F351924

General Info

Members Datasets Scaffolds Average Seq Length
239 160 478 106

Family's Representative Sequence

Representative Sequence 3300012502|Ga0157347_1071814|Ga0157347_10718141
Length 115
Sequence VFGIGLPELAVIAFVAVIVFGPDRLPDYARQAGRFVRQMRNLARSAQDQLREELGPEYADLKLTDLDPRTAIRKHILEAIEADDLAAAEEARMAQRTGGPELKPDERPPYDLEAT

Samples

Sample ID Description Type Environment
1 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
88 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
89 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
90 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
91 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
92 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
93 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
94 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
95 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
96 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
97 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
100 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
101 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
102 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
103 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
104 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
140 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
153 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
154 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
155 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
156 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
160 2739367898 Nocardioides sp. CF479 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.42
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.6
Nodule 0
Rhizoplane 11.3
Rhizosphere 79.5
Stem 0
Stem Tuber 0
Unclassified 1.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157347_1071814 3300012502 Bacteria 513
2 LJQas_1005262 3300000549 Bacteria 1649
3 LJQas_1043978 3300000549 Bacteria 531
4 JGI24740J21852_10078337 3300001979 Bacteria 870
5 JGI24735J21928_10031824 3300002067 Bacteria 1563
6 rootH1_10170717 3300003323 Bacteria 2707
7 Ga0070658_10264259 3300005327 Bacteria 1462
8 Ga0070658_10584412 3300005327 Bacteria 967
9 Ga0070658_11098272 3300005327 Bacteria 692
10 Ga0070683_100022437 3300005329 Bacteria 5642
11 Ga0070683_100075777 3300005329 Bacteria 3144
12 Ga0070683_100160513 3300005329 Bacteria 2133
13 Ga0070683_100371146 3300005329 Bacteria 1363
14 Ga0070677_10660683 3300005333 Bacteria 585
15 Ga0068869_101466665 3300005334 Bacteria 605
16 Ga0070680_100111506 3300005336 Bacteria 2277
17 Ga0070682_100462178 3300005337 Bacteria 975
18 Ga0070682_100484097 3300005337 Bacteria 955
19 Ga0070682_101493818 3300005337 Bacteria 581
20 Ga0070660_100250129 3300005339 Bacteria 1445
21 Ga0070671_101037542 3300005355 Bacteria 719
22 Ga0070708_100123897 3300005445 Bacteria 2387
23 Ga0070678_100552963 3300005456 Bacteria 1022
24 Ga0070681_10094821 3300005458 Bacteria 2933
25 Ga0070706_102143598 3300005467 Bacteria 505
26 Ga0070707_100123140 3300005468 Bacteria 2518
27 Ga0070698_100001164 3300005471 Bacteria 29171
