F351432

General Info

Members Datasets Scaffolds Average Seq Length
238 150 237 167

Family's Representative Sequence

Representative Sequence 3300053156|Ga0500622_0000740|Ga0500622_0000740_20232_20807
Length 191
Sequence LSQGGGYFVSETKKHAIMELIQSLLKEMEQEAQTTRKMLSIIPNDKFNWQPHPKSMTVIRLATHIAELPSWVSMVLTTDELDFAANPYDPKVIKNVDELVACFEESLADGKAHLEKAKLSQFDEKWTLRNGDDIYDVSLKGEVIRMAYSQIVHHRAQLGVFLRLLDVPIPGSYGPSADEEFTVAVVDTPTL

Samples

Sample ID Description Type Environment
1 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
68 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
69 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
117 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
124 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
129 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
130 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
131 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
134 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
135 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
136 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
137 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
138 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
139 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
140 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
141 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
142 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
143 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
144 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
145 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
146 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
147 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
148 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
149 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
150 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.66
Nodule 0
Rhizoplane 0
Rhizosphere 84.03
Stem 0
Stem Tuber 0
Unclassified 6.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1013561 3300001904 Bacteria 1315
2 JGI24744J21845_10047403 3300002077 Bacteria 796
3 rootH1_10055063 3300003316 Bacteria 4150
4 rootH2_10015983 3300003320 Bacteria 11340
5 rootL2_10019262 3300003322 Bacteria 10344
6 rootL2_10051491 3300003322 Bacteria 9429
7 rootL2_10079430 3300003322 Bacteria 1895
8 rootL2_10084692 3300003322 Bacteria 4931
9 rootL2_10142229 3300003322 Unclassified 2465
10 rootL2_10211184 3300003322 Bacteria 1803
11 rootH1_10074025 3300003323 Bacteria 3463
12 Ga0055542_1001896 3300003762 Bacteria 8278
13 Ga0065714_10112689 3300005288 Bacteria 1452
14 Ga0070676_10000410 3300005328 Bacteria 20111
15 Ga0070682_100080908 3300005337 Bacteria 2102
16 Ga0068868_100009773 3300005338 Bacteria 6922
17 Ga0068868_100132995 3300005338 Bacteria 2037
18 Ga0068868_101050545 3300005338 Unclassified 747
19 Ga0070660_100030277 3300005339 Bacteria 4061
20 Ga0070671_100201200 3300005355 Bacteria 1689
21 Ga0070671_101121926 3300005355 Bacteria 691
22 Ga0070673_100000522 3300005364 Bacteria 20614
23 Ga0070659_100000262 3300005366 Bacteria 41533
24 Ga0070659_100043851 3300005366 Bacteria 3500
25 Ga0070713_101958635 3300005436 Unclassified 568
26 Ga0070694_100851356 3300005444 Bacteria 750
27 Ga0070678_100000499 3300005456 Bacteria 18861
28 Ga0070662_100000031 3300005457 Bacteria 79515
