F352102

General Info

Members Datasets Scaffolds Average Seq Length
239 164 478 219

Family's Representative Sequence

Representative Sequence 3300035118|Ga0373954_0000179|Ga0373954_0000179_11855_12562
Length 235
Sequence MFFHGRQYIESAMPISLRRFAAIETSTEWCSVALWSDGEVRAIERRAGNRHSELALPMLERLLDSPKKDFADLDAVAFGAGPGSFTGLRIACGLAQGLAFARALPVLGVSTLEALAEASGATRVVACIDARMREVYYAALERRAGRWHEVIASQCVPPQSAPRPPGEGWIGCGNGFAAYGNMGLNRILTDAHPSALAVARLAAPRLAAGEGVDAAAAVPVYLRDKVALTMEEQRR

Samples

Sample ID Description Type Environment
1 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
34 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
42 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
74 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
75 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
76 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
77 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
78 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
79 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
80 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
81 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
82 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
83 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
84 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
85 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
86 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
87 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
93 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
94 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
95 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
96 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
97 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
102 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
110 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
113 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
114 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
115 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
121 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
122 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
123 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
126 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 2.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373954_0000179 3300035118 Bacteria 22901
2 Ga0070690_100146582 3300005330 Bacteria 1607
3 Ga0070680_100150524 3300005336 Bacteria 1953
4 Ga0070680_100212880 3300005336 Bacteria 1631
5 Ga0070689_100155435 3300005340 Bacteria 1847
6 Ga0070689_100308696 3300005340 Bacteria 1318
7 Ga0070692_10220179 3300005345 Bacteria 1121
8 Ga0070692_10348317 3300005345 Bacteria 919
9 Ga0070669_100043999 3300005353 Bacteria 3253
10 Ga0070675_100152276 3300005354 Bacteria 1983
11 Ga0070675_100702992 3300005354 Bacteria 921
12 Ga0070714_100129439 3300005435 Bacteria 2254
13 Ga0070711_100114174 3300005439 Bacteria 1987
14 Ga0070705_100076125 3300005440 Bacteria 2045
15 Ga0070705_100100008 3300005440 Bacteria 1829
16 Ga0070700_100001025 3300005441 Bacteria 13799
17 Ga0070700_100041453 3300005441 Bacteria 2822
18 Ga0070694_100036117 3300005444 Bacteria 3271