28 Ga0070699_101554330 3300005518 Bacteria 606
29 Ga0070679_100013245 3300005530 Bacteria 7893
30 Ga0070679_101660577 3300005530 Bacteria 587
31 Ga0070684_100236372 3300005535 Bacteria 1669
32 Ga0070684_100367204 3300005535 Bacteria 1325
33 Ga0070684_100893943 3300005535 Bacteria 832
34 Ga0070684_101480359 3300005535 Bacteria 640
35 Ga0070684_101593363 3300005535 Bacteria 616
36 Ga0068853_100129610 3300005539 Bacteria 2257
37 Ga0070665_100001445 3300005548 Bacteria 27861
38 Ga0070665_101351291 3300005548 Bacteria 722
39 Ga0068855_101399144 3300005563 Bacteria 721
40 Ga0070664_101087097 3300005564 Bacteria 753
41 Ga0068857_100360778 3300005577 Bacteria 1347
42 Ga0068857_100490354 3300005577 Bacteria 1152
43 Ga0070702_100576830 3300005615 Unclassified 839
44 Ga0068852_101154108 3300005616 Unclassified 795
45 Ga0068852_101563852 3300005616 Bacteria 682
46 Ga0068864_101573786 3300005618 Bacteria 661
47 Ga0068864_101747525 3300005618 Bacteria 627
48 Ga0068861_102384895 3300005719 Bacteria 532
49 Ga0068860_100942582 3300005843 Bacteria 880
50 Ga0075365_10292575 3300006038 Bacteria 1146
51 Ga0075365_10705525 3300006038 Bacteria 713
52 Ga0075364_10034302 3300006051 Bacteria 3273
53 Ga0075367_10071156 3300006178 Bacteria 2092
54 Ga0068865_100295741 3300006881 Bacteria 1294
55 Ga0068865_100394539 3300006881 Bacteria 1132
56 Ga0105245_10706754 3300009098 Bacteria 1041
57 Ga0105242_10810169 3300009176 Bacteria 928
58 Ga0105238_11276391 3300009551 Bacteria 760
59 Ga0105238_11813339 3300009551 Bacteria 642
60 Ga0105246_10303478 3300011119 Bacteria 1290
61 Ga0105246_12182187 3300011119 Bacteria 538
62 Ga0157317_1012463 3300012475 Bacteria 674
63 Ga0157369_10522417 3300013105 Bacteria 1228
64 Ga0157374_10359202 3300013296 Bacteria 1448
65 Ga0157372_13152215 3300013307 Bacteria 526
66 Ga0157375_10106751 3300013308 Bacteria 2892
67 Ga0157375_10457264 3300013308 Bacteria 1442
68 Ga0157375_10473570 3300013308 Bacteria 1417
69 Ga0157380_11100860 3300014326 Bacteria 833
70 Ga0163161_10431333 3300017792 Bacteria 1062
71 Ga0206353_11329424 3300020082 Bacteria 1333
72 Ga0213876_10184442 3300021384 Bacteria 1110
73 Ga0207688_10005348 3300025901 Bacteria 6971
74 Ga0207688_10203353 3300025901 Bacteria 1188
75 Ga0207688_10238385 3300025901 Unclassified 1100
76 Ga0207688_10725210 3300025901 Bacteria 629
77 Ga0207647_10019976 3300025904 Bacteria 4497
78 Ga0207643_10270752 3300025908 Bacteria 1051
79 Ga0207705_10188962 3300025909 Bacteria 1557
80 Ga0207705_10392262 3300025909 Bacteria 1073
81 Ga0207707_10118728 3300025912 Bacteria 2311
82 Ga0207707_11589248 3300025912 Bacteria 515
83 Ga0207671_10278803 3300025914 Bacteria 1318
84 Ga0207660_10142596 3300025917 Bacteria 1833
85 Ga0207662_10058383 3300025918 Bacteria 2309
86 Ga0207657_10064880 3300025919 Bacteria 3115
87 Ga0207657_10446914 3300025919 Bacteria 1014
88 Ga0207652_10050762 3300025921 Bacteria 3554
89 Ga0207652_10472202 3300025921 Bacteria 1130
90 Ga0207646_10293969 3300025922 Bacteria 1468
91 Ga0207694_10818265 3300025924 Bacteria 787
92 Ga0207687_11027961 3300025927 Bacteria 707
93 Ga0207690_11063002 3300025932 Bacteria 674
