F351378

General Info

Members Datasets Scaffolds Average Seq Length
238 152 476 129

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0374132|Ga0501076_0374132_487_903
Length 138
Sequence MIFVDSNVPMYLVGADHPHKTEAELLLRRAIAEEERLLTDAEVLQEILHRYAAIRRRDAIQPAFDALLGLVDEVVAIEAADAGEAKDRLLADPRLSARDALHLAVMRRRGVRRILTFDADFDRYPEVVRLGVAPPARG

Samples

Sample ID Description Type Environment
1 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
69 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
104 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
105 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
115 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
116 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
117 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
118 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
126 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
127 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.58
Stem 0
Stem Tuber 0
Unclassified 25.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501076_0374132 3300049592 Bacteria 1171
2 JGI25407J50210_10002419 3300003373 Bacteria 4386
3 Ga0070676_10617032 3300005328 Unclassified 784
4 Ga0070690_100101872 3300005330 Bacteria 1905
5 Ga0068869_100633386 3300005334 Bacteria 906
6 Ga0070666_10272990 3300005335 Bacteria 1200
7 Ga0068868_100812168 3300005338 Bacteria 844
8 Ga0070691_10106394 3300005341 Bacteria 1398
9 Ga0070687_100108588 3300005343 Bacteria 1566
10 Ga0070661_101171407 3300005344 Bacteria 642
11 Ga0070692_10461228 3300005345 Unclassified 815
12 Ga0070669_100231584 3300005353 Bacteria 1464
13 Ga0070675_100147539 3300005354 Bacteria 2015
14 Ga0070675_100517610 3300005354 Bacteria 1076
15 Ga0070671_100034246 3300005355 Bacteria 4204
16 Ga0070673_100001627 3300005364 Bacteria 13290
17 Ga0070673_100382417 3300005364 Bacteria 1255
18 Ga0070667_100381231 3300005367 Bacteria 1281
19 Ga0070667_100403657 3300005367 Bacteria 1244
20 Ga0070667_101013025 3300005367 Bacteria 775
21 Ga0070703_10077502 3300005406 Unclassified 1124
22 Ga0070709_10266012 3300005434 Unclassified 1241
23 Ga0070714_100037260 3300005435 Bacteria 4085
24 Ga0070714_100856451 3300005435 Unclassified 881
25 Ga0070701_10095733 3300005438 Bacteria 1635
26 Ga0070705_100360931 3300005440 Unclassified 1063
27 Ga0070705_101840328 3300005440 Unclassified 514
28 Ga0070700_100007351 3300005441 Bacteria 5942
29 Ga0070694_100187902 3300005444 Bacteria 1532
30 Ga0070694_100880221 3300005444 Bacteria 738
31 Ga0070708_100394358 3300005445 Unclassified 1305
32 Ga0070708_100684557 3300005445 Bacteria 966
33 Ga0070708_100719203 3300005445 Unclassified 939
34 Ga0070708_101416137 3300005445 Unclassified 648
35 Ga0070663_100226178 3300005455 Bacteria 1471
36 Ga0070662_101095175 3300005457 Bacteria 683
37 Ga0070662_101122842 3300005457 Bacteria 675
38 Ga0070706_100342285 3300005467 Bacteria 1394
39 Ga0070706_100352667 3300005467 Bacteria 1371
40 Ga0070707_100081280 3300005468 Bacteria 3128
41 Ga0070707_100169819 3300005468 Bacteria 2125
42 Ga0070707_100325658 3300005468 Unclassified 1493
43 Ga0070707_100338750 3300005468 Unclassified 1461
44 Ga0070707_101448813 3300005468 Bacteria 653
45 Ga0070698_100083052 3300005471 Bacteria 3194
46 Ga0070699_100215649 3300005518 Unclassified 1709