19 Ga0070694_100201270 3300005444 Bacteria 1485
20 Ga0070662_100024226 3300005457 Bacteria 4179
21 Ga0070681_10001964 3300005458 Bacteria 18586
22 Ga0070681_10588172 3300005458 Bacteria 1027
23 Ga0068867_100002633 3300005459 Bacteria 12659
24 Ga0070699_100244353 3300005518 Bacteria 1603
25 Ga0070679_100032273 3300005530 Bacteria 5179
26 Ga0070697_100008727 3300005536 Bacteria 7913
27 Ga0070672_100546523 3300005543 Bacteria 1005
28 Ga0070686_100373190 3300005544 Bacteria 1078
29 Ga0070686_100402368 3300005544 Unclassified 1041
30 Ga0070695_100016040 3300005545 Bacteria 4530
31 Ga0070695_100121278 3300005545 Bacteria 1789
32 Ga0070696_100057353 3300005546 Bacteria 2718
33 Ga0070696_100059618 3300005546 Bacteria 2667
34 Ga0070696_100208003 3300005546 Bacteria 1464
35 Ga0070704_100057581 3300005549 Bacteria 2764
36 Ga0070704_100099647 3300005549 Bacteria 2186
37 Ga0070704_100285212 3300005549 Bacteria 1370
38 Ga0068866_10020870 3300005718 Bacteria 3009
39 Ga0081539_10000496 3300005985 Bacteria 82338
40 Ga0075428_100004159 3300006844 Bacteria 15930
41 Ga0075430_100000581 3300006846 Bacteria 27790
42 Ga0075430_100021550 3300006846 Bacteria 5477
43 Ga0075430_100080501 3300006846 Bacteria 2729
44 Ga0075430_100514568 3300006846 Bacteria 988
45 Ga0075431_100017149 3300006847 Bacteria 7361
46 Ga0075434_100000220 3300006871 Bacteria 39286
47 Ga0075434_100057957 3300006871 Bacteria 3850
48 Ga0075434_100232120 3300006871 Bacteria 1865
49 Ga0075429_100000617 3300006880 Bacteria 27413
50 Ga0075429_100049779 3300006880 Bacteria 3645
51 Ga0068865_100074074 3300006881 Bacteria 2424
52 Ga0075436_100020812 3300006914 Bacteria 4500
53 Ga0075436_100073695 3300006914 Bacteria 2363
54 Ga0075436_100157397 3300006914 Bacteria 1601
55 Ga0099794_10067858 3300007265 Bacteria 1743
56 Ga0099795_10018500 3300007788 Bacteria 2240
57 Ga0111539_10079365 3300009094 Bacteria 3861
58 Ga0111539_10097767 3300009094 Bacteria 3449
59 Ga0111539_10116365 3300009094 Bacteria 3135
60 Ga0111539_10138291 3300009094 Bacteria 2852
61 Ga0111539_10294671 3300009094 Bacteria 1888
62 Ga0114129_10004930 3300009147 Bacteria 18832
63 Ga0114129_11817145 3300009147 Bacteria 741
64 Ga0105243_10014194 3300009148 Bacteria 6029
65 Ga0105249_10237528 3300009553 Bacteria 1800
66 Ga0157378_10741441 3300013297 Bacteria 1004
67 Ga0157378_11302046 3300013297 Bacteria 768
68 Ga0157380_10000634 3300014326 Bacteria 21652
69 Ga0213871_10069173 3300021441 Unclassified 995
70 Ga0207653_10091474 3300025885 Bacteria 1066
71 Ga0207682_10206423 3300025893 Bacteria 905
72 Ga0207642_10048171 3300025899 Bacteria 1909
73 Ga0207707_10738911 3300025912 Bacteria 824
74 Ga0207663_10067980 3300025916 Bacteria 2287
75 Ga0207660_10133152 3300025917 Bacteria 1894
76 Ga0207660_10202610 3300025917 Bacteria 1550
77 Ga0207660_10687456 3300025917 Unclassified 835
78 Ga0207662_10177775 3300025918 Bacteria 1368
79 Ga0207681_10143045 3300025923 Bacteria 1783
80 Ga0207659_10103979 3300025926 Bacteria 2147
81 Ga0207659_10123536 3300025926 Bacteria 1987
82 Ga0207706_10037158 3300025933 Bacteria 4325
83 Ga0207709_10003471 3300025935 Bacteria 9348
84 Ga0207670_10149972 3300025936 Bacteria 1729
85 Ga0207704_10000545 3300025938 Bacteria 16783
86 Ga0207704_10444010 3300025938 Bacteria 1034