94 Ga0207709_10642357 3300025935 Bacteria 844
95 Ga0207669_11355198 3300025937 Bacteria 605
96 Ga0207704_10078092 3300025938 Bacteria 2128
97 Ga0207704_10985149 3300025938 Bacteria 712
98 Ga0207711_11523277 3300025941 Bacteria 612
99 Ga0207661_10004243 3300025944 Bacteria 10032
100 Ga0207661_10098358 3300025944 Bacteria 2452
101 Ga0207661_10135559 3300025944 Bacteria 2114
102 Ga0207661_10350115 3300025944 Bacteria 1333
103 Ga0207679_10245337 3300025945 Bacteria 1520
104 Ga0207679_11587136 3300025945 Bacteria 600
105 Ga0207667_10525651 3300025949 Bacteria 1198
106 Ga0207712_11839021 3300025961 Bacteria 543
107 Ga0207702_10209125 3300026078 Bacteria 1813
108 Ga0207641_10152933 3300026088 Bacteria 2091
109 Ga0207641_10632833 3300026088 Bacteria 1050
110 Ga0207676_10282421 3300026095 Bacteria 1508
111 Ga0207676_11553895 3300026095 Bacteria 659
112 Ga0207675_100890189 3300026118 Bacteria 906
113 Ga0207683_10308669 3300026121 Bacteria 1448
114 Ga0268266_10025072 3300028379 Bacteria 5075
115 Ga0268264_10752824 3300028381 Bacteria 971
116 Ga0307406_11540077 3300031901 Bacteria 586
117 Ga0307407_10712057 3300031903 Bacteria 757
118 Ga0307412_10021274 3300031911 Bacteria 3960
119 Ga0307416_101391615 3300032002 Bacteria 807
120 Ga0395898_0596734 3300037466 Bacteria 1047
121 Ga0395905_0014732 3300037471 Bacteria 7456
122 Ga0395901_0087162 3300038443 Bacteria 3264
123 Ga0436365_0173733 3300039437 Bacteria 1579
124 Ga0439453_0053557 3300041408 Bacteria 821
125 Ga0439461_0043465 3300041410 Bacteria 977
126 Ga0439465_0175898 3300041413 Bacteria 773
127 Ga0451791_0811428 3300041451 Bacteria 1184
128 Ga0451797_0464193 3300041453 Bacteria 1778
129 Ga0451800_1502426 3300041459 Bacteria 1000
130 Ga0451802_0769746 3300041460 Bacteria 663
131 Ga0451837_1587575 3300041494 Bacteria 694
132 Ga0451841_0070710 3300041498 Bacteria 612
133 Ga0451851_0183696 3300041507 Bacteria 626
134 Ga0451843_0356303 3300041509 Bacteria 698
135 Ga0451843_1156121 3300041509 Bacteria 712
136 Ga0451853_1099726 3300041512 Bacteria 1488
137 Ga0451853_3002367 3300041512 Bacteria 526
138 Ga0439431_0024880 3300041997 Bacteria 1459
139 Ga0439432_199224 3300042006 Bacteria 581
140 Ga0439449_0174618 3300042007 Bacteria 803
141 Ga0450906_061333 3300042145 Bacteria 669
142 Ga0450909_024112 3300042185 Bacteria 913
143 Ga0439434_0004860 3300042435 Bacteria 3929
144 Ga0466965_0005054 3300044683 Bacteria 5913
145 Ga0466965_0261520 3300044683 Bacteria 930
146 Ga0466966_0885759 3300044684 Bacteria 538
147 Ga0466961_0092270 3300044693 Bacteria 1911
148 Ga0466963_0101106 3300044694 Bacteria 1974
149 Ga0466963_0136552 3300044694 Bacteria 1697
150 Ga0466963_0208424 3300044694 Bacteria 1368
151 Ga0466964_0059608 3300044706 Bacteria 1585
152 Ga0466964_0066859 3300044706 Bacteria 1509
153 Ga0466971_0120891 3300044719 Bacteria 1212
154 Ga0466970_0010110 3300044765 Bacteria 4780
155 Ga0466970_0026830 3300044765 Bacteria 3019
156 Ga0466970_0068956 3300044765 Bacteria 1900
157 Ga0466957_0113323 3300044842 Bacteria 1722
158 Ga0466960_0055109 3300044901 Bacteria 1933
159 Ga0466960_0090956 3300044901 Bacteria 1555