29 Ga0070662_100813900 3300005457 Bacteria 794
30 Ga0070681_10161350 3300005458 Bacteria 2166
31 Ga0068867_100000540 3300005459 Bacteria 24870
32 Ga0070679_100061696 3300005530 Unclassified 3737
33 Ga0070679_100103518 3300005530 Bacteria 2833
34 Ga0068853_100024906 3300005539 Bacteria 5021
35 Ga0068853_100046442 3300005539 Bacteria 3724
36 Ga0068853_100089574 3300005539 Unclassified 2702
37 Ga0068853_100104807 3300005539 Bacteria 2504
38 Ga0070672_101055879 3300005543 Bacteria 721
39 Ga0070693_100564757 3300005547 Unclassified 816
40 Ga0070665_100000034 3300005548 Bacteria 324289
41 Ga0070665_100904241 3300005548 Bacteria 895
42 Ga0068855_100001781 3300005563 Bacteria 26916
43 Ga0068855_100012308 3300005563 Bacteria 10336
44 Ga0068855_100019405 3300005563 Bacteria 8169
45 Ga0068855_100073456 3300005563 Bacteria 3973
46 Ga0068855_100252380 3300005563 Bacteria 1967
47 Ga0068855_100286841 3300005563 Bacteria 1826
48 Ga0068855_100461013 3300005563 Bacteria 1386
49 Ga0070664_100994730 3300005564 Bacteria 788
50 Ga0068857_101863316 3300005577 Unclassified 589
51 Ga0068854_100400701 3300005578 Bacteria 1135
52 Ga0068856_100000194 3300005614 Bacteria 64170
53 Ga0068856_100137754 3300005614 Bacteria 2447
54 Ga0068852_100000630 3300005616 Bacteria 23035
55 Ga0068859_100068027 3300005617 Bacteria 3597
56 Ga0068864_100283782 3300005618 Bacteria 1546
57 Ga0068870_10053444 3300005840 Bacteria 2145
58 Ga0068862_100007183 3300005844 Bacteria 9249
59 Ga0075366_10218450 3300006195 Bacteria 1161
60 Ga0097621_100004207 3300006237 Bacteria 9988
61 Ga0097621_101277261 3300006237 Unclassified 693
62 Ga0068871_100000284 3300006358 Bacteria 35264
63 Ga0068865_100000029 3300006881 Bacteria 91199
64 Ga0097620_100068028 3300006931 Bacteria 3597
65 Ga0105251_10343687 3300009011 Bacteria 680
66 Ga0105240_10000321 3300009093 Bacteria 90931
67 Ga0105240_10002040 3300009093 Bacteria 33263
68 Ga0105240_10009993 3300009093 Bacteria 13373
69 Ga0105240_10076238 3300009093 Unclassified 4134
70 Ga0105240_10499568 3300009093 Bacteria 1353
71 Ga0105245_10813533 3300009098 Bacteria 973
72 Ga0105241_10002762 3300009174 Bacteria 13150
73 Ga0105241_10005289 3300009174 Bacteria 9534
74 Ga0105241_10044946 3300009174 Bacteria 3349
75 Ga0105242_10017131 3300009176 Bacteria 5642
76 Ga0105242_11411071 3300009176 Bacteria 724
77 Ga0105237_10001073 3300009545 Bacteria 36751
78 Ga0105237_10002934 3300009545 Bacteria 20647
79 Ga0105237_10025704 3300009545 Bacteria 6019
80 Ga0105237_10119269 3300009545 Bacteria 2632
81 Ga0105238_10006339 3300009551 Bacteria 11764
82 Ga0105238_10229129 3300009551 Bacteria 1835
83 Ga0105239_10000813 3300010375 Bacteria 44289
84 Ga0105239_10049000 3300010375 Bacteria 4632
85 Ga0105239_10085840 3300010375 Bacteria 3469
86 Ga0105239_10135086 3300010375 Bacteria 2746
87 Ga0105239_10179355 3300010375 Bacteria 2370
88 Ga0105239_10379748 3300010375 Bacteria 1597
89 Ga0105246_10517252 3300011119 Bacteria 1016
90 Ga0105246_10712398 3300011119 Unclassified 881
91 Ga0157373_10007902 3300013100 Bacteria 7915
92 Ga0157373_10047393 3300013100 Bacteria 3065
93 Ga0157371_10361425 3300013102 Bacteria 1058
94 Ga0157370_10174702 3300013104 Bacteria 1997
95 Ga0157370_11497166 3300013104 Bacteria 607
96 Ga0157369_10048822 3300013105 Unclassified 4591
97 Ga0157369_10138279 3300013105 Unclassified 2578
98 Ga0157374_10000051 3300013296 Bacteria 126876
