F351159

General Info

Members Datasets Scaffolds Average Seq Length
238 130 476 305

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0079292|Ga0395901_0079292_269_1237
Length 322
Sequence VESILDAIGNTPLVRLRRCAPENGAELWLKLEYRNPTGSMKDRMALAMIEGAERDGLLAPGDTVVEYTGGSTGPAIALVCRAKGYRALIVIADCFTEERFQLMRALGAELDVVRSVEGRPKVTAQDIRNMVARAEELAARPDHYATDQFNNPYIIPDHRDRLGREIWKQSKGRVTAFCHGMGTASSLLGISDALRPHGVFIQGHEPASSAAITGGEPGPFLIQGWTGMVMPHWDAARVDHVEPIGDQEAVEMTRRLAEEEGIFAGISSGANVVGAHRLAERLGPEAVIATLAVDSGFKYLSVSPYADLVPSSSASPRTSSQR

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
83 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
84 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
90 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
91 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
92 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
93 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
94 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
95 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
96 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
97 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
98 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
99 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
100 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
129 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
130 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0
Rhizoplane 17.23
Rhizosphere 81.51
Stem 0
Stem Tuber 0
Unclassified 2.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0079292 3300038443 Bacteria 3429
2 Ga0070683_100171666 3300005329 Bacteria 2058
3 Ga0070691_10016449 3300005341 Bacteria 3397
4 Ga0070687_100226912 3300005343 Bacteria 1147
5 Ga0070692_10156604 3300005345 Bacteria 1302
6 Ga0070668_100026560 3300005347 Bacteria 4394
7 Ga0070675_100224756 3300005354 Bacteria 1636
8 Ga0070714_100013438 3300005435 Bacteria 6561
9 Ga0070710_10041290 3300005437 Bacteria 2546
10 Ga0070711_100025118 3300005439 Bacteria 3895
11 Ga0070711_100092458 3300005439 Bacteria 2183
12 Ga0070700_100021946 3300005441 Bacteria 3716
13 Ga0070708_100031280 3300005445 Bacteria 4606
14 Ga0070708_100169344 3300005445 Unclassified 2038
15 Ga0070708_100298163 3300005445 Bacteria 1518
16 Ga0070678_100022871 3300005456 Bacteria 4154
17 Ga0070662_100022137 3300005457 Bacteria 4346
18 Ga0070662_100059843 3300005457 Bacteria 2776
19 Ga0068867_100077732 3300005459 Bacteria 2494
20 Ga0070706_100002633 3300005467 Bacteria 17978
21 Ga0070706_100189824 3300005467 Bacteria 1920
22 Ga0070706_100407106 3300005467 Bacteria 1266
23 Ga0070698_100008109 3300005471 Bacteria 11354
24 Ga0070699_100071108 3300005518 Bacteria 3026
25 Ga0070684_100031115 3300005535 Bacteria 4541
26 Ga0068853_100103132 3300005539 Bacteria 2525
27 Ga0070695_100222851 3300005545 Bacteria 1359
28 Ga0070696_100030740 3300005546 Bacteria 3679
29 Ga0070693_100121517 3300005547 Bacteria 1620
30 Ga0070704_100321084 3300005549 Bacteria 1297
31 Ga0068855_100093334 3300005563 Bacteria 3470
32 Ga0068854_100022619 3300005578 Bacteria 4286
33 Ga0068856_100357196 3300005614 Bacteria 1480
34 Ga0070702_100023336 3300005615 Bacteria 3286
35 Ga0070702_100095004 3300005615 Bacteria 1816
36 Ga0068852_100157109 3300005616 Bacteria 2120
37 Ga0068861_100026182 3300005719 Bacteria 4239
38 Ga0068861_100474549 3300005719 Bacteria 1126
39 Ga0081455_10017539 3300005937 Bacteria 6858
40 Ga0081539_10002754 3300005985 Bacteria 23660
41 Ga0075365_10051717 3300006038 Bacteria 2715
42 Ga0070712_100008220 3300006175 Bacteria 6554
43 Ga0070712_100016590 3300006175 Bacteria 4757
44 Ga0097621_100023027 3300006237 Bacteria 4844
45 Ga0075431_100178311 3300006847 Bacteria 2181
46 Ga0075434_100157336 3300006871 Bacteria 2292
47 Ga0068865_100027816 3300006881 Bacteria 3738
48 Ga0068865_100166274 3300006881 Bacteria 1687
49 Ga0075436_100004999 3300006914 Bacteria 9109
50 Ga0075435_100080418 3300007076 Bacteria 2676
51 Ga0075435_100125492 3300007076 Bacteria 2145
52 Ga0105240_10361003 3300009093 Bacteria 1645
53 Ga0111539_10011176 3300009094 Bacteria 11285