160 Ga0466960_0526659 3300044901 Bacteria 695
161 Ga0466959_0848338 3300045049 Bacteria 610
162 Ga0451576_1048261 3300045051 Bacteria 854
163 Ga0466967_0010629 3300045976 Bacteria 6916
164 Ga0466967_0018806 3300045976 Bacteria 5535
165 Ga0466967_0026560 3300045976 Bacteria 4798
166 Ga0466967_0062795 3300045976 Bacteria 3299
167 Ga0466967_0157683 3300045976 Bacteria 2128
168 Ga0466967_0223065 3300045976 Bacteria 1792
169 Ga0495603_0906767 3300046455 Bacteria 501
170 Ga0495641_0059397 3300046461 Bacteria 1729
171 Ga0495587_0753489 3300046536 Unclassified 533
172 Ga0495647_0151527 3300046681 Bacteria 994
173 Ga0495658_0755811 3300046683 Bacteria 623
174 Ga0495600_0811295 3300046809 Bacteria 557
175 Ga0496100_0133737 3300048903 Bacteria 1750
176 Ga0496100_0690726 3300048903 Bacteria 796
177 Ga0496100_0898113 3300048903 Bacteria 696
178 Ga0496101_0761632 3300048904 Bacteria 764
179 Ga0496101_1513137 3300048904 Bacteria 522
180 Ga0496102_0120943 3300048905 Bacteria 2445
181 Ga0496103_0752063 3300048906 Bacteria 616
182 Ga0496106_0271912 3300048909 Bacteria 1357
183 Ga0496106_0591375 3300048909 Bacteria 889
184 Ga0496108_0005909 3300048911 Bacteria 9919
185 Ga0496108_0128051 3300048911 Bacteria 2181
186 Ga0496109_0038633 3300048912 Bacteria 4316
187 Ga0496110_0091839 3300048913 Bacteria 2716
188 Ga0496110_0119632 3300048913 Bacteria 2372
189 Ga0496111_0012839 3300048914 Bacteria 5683
190 Ga0496111_0785942 3300048914 Bacteria 689
191 Ga0496113_0499963 3300048916 Bacteria 976
192 Ga0496114_0046161 3300048917 Bacteria 3620
193 Ga0496114_0108587 3300048917 Bacteria 2375
194 Ga0496114_0141349 3300048917 Bacteria 2084
195 Ga0496114_0164962 3300048917 Bacteria 1928
196 Ga0496114_0371007 3300048917 Bacteria 1267
197 Ga0496114_0923638 3300048917 Bacteria 754
198 Ga0501034_0007962 3300049571 Bacteria 11255
199 Ga0501034_0015562 3300049571 Bacteria 7812
200 Ga0501036_0597483 3300049572 Bacteria 915
201 Ga0501037_0186943 3300049573 Bacteria 1468
202 Ga0501039_0926886 3300049575 Bacteria 678
203 Ga0501047_0207375 3300049581 Bacteria 1819
204 Ga0501067_0000686 3300049583 Bacteria 18205
205 Ga0501067_0004213 3300049583 Bacteria 7934
206 Ga0501068_0022348 3300049584 Bacteria 3698
207 Ga0501068_0030192 3300049584 Bacteria 3214
208 Ga0501068_1092622 3300049584 Bacteria 527
209 Ga0501070_0006602 3300049586 Bacteria 9870
210 Ga0501070_0028318 3300049586 Bacteria 4698
211 Ga0501070_0071218 3300049586 Bacteria 2878
212 Ga0501071_0010089 3300049587 Bacteria 6315
213 Ga0501071_0045507 3300049587 Bacteria 3151
214 Ga0501073_0001875 3300049589 Bacteria 15649
215 Ga0501073_0003191 3300049589 Bacteria 12301
216 Ga0501074_0004426 3300049590 Bacteria 10045
217 Ga0501074_0005811 3300049590 Bacteria 8897
218 Ga0501077_0006695 3300049593 Bacteria 7085
219 Ga0501077_0032619 3300049593 Bacteria 3315
220 Ga0501079_0010981 3300049741 Bacteria 6902
221 Ga0501080_0001653 3300049742 Bacteria 18957
222 Ga0501080_0006536 3300049742 Bacteria 10476
223 Ga0501081_0405036 3300049743 Bacteria 1010
224 Ga0501083_0031627 3300049744 Bacteria 3631
225 Ga0501035_0372943 3300049822 Bacteria 1191