99 Ga0157374_10000857 3300013296 Bacteria 26620
100 Ga0157378_10018718 3300013297 Bacteria 6088
101 Ga0157378_10071322 3300013297 Bacteria 3120
102 Ga0163162_10000018 3300013306 Bacteria 226257
103 Ga0163162_10123509 3300013306 Unclassified 2694
104 Ga0163162_11847687 3300013306 Bacteria 691
105 Ga0157372_10159929 3300013307 Unclassified 2603
106 Ga0157372_10810773 3300013307 Unclassified 1087
107 Ga0157372_11484124 3300013307 Unclassified 781
108 Ga0157375_10003658 3300013308 Bacteria 13334
109 Ga0157375_10471291 3300013308 Bacteria 1421
110 Ga0163163_10144048 3300014325 Bacteria 2426
111 Ga0157377_10126039 3300014745 Bacteria 1558
112 Ga0157379_10942197 3300014968 Bacteria 821
113 Ga0157376_10110371 3300014969 Bacteria 2420
114 Ga0157376_11990155 3300014969 Unclassified 619
115 Ga0163161_10145064 3300017792 Unclassified 1800
116 Ga0163161_11029507 3300017792 Unclassified 704
117 Ga0209258_100161 3300025242 Bacteria 151992
118 Ga0209646_1017652 3300025246 Bacteria 1050
119 Ga0209026_1000304 3300025250 Bacteria 53704
120 Ga0209148_1000161 3300025254 Bacteria 138759
121 Ga0209455_1001192 3300025272 Bacteria 12421
122 Ga0209257_1000004 3300025304 Bacteria 1678347
123 Ga0207647_10000081 3300025904 Bacteria 71603
124 Ga0207645_10000463 3300025907 Bacteria 33593
125 Ga0207643_10244649 3300025908 Bacteria 1104
126 Ga0207705_10000028 3300025909 Bacteria 240636
127 Ga0207705_10041279 3300025909 Bacteria 3310
128 Ga0207705_10147789 3300025909 Bacteria 1759
129 Ga0207654_10002416 3300025911 Bacteria 9540
130 Ga0207654_10014617 3300025911 Bacteria 4057
131 Ga0207654_10069095 3300025911 Bacteria 2092
132 Ga0207654_10111085 3300025911 Bacteria 1706
133 Ga0207654_10247032 3300025911 Bacteria 1194
134 Ga0207654_10521832 3300025911 Bacteria 841
135 Ga0207695_10000197 3300025913 Bacteria 168837
136 Ga0207695_10007748 3300025913 Bacteria 13606
137 Ga0207695_10026586 3300025913 Bacteria 6458
138 Ga0207695_10052739 3300025913 Unclassified 4258
139 Ga0207695_10323599 3300025913 Bacteria 1431
140 Ga0207695_11058589 3300025913 Bacteria 691
141 Ga0207671_10000516 3300025914 Bacteria 52391
142 Ga0207671_10029961 3300025914 Bacteria 4061
143 Ga0207671_10187732 3300025914 Unclassified 1611
144 Ga0207671_10907095 3300025914 Bacteria 697
145 Ga0207660_10025225 3300025917 Bacteria 4033
146 Ga0207657_10039102 3300025919 Bacteria 4217
147 Ga0207657_10068131 3300025919 Bacteria 3024
148 Ga0207657_10078160 3300025919 Bacteria 2787
149 Ga0207657_10336752 3300025919 Bacteria 1191
150 Ga0207652_10044367 3300025921 Bacteria 3788
151 Ga0207652_10086013 3300025921 Bacteria 2756
152 Ga0207681_10197254 3300025923 Bacteria 1544
153 Ga0207694_10027740 3300025924 Bacteria 4313
154 Ga0207687_10385195 3300025927 Bacteria 1150
155 Ga0207644_10042088 3300025931 Bacteria 3235
156 Ga0207690_10029010 3300025932 Bacteria 3513
157 Ga0207690_10039677 3300025932 Bacteria 3073
158 Ga0207706_10000124 3300025933 Bacteria 83568
159 Ga0207706_10537682 3300025933 Bacteria 1007
160 Ga0207686_10009311 3300025934 Bacteria 5327
161 Ga0207704_10000035 3300025938 Bacteria 96154
162 Ga0207691_10082718 3300025940 Bacteria 2883
163 Ga0207667_10001809 3300025949 Bacteria 26928
164 Ga0207667_10015521 3300025949 Bacteria 8645
165 Ga0207667_10021234 3300025949 Bacteria 7198
166 Ga0207667_10060868 3300025949 Bacteria 3952
167 Ga0207667_10173109 3300025949 Bacteria 2219