87 Ga0207691_10171220 3300025940 Bacteria 1901
88 Ga0207689_10075100 3300025942 Bacteria 2778
89 Ga0207712_10001551 3300025961 Bacteria 15493
90 Ga0207712_10521837 3300025961 Bacteria 1018
91 Ga0207668_10048567 3300025972 Bacteria 2913
92 Ga0207677_10267480 3300026023 Bacteria 1397
93 Ga0207708_10131067 3300026075 Bacteria 1960
94 Ga0207708_10164497 3300026075 Bacteria 1754
95 Ga0207648_10000297 3300026089 Bacteria 54091
96 Ga0207674_10097735 3300026116 Bacteria 2920
97 Ga0207675_100033928 3300026118 Bacteria 4756
98 Ga0207675_100653408 3300026118 Bacteria 1058
99 Ga0207675_101097716 3300026118 Bacteria 815
100 Ga0209996_1002975 3300027395 Bacteria 2115
101 Ga0209999_1023259 3300027543 Bacteria 1142
102 Ga0207428_10018177 3300027907 Bacteria 6011
103 Ga0207428_10064705 3300027907 Bacteria 2887
104 Ga0207428_10067453 3300027907 Bacteria 2817
105 Ga0268265_10001755 3300028380 Bacteria 17430
106 Ga0268265_10306869 3300028380 Unclassified 1431
107 Ga0307405_10392307 3300031731 Bacteria 1084
108 Ga0307413_10180319 3300031824 Bacteria 1505
109 Ga0307412_10170727 3300031911 Bacteria 1626
110 Ga0307416_100063827 3300032002 Bacteria 3018
111 Ga0307416_100361223 3300032002 Bacteria 1474
112 Ga0307411_10104792 3300032005 Bacteria 2009
113 Ga0307411_10144202 3300032005 Bacteria 1760
114 Ga0373950_0004974 3300034818 Bacteria 1968
115 Ga0373959_0049298 3300034820 Bacteria 905
116 Ga0373944_0022878 3300035089 Bacteria 1819
117 Ga0373951_0001250 3300035091 Bacteria 6721
118 Ga0373952_0036981 3300035092 Bacteria 1111
119 Ga0373932_0001204 3300035112 Bacteria 7370
120 Ga0373936_0022389 3300035113 Bacteria 2460
121 Ga0373939_0085548 3300035114 Bacteria 1056
122 Ga0373941_0002317 3300035115 Bacteria 4173
123 Ga0373945_0043153 3300035116 Bacteria 1635
124 Ga0373960_0012667 3300035121 Bacteria 2100
125 Ga0373960_0034827 3300035121 Bacteria 1426
126 Ga0373960_0036558 3300035121 Bacteria 1399
127 Ga0373942_0013761 3300035207 Bacteria 1950
128 Ga0373961_0009073 3300035241 Bacteria 2427
129 Ga0373962_0091748 3300035242 Bacteria 936
130 Ga0373924_0009674 3300035410 Bacteria 3541
131 Ga0373931_0005406 3300035691 Bacteria 5903
132 Ga0373931_0028444 3300035691 Bacteria 2862
133 Ga0373931_0117441 3300035691 Bacteria 1517
134 Ga0373933_0020015 3300035724 Bacteria 3789
135 Ga0373937_0000280 3300036401 Bacteria 48734
136 Ga0373937_0018939 3300036401 Bacteria 6156
137 Ga0373925_0040687 3300037068 Bacteria 3442
138 Ga0436360_0496134 3300039438 Unclassified 1699
139 Ga0439461_0013468 3300041410 Bacteria 1544
140 Ga0439443_004083 3300042003 Bacteria 1881
141 Ga0439435_0000073 3300042436 Bacteria 11906
142 Ga0439435_0003107 3300042436 Bacteria 3408
143 Ga0439460_0002164 3300042461 Bacteria 4714
144 Ga0466964_0218334 3300044706 Bacteria 924
145 Ga0451576_0023485 3300045051 Bacteria 6676
146 Ga0451576_0094987 3300045051 Bacteria 3101
147 Ga0451576_0353446 3300045051 Bacteria 1538
148 Ga0466967_0007551 3300045976 Bacteria 7854
149 Ga0495603_0031939 3300046455 Bacteria 3169
150 Ga0495641_0033195 3300046461 Bacteria 2452
151 Ga0495580_0001000 3300046472 Bacteria 24868
152 Ga0495582_0014856 3300046473 Bacteria 4279
153 Ga0495662_0006140 3300046476 Bacteria 6005