226 Ga0501044_0632916 3300049823 Bacteria 960
227 nmdc:mga00v17_77767_c1 3300050491 Bacteria 2066
228 nmdc:mga0yw44_214744_c1 3300050492 Bacteria 1273
229 nmdc:mga0yw44_246150_c1 3300050492 Bacteria 1189
230 nmdc:mga0yw44_787777_c1 3300050492 Bacteria 646
231 nmdc:mga06z11_62267_c1 3300050494 Bacteria 1948
232 nmdc:mga04h51_245894_c1 3300050495 Bacteria 715
233 Ga0500556_0000484 3300053104 Bacteria 27762
234 Ga0501084_0031607 3300054114 Bacteria 4425
235 Ga0501084_0206299 3300054114 Bacteria 1658
236 Ga0501082_0004748 3300060353 Bacteria 11855
237 Ga0466962_0064303 3300061719 Bacteria 1752
238 Ga0466962_0618359 3300061719 Bacteria 553
239 2740167868 2739367898 Bacteria 4367674
240 Ga0157347_1071814
241 LJQas_1005262
242 LJQas_1043978
243 JGI24740J21852_10078337
244 JGI24735J21928_10031824
245 rootH1_10170717
246 Ga0070658_10264259
247 Ga0070658_10584412
248 Ga0070658_11098272
249 Ga0070683_100022437
250 Ga0070683_100075777
251 Ga0070683_100160513
252 Ga0070683_100371146
253 Ga0070677_10660683
254 Ga0068869_101466665
255 Ga0070680_100111506
256 Ga0070682_100462178
257 Ga0070682_100484097
258 Ga0070682_101493818
259 Ga0070660_100250129
260 Ga0070671_101037542
261 Ga0070708_100123897
262 Ga0070678_100552963
263 Ga0070681_10094821
264 Ga0070706_102143598
265 Ga0070707_100123140
266 Ga0070698_100001164
267 Ga0070699_101554330
268 Ga0070679_100013245
269 Ga0070679_101660577
270 Ga0070684_100236372
271 Ga0070684_100367204
272 Ga0070684_100893943
273 Ga0070684_101480359
274 Ga0070684_101593363
275 Ga0068853_100129610
276 Ga0070665_100001445
277 Ga0070665_101351291
278 Ga0068855_101399144
279 Ga0070664_101087097
280 Ga0068857_100360778
281 Ga0068857_100490354
282 Ga0070702_100576830
283 Ga0068852_101154108
284 Ga0068852_101563852
285 Ga0068864_101573786
286 Ga0068864_101747525
287 Ga0068861_102384895
288 Ga0068860_100942582
289 Ga0075365_10292575
290 Ga0075365_10705525
291 Ga0075364_10034302
292 Ga0075367_10071156
293 Ga0068865_100295741
294 Ga0068865_100394539
295 Ga0105245_10706754
296 Ga0105242_10810169
297 Ga0105238_11276391
298 Ga0105238_11813339
299 Ga0105246_10303478
300 Ga0105246_12182187
301 Ga0157317_1012463
302 Ga0157369_10522417
303 Ga0157374_10359202
304 Ga0157372_13152215
305 Ga0157375_10106751
306 Ga0157375_10457264
307 Ga0157375_10473570
308 Ga0157380_11100860
309 Ga0163161_10431333
310 Ga0206353_11329424
311 Ga0213876_10184442
312 Ga0207688_10005348
313 Ga0207688_10203353
314 Ga0207688_10238385
315 Ga0207688_10725210
316 Ga0207647_10019976
317 Ga0207643_10270752
318 Ga0207705_10188962
319 Ga0207705_10392262
320 Ga0207707_10118728
321 Ga0207707_11589248
322 Ga0207671_10278803
323 Ga0207660_10142596
324 Ga0207662_10058383
325 Ga0207657_10064880
326 Ga0207657_10446914
327 Ga0207652_10050762
328 Ga0207652_10472202
329 Ga0207646_10293969
330 Ga0207694_10818265
331 Ga0207687_11027961
332 Ga0207690_11063002
333 Ga0207709_10642357
334 Ga0207669_11355198
335 Ga0207704_10078092
336 Ga0207704_10985149
337 Ga0207711_11523277
338 Ga0207661_10004243
339 Ga0207661_10098358
340 Ga0207661_10135559
341 Ga0207661_10350115
342 Ga0207679_10245337
343 Ga0207679_11587136