47 Ga0070699_100299180 3300005518 Bacteria 1443
48 Ga0070699_100608491 3300005518 Bacteria 997
49 Ga0070699_101153484 3300005518 Unclassified 711
50 Ga0068853_100459522 3300005539 Bacteria 1198
51 Ga0070672_100096355 3300005543 Bacteria 2394
52 Ga0070672_100379952 3300005543 Bacteria 1208
53 Ga0070686_100159255 3300005544 Bacteria 1588
54 Ga0070686_100212412 3300005544 Bacteria 1394
55 Ga0070695_100037264 3300005545 Bacteria 3064
56 Ga0070695_100724333 3300005545 Unclassified 791
57 Ga0070695_101360874 3300005545 Bacteria 588
58 Ga0070696_100765777 3300005546 Bacteria 792
59 Ga0070704_100075498 3300005549 Bacteria 2463
60 Ga0070704_100405351 3300005549 Bacteria 1164
61 Ga0070704_100523906 3300005549 Unclassified 1032
62 Ga0068857_100131779 3300005577 Bacteria 2255
63 Ga0068857_101379183 3300005577 Unclassified 685
64 Ga0068854_100088339 3300005578 Bacteria 2301
65 Ga0068854_100251462 3300005578 Bacteria 1411
66 Ga0070702_100034020 3300005615 Bacteria 2806
67 Ga0068859_100000008 3300005617 Bacteria 383750
68 Ga0068859_100092377 3300005617 Bacteria 3077
69 Ga0068859_100120673 3300005617 Bacteria 2688
70 Ga0068859_100147209 3300005617 Unclassified 2430
71 Ga0068859_101416377 3300005617 Bacteria 767
72 Ga0068864_100728895 3300005618 Unclassified 970
73 Ga0068863_100282343 3300005841 Bacteria 1609
74 Ga0068858_100096587 3300005842 Bacteria 2754
75 Ga0068858_100410924 3300005842 Unclassified 1301
76 Ga0068858_101252431 3300005842 Unclassified 729
77 Ga0068860_100073729 3300005843 Bacteria 3245
78 Ga0068862_100031203 3300005844 Bacteria 4496
79 Ga0068862_100146393 3300005844 Unclassified 2100
80 Ga0081538_10000325 3300005981 Bacteria 54572
81 Ga0081538_10075325 3300005981 Bacteria 1831
82 Ga0070715_10212154 3300006163 Bacteria 990
83 Ga0070712_100750902 3300006175 Unclassified 835
84 Ga0068871_101207974 3300006358 Bacteria 709
85 Ga0075430_100583729 3300006846 Bacteria 922
86 Ga0075433_11168214 3300006852 Bacteria 668
87 Ga0075436_100171935 3300006914 Bacteria 1530
88 Ga0097620_100000008 3300006931 Bacteria 383750
89 Ga0097620_100092373 3300006931 Bacteria 3077
90 Ga0097620_100120668 3300006931 Bacteria 2688
91 Ga0097620_100147200 3300006931 Unclassified 2430
92 Ga0097620_101416133 3300006931 Bacteria 767
93 Ga0075435_100002097 3300007076 Bacteria 13103
94 Ga0099794_10307553 3300007265 Unclassified 821
95 Ga0099795_10053018 3300007788 Unclassified 1483
96 Ga0105250_10627730 3300009092 Bacteria 500
97 Ga0105245_10023757 3300009098 Bacteria 5381
98 Ga0114129_10016913 3300009147 Bacteria 10385
99 Ga0105242_10887906 3300009176 Unclassified 890
100 Ga0105249_10117805 3300009553 Bacteria 2519
101 Ga0099796_10052091 3300010159 Bacteria 1424
102 Ga0105239_10656246 3300010375 Unclassified 1198
103 Ga0105246_10504900 3300011119 Unclassified 1028
104 Ga0163162_10747412 3300013306 Bacteria 1097
105 Ga0157380_10138243 3300014326 Bacteria 2089
106 Ga0157380_10163535 3300014326 Bacteria 1937
107 Ga0157376_11768688 3300014969 Bacteria 654
108 Ga0213871_10033574 3300021441 Bacteria 1350
109 Ga0228598_1032499 3300024227 Unclassified 1028
110 Ga0207688_10072083 3300025901 Bacteria 1962
111 Ga0207680_10111426 3300025903 Unclassified 1775
112 Ga0207699_10257977 3300025906 Bacteria 1204
113 Ga0207693_10527139 3300025915 Bacteria 922
114 Ga0207662_10115262 3300025918 Bacteria 1679