154 Ga0495662_0010943 3300046476 Bacteria 4437
155 Ga0495608_0001054 3300046511 Bacteria 19402
156 Ga0495608_0370911 3300046511 Bacteria 879
157 Ga0495618_0108393 3300046514 Bacteria 1779
158 Ga0495628_0008854 3300046516 Bacteria 8614
159 Ga0495630_0058963 3300046517 Bacteria 2879
160 Ga0495666_0081270 3300046526 Bacteria 1533
161 Ga0495642_0027409 3300046528 Bacteria 2267
162 Ga0495640_0003081 3300046533 Bacteria 13436
163 Ga0495640_0114460 3300046533 Bacteria 1758
164 Ga0495640_0231258 3300046533 Bacteria 1163
165 Ga0495586_0024530 3300046535 Bacteria 3224
166 Ga0495587_0356590 3300046536 Bacteria 815
167 Ga0495598_0074801 3300046537 Bacteria 1075
168 Ga0495621_0238379 3300046539 Bacteria 740
169 Ga0495645_0015468 3300046543 Bacteria 5427
170 Ga0495667_0008687 3300046559 Bacteria 6896
171 Ga0495634_0031419 3300046642 Bacteria 3658
172 Ga0495634_0426742 3300046642 Unclassified 784
173 Ga0495635_0055671 3300046663 Bacteria 2724
174 Ga0495659_0015059 3300046664 Bacteria 2539
175 Ga0495588_0018503 3300046674 Bacteria 3398
176 Ga0495599_0038806 3300046678 Bacteria 2993
177 Ga0495647_0000528 3300046681 Bacteria 11189
178 Ga0495647_0059263 3300046681 Bacteria 1507
179 Ga0495658_0011101 3300046683 Bacteria 4522
180 Ga0495658_0027203 3300046683 Bacteria 3074
181 Ga0495658_0076074 3300046683 Bacteria 1961
182 Ga0495669_0024090 3300046684 Bacteria 2652
183 Ga0495624_0108678 3300046690 Bacteria 1706
184 Ga0495600_0024258 3300046809 Bacteria 3904
185 Ga0495604_0029705 3300047317 Bacteria 4348
186 Ga0495676_0007685 3300047321 Bacteria 9888
187 Ga0495680_0008866 3300047322 Bacteria 9096
188 Ga0495684_0120032 3300047471 Bacteria 1981
189 Ga0501292_019803 3300049515 Bacteria 1080
190 Ga0501036_0157351 3300049572 Bacteria 1916
191 Ga0501037_0543063 3300049573 Bacteria 785
192 Ga0501038_0303487 3300049574 Bacteria 1252
193 Ga0501039_0198543 3300049575 Bacteria 1577
194 Ga0501041_0011817 3300049577 Bacteria 5166
195 Ga0501041_0415292 3300049577 Bacteria 853
196 Ga0501042_0004589 3300049578 Bacteria 8819
197 Ga0501042_0254736 3300049578 Bacteria 1267
198 Ga0501042_0329748 3300049578 Bacteria 1103
199 Ga0501043_0206284 3300049579 Bacteria 1524
200 Ga0501046_0121892 3300049580 Bacteria 1983
201 Ga0501067_0018085 3300049583 Bacteria 3903
202 Ga0501072_0018273 3300049588 Bacteria 5395
203 Ga0501072_0179035 3300049588 Bacteria 1691
204 Ga0501073_0374860 3300049589 Bacteria 983
205 Ga0501074_0235710 3300049590 Bacteria 1302
206 Ga0501075_0024370 3300049591 Bacteria 4436
207 Ga0501075_0487351 3300049591 Bacteria 940
208 Ga0501076_0006360 3300049592 Bacteria 8563
209 Ga0501076_0676224 3300049592 Bacteria 852
210 Ga0501077_0012506 3300049593 Bacteria 5314
211 Ga0501079_0115238 3300049741 Bacteria 2089
212 Ga0501079_0156019 3300049741 Bacteria 1779
213 Ga0501080_0113487 3300049742 Bacteria 2512
214 Ga0501081_0001948 3300049743 Bacteria 12829
215 Ga0501035_0186575 3300049822 Bacteria 1785
216 Ga0501045_0037203 3300049824 Bacteria 3537
217 nmdc:mga05p37_72_c1 3300050507 Bacteria 88725
218 nmdc:mga09592_1934_c1 3300050508 Bacteria 16664
219 nmdc:mga09592_36252_c1 3300050508 Bacteria 4131
220 nmdc:mga0qj67_155510_c1 3300050509 Bacteria 1856
221 nmdc:mga0qj67_17482_c1 3300050509 Bacteria 5453