344 Ga0207667_10525651
345 Ga0207712_11839021
346 Ga0207702_10209125
347 Ga0207641_10152933
348 Ga0207641_10632833
349 Ga0207676_10282421
350 Ga0207676_11553895
351 Ga0207675_100890189
352 Ga0207683_10308669
353 Ga0268266_10025072
354 Ga0268264_10752824
355 Ga0307406_11540077
356 Ga0307407_10712057
357 Ga0307412_10021274
358 Ga0307416_101391615
359 Ga0395898_0596734
360 Ga0395905_0014732
361 Ga0395901_0087162
362 Ga0436365_0173733
363 Ga0439453_0053557
364 Ga0439461_0043465
365 Ga0439465_0175898
366 Ga0451791_0811428
367 Ga0451797_0464193
368 Ga0451800_1502426
369 Ga0451802_0769746
370 Ga0451837_1587575
371 Ga0451841_0070710
372 Ga0451851_0183696
373 Ga0451843_0356303
374 Ga0451843_1156121
375 Ga0451853_1099726
376 Ga0451853_3002367
377 Ga0439431_0024880
378 Ga0439432_199224
379 Ga0439449_0174618
380 Ga0450906_061333
381 Ga0450909_024112
382 Ga0439434_0004860
383 Ga0466965_0005054
384 Ga0466965_0261520
385 Ga0466966_0885759
386 Ga0466961_0092270
387 Ga0466963_0101106
388 Ga0466963_0136552
389 Ga0466963_0208424
390 Ga0466964_0059608
391 Ga0466964_0066859
392 Ga0466971_0120891
393 Ga0466970_0010110
394 Ga0466970_0026830
395 Ga0466970_0068956
396 Ga0466957_0113323
397 Ga0466960_0055109
398 Ga0466960_0090956
399 Ga0466960_0526659
400 Ga0466959_0848338
401 Ga0451576_1048261
402 Ga0466967_0010629
403 Ga0466967_0018806
404 Ga0466967_0026560
405 Ga0466967_0062795
406 Ga0466967_0157683
407 Ga0466967_0223065
408 Ga0495603_0906767
409 Ga0495641_0059397
410 Ga0495587_0753489
411 Ga0495647_0151527
412 Ga0495658_0755811
413 Ga0495600_0811295
414 Ga0496100_0133737
415 Ga0496100_0690726
416 Ga0496100_0898113
417 Ga0496101_0761632
418 Ga0496101_1513137
419 Ga0496102_0120943
420 Ga0496103_0752063
421 Ga0496106_0271912
422 Ga0496106_0591375
423 Ga0496108_0005909
424 Ga0496108_0128051
425 Ga0496109_0038633
426 Ga0496110_0091839
427 Ga0496110_0119632
428 Ga0496111_0012839
429 Ga0496111_0785942
430 Ga0496113_0499963
431 Ga0496114_0046161
432 Ga0496114_0108587
433 Ga0496114_0141349
434 Ga0496114_0164962
435 Ga0496114_0371007
436 Ga0496114_0923638
437 Ga0501034_0007962
438 Ga0501034_0015562
439 Ga0501036_0597483
440 Ga0501037_0186943
441 Ga0501039_0926886
442 Ga0501047_0207375
443 Ga0501067_0000686
444 Ga0501067_0004213
445 Ga0501068_0022348
446 Ga0501068_0030192
447 Ga0501068_1092622
448 Ga0501070_0006602
449 Ga0501070_0028318
450 Ga0501070_0071218
451 Ga0501071_0010089
452 Ga0501071_0045507
453 Ga0501073_0001875
454 Ga0501073_0003191
455 Ga0501074_0004426
456 Ga0501074_0005811
457 Ga0501077_0006695
458 Ga0501077_0032619
459 Ga0501079_0010981
460 Ga0501080_0001653
461 Ga0501080_0006536
462 Ga0501081_0405036
463 Ga0501083_0031627
464 Ga0501035_0372943
465 Ga0501044_0632916
466 nmdc:mga00v17_77767_c1
467 nmdc:mga0yw44_214744_c1
468 nmdc:mga0yw44_246150_c1
469 nmdc:mga0yw44_787777_c1
470 nmdc:mga06z11_62267_c1
471 nmdc:mga04h51_245894_c1
472 Ga0500556_0000484
473 Ga0501084_0031607
474 Ga0501084_0206299
475 Ga0501082_0004748
476 Ga0466962_0064303
477 Ga0466962_0618359
478 2740167868

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02416

TatA_B_E

mttA/Hcf106 family

4

57

0.94

Map