115 Ga0207646_10116468 3300025922 Bacteria 2400
116 Ga0207646_10211671 3300025922 Bacteria 1751
117 Ga0207646_10346205 3300025922 Bacteria 1343
118 Ga0207681_10115637 3300025923 Bacteria 1959
119 Ga0207681_10167502 3300025923 Bacteria 1662
120 Ga0207659_10313564 3300025926 Bacteria 1292
121 Ga0207687_10111905 3300025927 Bacteria 2028
122 Ga0207700_10001156 3300025928 Bacteria 15155
123 Ga0207664_10030355 3300025929 Bacteria 4128
124 Ga0207664_10509254 3300025929 Bacteria 1078
125 Ga0207644_10093479 3300025931 Bacteria 2245
126 Ga0207706_10136993 3300025933 Bacteria 2154
127 Ga0207706_10899632 3300025933 Bacteria 748
128 Ga0207665_10041238 3300025939 Bacteria 3081
129 Ga0207665_10180511 3300025939 Bacteria 1528
130 Ga0207691_10006948 3300025940 Bacteria 10917
131 Ga0207691_10464266 3300025940 Bacteria 1077
132 Ga0207711_10269856 3300025941 Bacteria 1565
133 Ga0207689_10020596 3300025942 Bacteria 5549
134 Ga0207689_10907940 3300025942 Bacteria 743
135 Ga0207651_10010188 3300025960 Bacteria 5196
136 Ga0207651_11096947 3300025960 Bacteria 713
137 Ga0207640_10002048 3300025981 Bacteria 10897
138 Ga0207640_10105824 3300025981 Bacteria 1983
139 Ga0207640_10346031 3300025981 Bacteria 1193
140 Ga0207658_10392603 3300025986 Bacteria 1218
141 Ga0207658_11151207 3300025986 Bacteria 709
142 Ga0207703_10117836 3300026035 Bacteria 2275
143 Ga0207703_10605711 3300026035 Bacteria 1036
144 Ga0207703_10818869 3300026035 Unclassified 889
145 Ga0207639_10996299 3300026041 Unclassified 785
146 Ga0207708_10010548 3300026075 Bacteria 6859
147 Ga0207676_10238198 3300026095 Bacteria 1631
148 Ga0207676_10698473 3300026095 Unclassified 983
149 Ga0207674_10143245 3300026116 Unclassified 2349
150 Ga0207674_10494967 3300026116 Bacteria 1181
151 Ga0207675_100058088 3300026118 Bacteria 3610
152 Ga0207698_10918680 3300026142 Bacteria 883
153 Ga0209179_1007368 3300027512 Bacteria 1815
154 Ga0209968_1035742 3300027526 Bacteria 839
155 Ga0268265_10409984 3300028380 Unclassified 1255
156 Ga0268265_10627505 3300028380 Bacteria 1030
157 Ga0268264_10240003 3300028381 Unclassified 1678
158 Ga0268264_11410163 3300028381 Bacteria 707
159 Ga0265338_10055128 3300028800 Bacteria 3538
160 Ga0265338_10078061 3300028800 Bacteria 2794
161 Ga0265330_10014014 3300031235 Bacteria 3723
162 Ga0265332_10042224 3300031238 Bacteria 1971
163 Ga0265328_10018952 3300031239 Unclassified 2647
164 Ga0265320_10026249 3300031240 Bacteria 3051
165 Ga0265325_10010928 3300031241 Bacteria 5228
166 Ga0265325_10024981 3300031241 Bacteria 3245
167 Ga0265329_10006420 3300031242 Bacteria 4664
168 Ga0265340_10050759 3300031247 Unclassified 2010
169 Ga0265339_10174268 3300031249 Unclassified 1075
170 Ga0265331_10003618 3300031250 Bacteria 9883
171 Ga0265316_10022768 3300031344 Bacteria 5273
172 Ga0265313_10019604 3300031595 Bacteria 3758
173 Ga0307415_102415181 3300032126 Bacteria 517
174 Ga0316583_10125150 3300032133 Unclassified 896
175 Ga0373929_0048822 3300035085 Bacteria 962
176 Ga0373934_0471108 3300035086 Unclassified 527
177 Ga0316574_0101917 3300035398 Bacteria 1838
178 Ga0373931_0060335 3300035691 Unclassified 2041
179 Ga0373935_0355472 3300035692 Unclassified 1045
180 Ga0373947_0232059 3300035725 Unclassified 1216
181 Ga0373925_0264469 3300037068 Unclassified 1382