222 nmdc:mga0qj67_369_c1 3300050509 Bacteria 30904
223 nmdc:mga06r32_29249_c1 3300050510 Bacteria 5162
224 nmdc:mga08y16_206203_c1 3300050511 Bacteria 2037
225 nmdc:mga08y16_75955_c1 3300050511 Bacteria 3502
226 nmdc:mga08y16_9724_c1 3300050511 Bacteria 10097
227 nmdc:mga0n895_379734_c1 3300050512 Bacteria 1430
228 nmdc:mga0n895_55706_c1 3300050512 Bacteria 3892
229 nmdc:mga0n895_979_c1 3300050512 Bacteria 20683
230 nmdc:mga0rr50_19478_c1 3300050513 Bacteria 4582
231 nmdc:mga0rr50_5917_c1 3300050513 Bacteria 7362
232 nmdc:mga08x19_28014_c1 3300050514 Bacteria 3526
233 nmdc:mga08x19_4768_c1 3300050514 Bacteria 8042
234 nmdc:mga08x19_82786_c1 3300050514 Bacteria 2109
235 nmdc:mga0a205_381779_c1 3300050515 Bacteria 1274
236 Ga0501084_0084709 3300054114 Bacteria 2661
237 Ga0501084_0320869 3300054114 Bacteria 1308
238 Ga0501082_0046569 3300060353 Bacteria 3738
239 Ga0530510_0105772 3300061734 Bacteria 2059
240 Ga0373954_0000179
241 Ga0070690_100146582
242 Ga0070680_100150524
243 Ga0070680_100212880
244 Ga0070689_100155435
245 Ga0070689_100308696
246 Ga0070692_10220179
247 Ga0070692_10348317
248 Ga0070669_100043999
249 Ga0070675_100152276
250 Ga0070675_100702992
251 Ga0070714_100129439
252 Ga0070711_100114174
253 Ga0070705_100076125
254 Ga0070705_100100008
255 Ga0070700_100001025
256 Ga0070700_100041453
257 Ga0070694_100036117
258 Ga0070694_100201270
259 Ga0070662_100024226
260 Ga0070681_10001964
261 Ga0070681_10588172
262 Ga0068867_100002633
263 Ga0070699_100244353
264 Ga0070679_100032273
265 Ga0070697_100008727
266 Ga0070672_100546523
267 Ga0070686_100373190
268 Ga0070686_100402368
269 Ga0070695_100016040
270 Ga0070695_100121278
271 Ga0070696_100057353
272 Ga0070696_100059618
273 Ga0070696_100208003
274 Ga0070704_100057581
275 Ga0070704_100099647
276 Ga0070704_100285212
277 Ga0068866_10020870
278 Ga0081539_10000496
279 Ga0075428_100004159
280 Ga0075430_100000581
281 Ga0075430_100021550
282 Ga0075430_100080501
283 Ga0075430_100514568
284 Ga0075431_100017149
285 Ga0075434_100000220
286 Ga0075434_100057957
287 Ga0075434_100232120
288 Ga0075429_100000617
289 Ga0075429_100049779
290 Ga0068865_100074074
291 Ga0075436_100020812
292 Ga0075436_100073695
293 Ga0075436_100157397
294 Ga0099794_10067858
295 Ga0099795_10018500
296 Ga0111539_10079365
297 Ga0111539_10097767
298 Ga0111539_10116365
299 Ga0111539_10138291
300 Ga0111539_10294671
301 Ga0114129_10004930
302 Ga0114129_11817145
303 Ga0105243_10014194
304 Ga0105249_10237528
305 Ga0157378_10741441
306 Ga0157378_11302046
307 Ga0157380_10000634
308 Ga0213871_10069173
309 Ga0207653_10091474
310 Ga0207682_10206423
311 Ga0207642_10048171
312 Ga0207707_10738911
313 Ga0207663_10067980
314 Ga0207660_10133152
315 Ga0207660_10202610
316 Ga0207660_10687456
317 Ga0207662_10177775
318 Ga0207681_10143045
319 Ga0207659_10103979
320 Ga0207659_10123536
321 Ga0207706_10037158
322 Ga0207709_10003471
323 Ga0207670_10149972
324 Ga0207704_10000545
325 Ga0207704_10444010
326 Ga0207691_10171220
327 Ga0207689_10075100
328 Ga0207712_10001551
329 Ga0207712_10521837
330 Ga0207668_10048567
331 Ga0207677_10267480
332 Ga0207708_10131067
333 Ga0207708_10164497
334 Ga0207648_10000297
335 Ga0207674_10097735
336 Ga0207675_100033928
337 Ga0207675_100653408