168 Ga0207667_10214042 3300025949 Bacteria 1975
169 Ga0207667_10368989 3300025949 Bacteria 1463
170 Ga0207651_10044735 3300025960 Bacteria 2965
171 Ga0207677_10917085 3300026023 Bacteria 790
172 Ga0207639_10022215 3300026041 Bacteria 4567
173 Ga0207639_10070827 3300026041 Unclassified 2725
174 Ga0207639_10084692 3300026041 Bacteria 2519
175 Ga0207639_10156684 3300026041 Bacteria 1914
176 Ga0207702_10000361 3300026078 Bacteria 51967
177 Ga0207702_10044992 3300026078 Bacteria 3713
178 Ga0207702_10218155 3300026078 Bacteria 1777
179 Ga0207648_10000733 3300026089 Bacteria 36780
180 Ga0207676_10211692 3300026095 Bacteria 1720
181 Ga0207698_10003962 3300026142 Bacteria 8973
182 Ga0207698_10013937 3300026142 Bacteria 5324
183 Ga0268266_10000119 3300028379 Bacteria 162424
184 Ga0268265_10028937 3300028380 Bacteria 3972
185 Ga0268264_10041297 3300028381 Unclassified 3815
186 Ga0307517_10018887 3300028786 Bacteria 8882
187 Ga0265338_10058600 3300028800 Bacteria 3398
188 Ga0265327_10135169 3300031251 Bacteria 1157
189 Ga0307508_10637687 3300031616 Bacteria 670
190 Ga0265314_10155843 3300031711 Bacteria 1395
191 Ga0307410_10223469 3300031852 Bacteria 1450
192 Ga0307409_100316450 3300031995 Bacteria 1459
193 Ga0307415_100548576 3300032126 Bacteria 1020
194 Ga0307510_10082245 3300033180 Bacteria 3117
195 Ga0395900_0000153 3300037418 Bacteria 115432
196 Ga0395900_0000155 3300037418 Bacteria 113606
197 Ga0395898_0004560 3300037466 Bacteria 15119
198 Ga0395905_0124937 3300037471 Unclassified 2419
199 Ga0395901_0000330 3300038443 Bacteria 58380
200 Ga0451853_2793369 3300041512 Unclassified 673
201 Ga0439431_0145356 3300041997 Bacteria 672
202 Ga0439448_0043047 3300042005 Bacteria 1465
203 Ga0451577_0096970 3300042876 Bacteria 2633
204 Ga0453684_0278573 3300044712 Bacteria 1908
205 Ga0466970_0121415 3300044765 Unclassified 1431
206 Ga0495627_009549 3300046453 Bacteria 3564
207 Ga0495651_0229377 3300046462 Bacteria 1280
208 Ga0495596_0123661 3300046500 Bacteria 1004
209 Ga0495632_0044724 3300046519 Bacteria 2209
210 Ga0495632_0156150 3300046519 Unclassified 1053
211 Ga0495652_0191948 3300046529 Bacteria 1558
212 Ga0495633_0000151 3300046558 Bacteria 91565
213 Ga0495668_0001937 3300046616 Bacteria 18422
214 Ga0495661_0006067 3300046665 Bacteria 8511
215 Ga0495670_0298125 3300046691 Bacteria 864
216 Ga0495649_0296896 3300046694 Unclassified 823
217 Ga0495687_002412 3300047443 Bacteria 15055
218 Ga0495686_0012213 3300047472 Bacteria 6016
219 Ga0495686_0152433 3300047472 Bacteria 1356
220 Ga0501202_042327 3300049652 Bacteria 987
221 nmdc:mga07m45_595684_c1 3300050496 Bacteria 638
222 Ga0500635_0000929 3300053080 Bacteria 7086
223 Ga0500646_0002492 3300053090 Bacteria 4780
224 Ga0500651_0213542 3300053093 Unclassified 1134
225 Ga0500660_104125 3300053100 Bacteria 1229
226 Ga0500569_000356 3300053109 Bacteria 7385
227 Ga0500607_015210 3300053121 Bacteria 4442
228 Ga0500608_000589 3300053122 Bacteria 13360
229 Ga0500642_0241685 3300053130 Bacteria 831
230 Ga0500658_0002923 3300053134 Bacteria 6557
231 Ga0500559_0032445 3300053136 Unclassified 2245
232 Ga0500577_0000386 3300053142 Bacteria 11294
233 Ga0500590_016605 3300053148 Bacteria 3807
234 Ga0500616_0039448 3300053153 Bacteria 2546
235 Ga0500622_0000740 3300053156 Bacteria 28507
236 Ga0500636_0011283 3300053177 Bacteria 5230
237 Ga0500645_028816 3300053730 Bacteria 1679