182 Ga0373925_0528452 3300037068 Unclassified 969
183 Ga0395900_0667894 3300037418 Unclassified 975
184 Ga0436360_0223496 3300039438 Bacteria 3536
185 Ga0436363_1678485 3300039450 Bacteria 871
186 Ga0439462_0057427 3300042015 Bacteria 1051
187 Ga0439434_0073831 3300042435 Bacteria 1076
188 Ga0439460_0242968 3300042461 Bacteria 621
189 Ga0451577_1866201 3300042876 Bacteria 527
190 Ga0453683_0659301 3300044673 Unclassified 684
191 Ga0453684_1339296 3300044712 Bacteria 745
192 Ga0495653_0429057 3300046463 Bacteria 835
193 Ga0495602_0588062 3300048088 Bacteria 767
194 Ga0501033_0700531 3300049570 Unclassified 689
195 Ga0501036_0046660 3300049572 Bacteria 3668
196 Ga0501036_0441180 3300049572 Bacteria 1085
197 Ga0501036_0822073 3300049572 Bacteria 765
198 Ga0501038_0442602 3300049574 Unclassified 1000
199 Ga0501038_0895443 3300049574 Unclassified 655
200 Ga0501040_0092916 3300049576 Bacteria 2098
201 Ga0501040_0622293 3300049576 Unclassified 780
202 Ga0501042_0192329 3300049578 Bacteria 1472
203 Ga0501042_1304578 3300049578 Bacteria 529
204 Ga0501046_0959990 3300049580 Bacteria 594
205 Ga0501071_0945505 3300049587 Bacteria 665
206 Ga0501071_1120273 3300049587 Bacteria 608
207 Ga0501071_1146406 3300049587 Unclassified 601
208 Ga0501075_0007690 3300049591 Bacteria 7482
209 Ga0501075_0332961 3300049591 Bacteria 1157
210 Ga0501076_0111251 3300049592 Bacteria 2214
211 Ga0501076_0477956 3300049592 Bacteria 1027
212 Ga0501076_0730643 3300049592 Bacteria 817
213 Ga0501076_1274053 3300049592 Bacteria 605
214 Ga0501076_1496679 3300049592 Unclassified 554
215 Ga0501077_0168576 3300049593 Bacteria 1391
216 Ga0501079_0607828 3300049741 Bacteria 860
217 Ga0501080_0134099 3300049742 Bacteria 2292
218 Ga0501080_1410573 3300049742 Unclassified 594
219 Ga0501081_0432307 3300049743 Bacteria 977
220 Ga0501045_0583204 3300049824 Unclassified 828
221 Ga0501045_0720710 3300049824 Unclassified 736
222 Ga0501045_0945521 3300049824 Bacteria 633
223 nmdc:mga05p37_16702_c1 3300050507 Bacteria 8845
224 nmdc:mga08y16_1223937_c1 3300050511 Bacteria 721
225 nmdc:mga08y16_2072318_c1 3300050511 Bacteria 517
226 nmdc:mga0n895_1650859_c1 3300050512 Unclassified 604
227 nmdc:mga0n895_650590_c1 3300050512 Bacteria 1053
228 nmdc:mga0rr50_3900_c1 3300050513 Bacteria 8682
229 Ga0501084_0893754 3300054114 Unclassified 747
230 Ga0501084_1830744 3300054114 Bacteria 507
231 Ga0501082_0164382 3300060353 Bacteria 1929
232 Ga0501082_0212604 3300060353 Bacteria 1682
233 Ga0501082_0356910 3300060353 Bacteria 1275
234 Ga0501082_0617989 3300060353 Bacteria 948
235 Ga0501082_0787216 3300060353 Bacteria 832
236 Ga0530510_0060072 3300061734 Bacteria 2751
237 Ga0530510_0112347 3300061734 Bacteria 1996
238 Ga0530510_1332165 3300061734 Unclassified 551
239 Ga0501076_0374132
240 JGI25407J50210_10002419
241 Ga0070676_10617032
242 Ga0070690_100101872
243 Ga0068869_100633386
244 Ga0070666_10272990
245 Ga0068868_100812168
246 Ga0070691_10106394
247 Ga0070687_100108588
248 Ga0070661_101171407
249 Ga0070692_10461228
250 Ga0070669_100231584
251 Ga0070675_100147539
252 Ga0070675_100517610
253 Ga0070671_100034246
254 Ga0070673_100001627
255 Ga0070673_100382417
256 Ga0070667_100381231
257 Ga0070667_100403657
258 Ga0070667_101013025
259 Ga0070703_10077502
260 Ga0070709_10266012
261 Ga0070714_100037260