338 Ga0207675_101097716
339 Ga0209996_1002975
340 Ga0209999_1023259
341 Ga0207428_10018177
342 Ga0207428_10064705
343 Ga0207428_10067453
344 Ga0268265_10001755
345 Ga0268265_10306869
346 Ga0307405_10392307
347 Ga0307413_10180319
348 Ga0307412_10170727
349 Ga0307416_100063827
350 Ga0307416_100361223
351 Ga0307411_10104792
352 Ga0307411_10144202
353 Ga0373950_0004974
354 Ga0373959_0049298
355 Ga0373944_0022878
356 Ga0373951_0001250
357 Ga0373952_0036981
358 Ga0373932_0001204
359 Ga0373936_0022389
360 Ga0373939_0085548
361 Ga0373941_0002317
362 Ga0373945_0043153
363 Ga0373960_0012667
364 Ga0373960_0034827
365 Ga0373960_0036558
366 Ga0373942_0013761
367 Ga0373961_0009073
368 Ga0373962_0091748
369 Ga0373924_0009674
370 Ga0373931_0005406
371 Ga0373931_0028444
372 Ga0373931_0117441
373 Ga0373933_0020015
374 Ga0373937_0000280
375 Ga0373937_0018939
376 Ga0373925_0040687
377 Ga0436360_0496134
378 Ga0439461_0013468
379 Ga0439443_004083
380 Ga0439435_0000073
381 Ga0439435_0003107
382 Ga0439460_0002164
383 Ga0466964_0218334
384 Ga0451576_0023485
385 Ga0451576_0094987
386 Ga0451576_0353446
387 Ga0466967_0007551
388 Ga0495603_0031939
389 Ga0495641_0033195
390 Ga0495580_0001000
391 Ga0495582_0014856
392 Ga0495662_0006140
393 Ga0495662_0010943
394 Ga0495608_0001054
395 Ga0495608_0370911
396 Ga0495618_0108393
397 Ga0495628_0008854
398 Ga0495630_0058963
399 Ga0495666_0081270
400 Ga0495642_0027409
401 Ga0495640_0003081
402 Ga0495640_0114460
403 Ga0495640_0231258
404 Ga0495586_0024530
405 Ga0495587_0356590
406 Ga0495598_0074801
407 Ga0495621_0238379
408 Ga0495645_0015468
409 Ga0495667_0008687
410 Ga0495634_0031419
411 Ga0495634_0426742
412 Ga0495635_0055671
413 Ga0495659_0015059
414 Ga0495588_0018503
415 Ga0495599_0038806
416 Ga0495647_0000528
417 Ga0495647_0059263
418 Ga0495658_0011101
419 Ga0495658_0027203
420 Ga0495658_0076074
421 Ga0495669_0024090
422 Ga0495624_0108678
423 Ga0495600_0024258
424 Ga0495604_0029705
425 Ga0495676_0007685
426 Ga0495680_0008866
427 Ga0495684_0120032
428 Ga0501292_019803
429 Ga0501036_0157351
430 Ga0501037_0543063
431 Ga0501038_0303487
432 Ga0501039_0198543
433 Ga0501041_0011817
434 Ga0501041_0415292
435 Ga0501042_0004589
436 Ga0501042_0254736
437 Ga0501042_0329748
438 Ga0501043_0206284
439 Ga0501046_0121892
440 Ga0501067_0018085
441 Ga0501072_0018273
442 Ga0501072_0179035
443 Ga0501073_0374860
444 Ga0501074_0235710
445 Ga0501075_0024370
446 Ga0501075_0487351
447 Ga0501076_0006360
448 Ga0501076_0676224
449 Ga0501077_0012506
450 Ga0501079_0115238
451 Ga0501079_0156019
452 Ga0501080_0113487
453 Ga0501081_0001948
454 Ga0501035_0186575
455 Ga0501045_0037203
456 nmdc:mga05p37_72_c1
457 nmdc:mga09592_1934_c1
458 nmdc:mga09592_36252_c1
459 nmdc:mga0qj67_155510_c1
460 nmdc:mga0qj67_17482_c1
461 nmdc:mga0qj67_369_c1
462 nmdc:mga06r32_29249_c1
463 nmdc:mga08y16_206203_c1
464 nmdc:mga08y16_75955_c1
465 nmdc:mga08y16_9724_c1
466 nmdc:mga0n895_379734_c1
467 nmdc:mga0n895_55706_c1
468 nmdc:mga0n895_979_c1
469 nmdc:mga0rr50_19478_c1
470 nmdc:mga0rr50_5917_c1
471 nmdc:mga08x19_28014_c1
472 nmdc:mga08x19_4768_c1
473 nmdc:mga08x19_82786_c1
474 nmdc:mga0a205_381779_c1
475 Ga0501084_0084709
476 Ga0501084_0320869
477 Ga0501082_0046569
478 Ga0530510_0105772