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10142229 rootL2_101422294 155
2 3300025911 Ga0207654_10521832 Ga0207654_105218321 155
3 3300025933 Ga0207706_10537682 Ga0207706_105376822 155
4 3300025913 Ga0207695_11058589 Ga0207695_110585891 160
5 iso_pu_bacteria 2911138879 2911139213 162
6 3300005444 Ga0070694_100851356 Ga0070694_1008513561 163
7 3300005617 Ga0068859_100068027 Ga0068859_1000680272 163
8 3300005618 Ga0068864_100283782 Ga0068864_1002837822 163
9 3300005844 Ga0068862_100007183 Ga0068862_1000071836 163
10 3300006931 Ga0097620_100068028 Ga0097620_1000680282 163
11 3300009011 Ga0105251_10343687 Ga0105251_103436871 163
12 3300013104 Ga0157370_11497166 Ga0157370_114971661 163
13 3300025923 Ga0207681_10197254 Ga0207681_101972542 163
14 3300026023 Ga0207677_10917085 Ga0207677_109170851 163
15 3300026095 Ga0207676_10211692 Ga0207676_102116922 163
16 3300028380 Ga0268265_10028937 Ga0268265_100289371 163
17 3300028381 Ga0268264_10041297 Ga0268264_100412973 163
18 3300031711 Ga0265314_10155843 Ga0265314_101558432 163
19 3300037418 Ga0395900_0000155 Ga0395900_0000155_88113_88604 163
20 3300042876 Ga0451577_0096970 Ga0451577_0096970_1665_2162 163
21 3300044712 Ga0453684_0278573 Ga0453684_0278573_631_1128 163
22 3300049652 Ga0501202_042327 Ga0501202_042327_147_638 163
23 3300003316 rootH1_10055063 rootH1_100550632 164
24 3300003322 rootL2_10019262 rootL2_100192626 164
25 3300003322 rootL2_10051491 rootL2_100514914 164
26 3300003322 rootL2_10079430 rootL2_100794302 164
27 3300003322 rootL2_10084692 rootL2_100846925 164
28 3300003323 rootH1_10074025 rootH1_100740256 164
29 3300010375 Ga0105239_10379748 Ga0105239_103797482 164
30 3300025304 Ga0209257_1000004 Ga0209257_1000004916 164
31 3300041997 Ga0439431_0145356 Ga0439431_0145356_91_615 164
32 3300044765 Ga0466970_0121415 Ga0466970_0121415_557_1051 164
33 3300046453 Ga0495627_009549 Ga0495627_009549_3051_3545 164
34 3300046558 Ga0495633_0000151 Ga0495633_0000151_55034_55528 164
35 3300047472 Ga0495686_0012213 Ga0495686_0012213_3493_4017 164
36 3300053156 Ga0500622_0000740 Ga0500622_0000740_20232_20807 164
37 3300001904 JGI24736J21556_1013561 JGI24736J21556_10135612 165
38 3300002077 JGI24744J21845_10047403 JGI24744J21845_100474032 165
39 3300003320 rootH2_10015983 rootH2_100159837 165
40 3300003322 rootL2_10211184 rootL2_102111843 165
41 3300003762 Ga0055542_1001896 Ga0055542_10018968 165
42 3300005288 Ga0065714_10112689 Ga0065714_101126892 165
43 3300005328 Ga0070676_10000410 Ga0070676_100004108 165
44 3300005337 Ga0070682_100080908 Ga0070682_1000809082 165
45 3300005338 Ga0068868_100009773 Ga0068868_1000097737 165
46 3300005338 Ga0068868_100132995 Ga0068868_1001329953 165
47 3300005338 Ga0068868_101050545 Ga0068868_1010505451 165
48 3300005339 Ga0070660_100030277 Ga0070660_1000302773 165
49 3300005355 Ga0070671_100201200 Ga0070671_1002012002 165
50 3300005355 Ga0070671_101121926 Ga0070671_1011219261 165
51 3300005364 Ga0070673_100000522 Ga0070673_10000052219 165
52 3300005366 Ga0070659_100000262 Ga0070659_10000026235 165
53 3300005366 Ga0070659_100043851 Ga0070659_1000438513 165
54 3300005436 Ga0070713_101958635 Ga0070713_1019586351 165
55 3300005456 Ga0070678_100000499 Ga0070678_10000049911 165
56 3300005457 Ga0070662_100000031 Ga0070662_10000003142 165
57 3300005457 Ga0070662_100813900 Ga0070662_1008139001 165
58 3300005458 Ga0070681_10161350 Ga0070681_101613503 165
59 3300005459 Ga0068867_100000540 Ga0068867_10000054025 165
60 3300005530 Ga0070679_100061696 Ga0070679_1000616963 165
61 3300005530 Ga0070679_100103518 Ga0070679_1001035183 165
62 3300005539 Ga0068853_100024906 Ga0068853_1000249064 165
63 3300005539 Ga0068853_100046442 Ga0068853_1000464423 165
64 3300005539 Ga0068853_100089574 Ga0068853_1000895744 165
65 3300005539 Ga0068853_100104807 Ga0068853_1001048072 165
66 3300005543 Ga0070672_101055879 Ga0070672_1010558791 165