262 Ga0070714_100856451
263 Ga0070701_10095733
264 Ga0070705_100360931
265 Ga0070705_101840328
266 Ga0070700_100007351
267 Ga0070694_100187902
268 Ga0070694_100880221
269 Ga0070708_100394358
270 Ga0070708_100684557
271 Ga0070708_100719203
272 Ga0070708_101416137
273 Ga0070663_100226178
274 Ga0070662_101095175
275 Ga0070662_101122842
276 Ga0070706_100342285
277 Ga0070706_100352667
278 Ga0070707_100081280
279 Ga0070707_100169819
280 Ga0070707_100325658
281 Ga0070707_100338750
282 Ga0070707_101448813
283 Ga0070698_100083052
284 Ga0070699_100215649
285 Ga0070699_100299180
286 Ga0070699_100608491
287 Ga0070699_101153484
288 Ga0068853_100459522
289 Ga0070672_100096355
290 Ga0070672_100379952
291 Ga0070686_100159255
292 Ga0070686_100212412
293 Ga0070695_100037264
294 Ga0070695_100724333
295 Ga0070695_101360874
296 Ga0070696_100765777
297 Ga0070704_100075498
298 Ga0070704_100405351
299 Ga0070704_100523906
300 Ga0068857_100131779
301 Ga0068857_101379183
302 Ga0068854_100088339
303 Ga0068854_100251462
304 Ga0070702_100034020
305 Ga0068859_100000008
306 Ga0068859_100092377
307 Ga0068859_100120673
308 Ga0068859_100147209
309 Ga0068859_101416377
310 Ga0068864_100728895
311 Ga0068863_100282343
312 Ga0068858_100096587
313 Ga0068858_100410924
314 Ga0068858_101252431
315 Ga0068860_100073729
316 Ga0068862_100031203
317 Ga0068862_100146393
318 Ga0081538_10000325
319 Ga0081538_10075325
320 Ga0070715_10212154
321 Ga0070712_100750902
322 Ga0068871_101207974
323 Ga0075430_100583729
324 Ga0075433_11168214
325 Ga0075436_100171935
326 Ga0097620_100000008
327 Ga0097620_100092373
328 Ga0097620_100120668
329 Ga0097620_100147200
330 Ga0097620_101416133
331 Ga0075435_100002097
332 Ga0099794_10307553
333 Ga0099795_10053018
334 Ga0105250_10627730
335 Ga0105245_10023757
336 Ga0114129_10016913
337 Ga0105242_10887906
338 Ga0105249_10117805
339 Ga0099796_10052091
340 Ga0105239_10656246
341 Ga0105246_10504900
342 Ga0163162_10747412
343 Ga0157380_10138243
344 Ga0157380_10163535
345 Ga0157376_11768688
346 Ga0213871_10033574
347 Ga0228598_1032499
348 Ga0207688_10072083
349 Ga0207680_10111426
350 Ga0207699_10257977
351 Ga0207693_10527139
352 Ga0207662_10115262
353 Ga0207646_10116468
354 Ga0207646_10211671
355 Ga0207646_10346205
356 Ga0207681_10115637
357 Ga0207681_10167502
358 Ga0207659_10313564
359 Ga0207687_10111905
360 Ga0207700_10001156
361 Ga0207664_10030355
362 Ga0207664_10509254
363 Ga0207644_10093479
364 Ga0207706_10136993
365 Ga0207706_10899632
366 Ga0207665_10041238
367 Ga0207665_10180511
368 Ga0207691_10006948
369 Ga0207691_10464266
370 Ga0207711_10269856
371 Ga0207689_10020596
372 Ga0207689_10907940
373 Ga0207651_10010188
374 Ga0207651_11096947
375 Ga0207640_10002048
376 Ga0207640_10105824
377 Ga0207640_10346031
378 Ga0207658_10392603
379 Ga0207658_11151207
380 Ga0207703_10117836
381 Ga0207703_10605711
382 Ga0207703_10818869
383 Ga0207639_10996299
384 Ga0207708_10010548
385 Ga0207676_10238198
386 Ga0207676_10698473
387 Ga0207674_10143245
388 Ga0207674_10494967
389 Ga0207675_100058088
390 Ga0207698_10918680
391 Ga0209179_1007368
392 Ga0209968_1035742
393 Ga0268265_10409984
394 Ga0268265_10627505
395 Ga0268264_10240003
396 Ga0268264_11410163
397 Ga0265338_10055128
398 Ga0265338_10078061
399 Ga0265330_10014014
400 Ga0265332_10042224
401 Ga0265328_10018952
402 Ga0265320_10026249