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00814

TsaD

tRNA N6-adenosine threonylcarbamoyltransferase

43

169

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4y0w-assembly1.cif.gz_C-2 yeaz from pseudomonas aeruginosa 0.9075 2 201
5br9-assembly3.cif.gz_E crystal structure of an uncharacterized protein with similarity to peptidase yeaz from pseudomonas aeruginosa 0.9059 2 202
3r6m-assembly2.cif.gz_C crystal structure of vibrio parahaemolyticus yeaz 0.9047 1 193
4y0w-assembly1.cif.gz_B-2 yeaz from pseudomonas aeruginosa 0.9009 2 201
4y0w-assembly1.cif.gz_D-2 yeaz from pseudomonas aeruginosa 0.8983 1 198
ID Description Score Start End Superfamily
af_P76256_2_128_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9288 2 118 3.40.50.2000
af_P76256_2_102_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9266 2 96 3.30.420.40
5br9C01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.913 2 89 3.30.420.40
af_P76256_2_102_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8657 2 96 3.30.420.40
af_Q2FWL0_1_92_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8646 1 88 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A2N2S473-F1-model_v4 tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB 0.9502 1 160 GO:0002949
GO:0005829
GO:0016740
AF-A0A3C0NW18-F1-model_v4 tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB 0.947 1 204 GO:0002949
GO:0005829
GO:0016740
AF-A0A2N2SXZ9-F1-model_v4 tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB 0.945 1 161 GO:0002949
GO:0005829
GO:0016740
AF-A0A521VP35-F1-model_v4 tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB 0.9438 1 119 GO:0002949
GO:0005829
GO:0016740
AF-A0A2E1TLA6-F1-model_v4 tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB 0.9395 1 203 GO:0002949
GO:0005829
GO:0016740

Map