67 3300005547 Ga0070693_100564757 Ga0070693_1005647572 165
68 3300005548 Ga0070665_100000034 Ga0070665_10000003455 165
69 3300005548 Ga0070665_100904241 Ga0070665_1009042411 165
70 3300005563 Ga0068855_100001781 Ga0068855_10000178130 165
71 3300005563 Ga0068855_100012308 Ga0068855_1000123082 165
72 3300005563 Ga0068855_100019405 Ga0068855_1000194053 165
73 3300005563 Ga0068855_100073456 Ga0068855_1000734561 165
74 3300005563 Ga0068855_100252380 Ga0068855_1002523803 165
75 3300005563 Ga0068855_100286841 Ga0068855_1002868414 165
76 3300005563 Ga0068855_100461013 Ga0068855_1004610132 165
77 3300005564 Ga0070664_100994730 Ga0070664_1009947301 165
78 3300005577 Ga0068857_101863316 Ga0068857_1018633161 165
79 3300005578 Ga0068854_100400701 Ga0068854_1004007012 165
80 3300005614 Ga0068856_100000194 Ga0068856_10000019452 165
81 3300005614 Ga0068856_100137754 Ga0068856_1001377543 165
82 3300005616 Ga0068852_100000630 Ga0068852_10000063019 165
83 3300005840 Ga0068870_10053444 Ga0068870_100534442 165
84 3300006195 Ga0075366_10218450 Ga0075366_102184501 165
85 3300006237 Ga0097621_100004207 Ga0097621_10000420716 165
86 3300006237 Ga0097621_101277261 Ga0097621_1012772611 165
87 3300006358 Ga0068871_100000284 Ga0068871_10000028416 165
88 3300006881 Ga0068865_100000029 Ga0068865_10000002936 165
89 3300009093 Ga0105240_10000321 Ga0105240_1000032115 165
90 3300009093 Ga0105240_10002040 Ga0105240_1000204011 165
91 3300009093 Ga0105240_10009993 Ga0105240_100099932 165
92 3300009093 Ga0105240_10076238 Ga0105240_100762382 165
93 3300009093 Ga0105240_10499568 Ga0105240_104995683 165
94 3300009098 Ga0105245_10813533 Ga0105245_108135331 165
95 3300009174 Ga0105241_10002762 Ga0105241_100027628 165
96 3300009174 Ga0105241_10005289 Ga0105241_100052894 165
97 3300009174 Ga0105241_10044946 Ga0105241_100449462 165
98 3300009176 Ga0105242_10017131 Ga0105242_100171317 165
99 3300009176 Ga0105242_11411071 Ga0105242_114110711 165
100 3300009545 Ga0105237_10001073 Ga0105237_100010733 165
101 3300009545 Ga0105237_10002934 Ga0105237_100029348 165
102 3300009545 Ga0105237_10025704 Ga0105237_100257047 165
103 3300009545 Ga0105237_10119269 Ga0105237_101192692 165
104 3300009551 Ga0105238_10006339 Ga0105238_1000633914 165
105 3300009551 Ga0105238_10229129 Ga0105238_102291292 165
106 3300010375 Ga0105239_10000813 Ga0105239_100008135 165
107 3300010375 Ga0105239_10049000 Ga0105239_100490006 165
108 3300010375 Ga0105239_10085840 Ga0105239_100858405 165
109 3300010375 Ga0105239_10135086 Ga0105239_101350861 165
110 3300010375 Ga0105239_10179355 Ga0105239_101793553 165
111 3300011119 Ga0105246_10517252 Ga0105246_105172522 165
112 3300011119 Ga0105246_10712398 Ga0105246_107123981 165
113 3300013100 Ga0157373_10007902 Ga0157373_100079024 165
114 3300013100 Ga0157373_10047393 Ga0157373_100473932 165
115 3300013102 Ga0157371_10361425 Ga0157371_103614252 165
116 3300013104 Ga0157370_10174702 Ga0157370_101747021 165
117 3300013105 Ga0157369_10048822 Ga0157369_100488222 165
118 3300013105 Ga0157369_10138279 Ga0157369_101382792 165
119 3300013296 Ga0157374_10000051 Ga0157374_100000515 165
120 3300013296 Ga0157374_10000857 Ga0157374_100008579 165
121 3300013297 Ga0157378_10018718 Ga0157378_100187181 165
122 3300013297 Ga0157378_10071322 Ga0157378_100713223 165
123 3300013306 Ga0163162_10000018 Ga0163162_1000001831 165
124 3300013306 Ga0163162_10123509 Ga0163162_101235092 165
125 3300013306 Ga0163162_11847687 Ga0163162_118476871 165
126 3300013307 Ga0157372_10159929 Ga0157372_101599292 165
127 3300013307 Ga0157372_10810773 Ga0157372_108107732 165
128 3300013307 Ga0157372_11484124 Ga0157372_114841241 165
129 3300013308 Ga0157375_10003658 Ga0157375_100036586 165
130 3300013308 Ga0157375_10471291 Ga0157375_104712911 165
131 3300014325 Ga0163163_10144048 Ga0163163_101440482 165
132 3300014745 Ga0157377_10126039 Ga0157377_101260391 165