403 Ga0265325_10010928
404 Ga0265325_10024981
405 Ga0265329_10006420
406 Ga0265340_10050759
407 Ga0265339_10174268
408 Ga0265331_10003618
409 Ga0265316_10022768
410 Ga0265313_10019604
411 Ga0307415_102415181
412 Ga0316583_10125150
413 Ga0373929_0048822
414 Ga0373934_0471108
415 Ga0316574_0101917
416 Ga0373931_0060335
417 Ga0373935_0355472
418 Ga0373947_0232059
419 Ga0373925_0264469
420 Ga0373925_0528452
421 Ga0395900_0667894
422 Ga0436360_0223496
423 Ga0436363_1678485
424 Ga0439462_0057427
425 Ga0439434_0073831
426 Ga0439460_0242968
427 Ga0451577_1866201
428 Ga0453683_0659301
429 Ga0453684_1339296
430 Ga0495653_0429057
431 Ga0495602_0588062
432 Ga0501033_0700531
433 Ga0501036_0046660
434 Ga0501036_0441180
435 Ga0501036_0822073
436 Ga0501038_0442602
437 Ga0501038_0895443
438 Ga0501040_0092916
439 Ga0501040_0622293
440 Ga0501042_0192329
441 Ga0501042_1304578
442 Ga0501046_0959990
443 Ga0501071_0945505
444 Ga0501071_1120273
445 Ga0501071_1146406
446 Ga0501075_0007690
447 Ga0501075_0332961
448 Ga0501076_0111251
449 Ga0501076_0477956
450 Ga0501076_0730643
451 Ga0501076_1274053
452 Ga0501076_1496679
453 Ga0501077_0168576
454 Ga0501079_0607828
455 Ga0501080_0134099
456 Ga0501080_1410573
457 Ga0501081_0432307
458 Ga0501045_0583204
459 Ga0501045_0720710
460 Ga0501045_0945521
461 nmdc:mga05p37_16702_c1
462 nmdc:mga08y16_1223937_c1
463 nmdc:mga08y16_2072318_c1
464 nmdc:mga0n895_1650859_c1
465 nmdc:mga0n895_650590_c1
466 nmdc:mga0rr50_3900_c1
467 Ga0501084_0893754
468 Ga0501084_1830744
469 Ga0501082_0164382
470 Ga0501082_0212604
471 Ga0501082_0356910
472 Ga0501082_0617989
473 Ga0501082_0787216
474 Ga0530510_0060072
475 Ga0530510_0112347
476 Ga0530510_1332165

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

2

127

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wz4-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis vapc20 (rv2549c), sarcin-ricin loop cleaving toxin 0.8258 1 119
5x3t-assembly1.cif.gz_H vapbc from mycobacterium tuberculosis 0.817 2 121
7by2-assembly1.cif.gz_B-2 toxin-antitoxin complex from klebsiella pneumoniae 0.7802 1 131
5wzf-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis vapc20 (rv2549c), sarcin-ricin loop cleaving toxin 0.7675 1 128
7vwo-assembly3.cif.gz_I ta complex from mycobacterium tuberculosis 0.7639 1 131
ID Description Score Start End Superfamily
af_P9WFA1_1_129_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9918 1 129 3.40.50.1010
af_P9WFA1_1_129_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9842 1 129 3.40.50.1010
af_P9WF89_1_125_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9341 1 120 3.40.50.1010
af_P9WF89_1_125_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8847 1 120 3.40.50.1010
af_P95004_1_128_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8382 1 130 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A7V8YHG4-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9945 1 112 GO:0004518
AF-A0A7V8Y4Q3-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9908 1 131 GO:0000287
GO:0004540
GO:0090729
AF-A0A6L8J9B2-F1-model_v4 deleted 0.9873 1 130
AF-A0A6I7P0C6-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.986 1 131 GO:0000287
GO:0004540
GO:0090729
AF-A0A7V8YHG4-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9857 1 112 GO:0004518

Map