133 3300014968 Ga0157379_10942197 Ga0157379_109421972 165
134 3300014969 Ga0157376_10110371 Ga0157376_101103713 165
135 3300014969 Ga0157376_11990155 Ga0157376_119901551 165
136 3300017792 Ga0163161_10145064 Ga0163161_101450642 165
137 3300017792 Ga0163161_11029507 Ga0163161_110295071 165
138 3300025242 Ga0209258_100161 Ga0209258_10016170 165
139 3300025246 Ga0209646_1017652 Ga0209646_10176521 165
140 3300025250 Ga0209026_1000304 Ga0209026_100030442 165
141 3300025254 Ga0209148_1000161 Ga0209148_100016139 165
142 3300025272 Ga0209455_1001192 Ga0209455_10011924 165
143 3300025904 Ga0207647_10000081 Ga0207647_1000008152 165
144 3300025907 Ga0207645_10000463 Ga0207645_1000046330 165
145 3300025908 Ga0207643_10244649 Ga0207643_102446492 165
146 3300025909 Ga0207705_10000028 Ga0207705_1000002896 165
147 3300025909 Ga0207705_10041279 Ga0207705_100412792 165
148 3300025909 Ga0207705_10147789 Ga0207705_101477892 165
149 3300025911 Ga0207654_10002416 Ga0207654_100024162 165
150 3300025911 Ga0207654_10014617 Ga0207654_100146174 165
151 3300025911 Ga0207654_10069095 Ga0207654_100690952 165
152 3300025911 Ga0207654_10111085 Ga0207654_101110852 165
153 3300025911 Ga0207654_10247032 Ga0207654_102470322 165
154 3300025913 Ga0207695_10000197 Ga0207695_1000019784 165
155 3300025913 Ga0207695_10007748 Ga0207695_100077482 165
156 3300025913 Ga0207695_10026586 Ga0207695_100265866 165
157 3300025913 Ga0207695_10052739 Ga0207695_100527396 165
158 3300025913 Ga0207695_10323599 Ga0207695_103235991 165
159 3300025914 Ga0207671_10000516 Ga0207671_1000051621 165
160 3300025914 Ga0207671_10029961 Ga0207671_100299612 165
161 3300025914 Ga0207671_10187732 Ga0207671_101877323 165
162 3300025914 Ga0207671_10907095 Ga0207671_109070951 165
163 3300025917 Ga0207660_10025225 Ga0207660_100252252 165
164 3300025919 Ga0207657_10039102 Ga0207657_100391025 165
165 3300025919 Ga0207657_10068131 Ga0207657_100681311 165
166 3300025919 Ga0207657_10078160 Ga0207657_100781602 165
167 3300025919 Ga0207657_10336752 Ga0207657_103367522 165
168 3300025921 Ga0207652_10044367 Ga0207652_100443673 165
169 3300025921 Ga0207652_10086013 Ga0207652_100860132 165
170 3300025924 Ga0207694_10027740 Ga0207694_100277403 165
171 3300025927 Ga0207687_10385195 Ga0207687_103851951 165
172 3300025931 Ga0207644_10042088 Ga0207644_100420883 165
173 3300025932 Ga0207690_10029010 Ga0207690_100290103 165
174 3300025932 Ga0207690_10039677 Ga0207690_100396774 165
175 3300025933 Ga0207706_10000124 Ga0207706_1000012454 165
176 3300025934 Ga0207686_10009311 Ga0207686_100093117 165
177 3300025938 Ga0207704_10000035 Ga0207704_1000003581 165
178 3300025940 Ga0207691_10082718 Ga0207691_100827183 165
179 3300025949 Ga0207667_10001809 Ga0207667_1000180927 165
180 3300025949 Ga0207667_10015521 Ga0207667_1001552111 165
181 3300025949 Ga0207667_10021234 Ga0207667_100212343 165
182 3300025949 Ga0207667_10060868 Ga0207667_100608685 165
183 3300025949 Ga0207667_10173109 Ga0207667_101731092 165
184 3300025949 Ga0207667_10214042 Ga0207667_102140422 165
185 3300025949 Ga0207667_10368989 Ga0207667_103689893 165
186 3300025960 Ga0207651_10044735 Ga0207651_100447351 165
187 3300026041 Ga0207639_10022215 Ga0207639_100222152 165
188 3300026041 Ga0207639_10070827 Ga0207639_100708274 165
189 3300026041 Ga0207639_10084692 Ga0207639_100846922 165
190 3300026041 Ga0207639_10156684 Ga0207639_101566841 165
191 3300026078 Ga0207702_10000361 Ga0207702_1000036136 165
192 3300026078 Ga0207702_10044992 Ga0207702_100449924 165
193 3300026078 Ga0207702_10218155 Ga0207702_102181552 165
194 3300026089 Ga0207648_10000733 Ga0207648_1000073336 165
195 3300026142 Ga0207698_10003962 Ga0207698_100039624 165
196 3300026142 Ga0207698_10013937 Ga0207698_100139372 165
197 3300028379 Ga0268266_10000119 Ga0268266_10000119119 165
198 3300028786 Ga0307517_10018887 Ga0307517_100188878 165
199 3300028800 Ga0265338_10058600 Ga0265338_100586003 165
200 3300031251 Ga0265327_10135169 Ga0265327_101351692 165
201 3300031616 Ga0307508_10637687 Ga0307508_106376871 165
202 3300031852 Ga0307410_10223469 Ga0307410_102234692 165
203 3300031995 Ga0307409_100316450 Ga0307409_1003164502 165
204 3300032126 Ga0307415_100548576 Ga0307415_1005485762 165
205 3300033180 Ga0307510_10082245 Ga0307510_100822453 165
206 3300037418 Ga0395900_0000153 Ga0395900_0000153_44046_44582 165
207 3300037466 Ga0395898_0004560 Ga0395898_0004560_3868_4404 165
208 3300037471 Ga0395905_0124937 Ga0395905_0124937_1641_2177 165
209 3300038443 Ga0395901_0000330 Ga0395901_0000330_47513_48049 165
210 3300041512 Ga0451853_2793369 Ga0451853_2793369_147_656 165
211 3300042005 Ga0439448_0043047 Ga0439448_0043047_764_1261 165
212 3300046462 Ga0495651_0229377 Ga0495651_0229377_472_1014 165
213 3300046500 Ga0495596_0123661 Ga0495596_0123661_407_904 165
214 3300046519 Ga0495632_0044724 Ga0495632_0044724_336_833 165
215 3300046519 Ga0495632_0156150 Ga0495632_0156150_342_851 165
216 3300046529 Ga0495652_0191948 Ga0495652_0191948_697_1239 165
217 3300046616 Ga0495668_0001937 Ga0495668_0001937_5792_6289 165
218 3300046665 Ga0495661_0006067 Ga0495661_0006067_4612_5130 165
219 3300046691 Ga0495670_0298125 Ga0495670_0298125_33_530 165
220 3300046694 Ga0495649_0296896 Ga0495649_0296896_312_809 165
221 3300047443 Ga0495687_002412 Ga0495687_002412_11605_12102 165
222 3300047472 Ga0495686_0152433 Ga0495686_0152433_224_739 165
223 3300050496 nmdc:mga07m45_595684_c1 nmdc:mga07m45_595684_c1_32_529 165
224 3300053080 Ga0500635_0000929 Ga0500635_0000929_1548_2060 165
225 3300053090 Ga0500646_0002492 Ga0500646_0002492_3054_3563 165
226 3300053093 Ga0500651_0213542 Ga0500651_0213542_115_624 165
227 3300053100 Ga0500660_104125 Ga0500660_104125_617_1126 165
228 3300053109 Ga0500569_000356 Ga0500569_000356_3449_3958 165
229 3300053121 Ga0500607_015210 Ga0500607_015210_808_1317 165
230 3300053122 Ga0500608_000589 Ga0500608_000589_3037_3534 165
231 3300053130 Ga0500642_0241685 Ga0500642_0241685_173_670 165
232 3300053134 Ga0500658_0002923 Ga0500658_0002923_2754_3263 165
233 3300053136 Ga0500559_0032445 Ga0500559_0032445_1350_1859 165
234 3300053142 Ga0500577_0000386 Ga0500577_0000386_1739_2248 165
235 3300053148 Ga0500590_016605 Ga0500590_016605_2228_2737 165
236 3300053153 Ga0500616_0039448 Ga0500616_0039448_646_1155 165
237 3300053177 Ga0500636_0011283 Ga0500636_0011283_4560_5069 165
238 3300053730 Ga0500645_028816 Ga0500645_028816_1017_1514 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

27

158

0.88

PF05163

DinB

DinB family

12

182

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dka-assembly1.cif.gz_B crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.8162 6 153
3dka-assembly1.cif.gz_A crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.8127 6 153
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.8086 5 156
3gor-assembly2.cif.gz_D crystal structure of putative metal-dependent hydrolase apc36150 0.8038 2 153
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.7976 1 156
ID Description Score Start End Superfamily
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8116 6 146 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.793 1 149 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7869 5 156 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.785 6 146 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.778 1 149 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A4Q5ZBD6-F1-model_v4 DinB family protein 0.9762 1 118
AF-A0A4Q5ZBD6-F1-model_v4 DinB family protein 0.9681 1 118
AF-A0A7V9DEZ0-F1-model_v4 DinB family protein 0.9644 1 134
AF-A0A7J5WSI0-F1-model_v4 DinB family protein 0.9612 1 131
AF-A0A519UZ83-F1-model_v4 DinB family protein 0.961 1 149

Feature Viewer

pLDDT pTM Quality
93.38 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map