54 Ga0111539_10035121 3300009094 Bacteria 6071
55 Ga0105245_10207630 3300009098 Bacteria 1884
56 Ga0114129_10062947 3300009147 Bacteria 5182
57 Ga0114129_10143170 3300009147 Bacteria 3276
58 Ga0114129_10398586 3300009147 Bacteria 1814
59 Ga0114129_10504755 3300009147 Bacteria 1579
60 Ga0105243_10054255 3300009148 Bacteria 3181
61 Ga0105243_10154021 3300009148 Bacteria 1975
62 Ga0105241_10139430 3300009174 Bacteria 1973
63 Ga0105242_10145260 3300009176 Bacteria 2063
64 Ga0105242_10329440 3300009176 Bacteria 1403
65 Ga0105248_10291077 3300009177 Bacteria 1839
66 Ga0105249_10023389 3300009553 Bacteria 5545
67 Ga0105249_10315392 3300009553 Bacteria 1573
68 Ga0105239_10074330 3300010375 Bacteria 3737
69 Ga0157374_10475370 3300013296 Bacteria 1253
70 Ga0163162_10019912 3300013306 Bacteria 6590
71 Ga0163162_10119554 3300013306 Bacteria 2738
72 Ga0157375_10605888 3300013308 Bacteria 1254
73 Ga0182008_10004566 3300014497 Bacteria 8062
74 Ga0157376_10067978 3300014969 Bacteria 3016
75 Ga0157376_10167290 3300014969 Bacteria 1999
76 Ga0182007_10004997 3300015262 Bacteria 5900
77 Ga0163161_10047313 3300017792 Bacteria 3107
78 Ga0207688_10101474 3300025901 Bacteria 1662
79 Ga0207685_10010402 3300025905 Bacteria 2747
80 Ga0207684_10142746 3300025910 Bacteria 2059
81 Ga0207693_10004240 3300025915 Bacteria 12156
82 Ga0207693_10011767 3300025915 Bacteria 7072
83 Ga0207693_10013575 3300025915 Bacteria 6565
84 Ga0207663_10004702 3300025916 Bacteria 6818
85 Ga0207662_10006868 3300025918 Bacteria 6166
86 Ga0207662_10016714 3300025918 Bacteria 4143
87 Ga0207687_10155298 3300025927 Bacteria 1750
88 Ga0207700_10232436 3300025928 Bacteria 1568
89 Ga0207664_10024462 3300025929 Bacteria 4539
90 Ga0207664_10186618 3300025929 Bacteria 1783
91 Ga0207644_10537356 3300025931 Bacteria 967
92 Ga0207706_10005919 3300025933 Bacteria 11374
93 Ga0207706_10232656 3300025933 Bacteria 1612
94 Ga0207686_10038721 3300025934 Bacteria 2887
95 Ga0207686_10086083 3300025934 Bacteria 2063
96 Ga0207709_10166190 3300025935 Bacteria 1544
97 Ga0207665_10001031 3300025939 Bacteria 18776
98 Ga0207665_10250718 3300025939 Bacteria 1308
99 Ga0207667_10100118 3300025949 Bacteria 2990
100 Ga0207667_10166430 3300025949 Bacteria 2266
101 Ga0207712_10065798 3300025961 Bacteria 2589
102 Ga0207712_10196645 3300025961 Bacteria 1595
103 Ga0207712_10215153 3300025961 Bacteria 1533
104 Ga0207640_10083329 3300025981 Bacteria 2192
105 Ga0207678_10025427 3300026067 Bacteria 5168
106 Ga0207708_10001245 3300026075 Bacteria 19217
107 Ga0207702_10022325 3300026078 Bacteria 5246
108 Ga0207702_10125680 3300026078 Bacteria 2302
109 Ga0207674_10314636 3300026116 Bacteria 1515
110 Ga0207675_100000420 3300026118 Bacteria 40991
111 Ga0207675_100030366 3300026118 Bacteria 5033
112 Ga0207675_100170033 3300026118 Bacteria 2083
113 Ga0207698_10091204 3300026142 Bacteria 2494
114 Ga0307416_100018682 3300032002 Bacteria 4893
115 Ga0373958_0001659 3300034819 Bacteria 3023
116 Ga0373932_0017353 3300035112 Bacteria 1847
117 Ga0373962_0016473 3300035242 Bacteria 1906
118 Ga0395899_0021584 3300037312 Bacteria 4883
119 Ga0395899_0022646 3300037312 Bacteria 4759
120 Ga0395899_0044302 3300037312 Bacteria 3316
121 Ga0395899_0204024 3300037312 Bacteria 1377
122 Ga0395900_0002588 3300037418 Bacteria 19786
123 Ga0395900_0006041 3300037418 Bacteria 12631
124 Ga0395900_0008740 3300037418 Bacteria 10404
125 Ga0395900_0052419 3300037418 Bacteria 4200
126 Ga0395900_0056047 3300037418 Bacteria 4057
127 Ga0395900_0104161 3300037418 Unclassified 2915
128 Ga0395900_0120965 3300037418 Bacteria 2686
129 Ga0395900_0179610 3300037418 Bacteria 2152
130 Ga0395900_0314874 3300037418 Unclassified 1547
131 Ga0395900_0509818 3300037418 Bacteria 1152
132 Ga0395900_0642459 3300037418 Bacteria 998
133 Ga0395898_0005154 3300037466 Bacteria 14140
134 Ga0395898_0006453 3300037466 Bacteria 12529
135 Ga0395898_0013489 3300037466 Bacteria 8414
136 Ga0395898_0017746 3300037466 Bacteria 7262
137 Ga0395898_0023929 3300037466 Bacteria 6164
138 Ga0395898_0144764 3300037466 Bacteria 2275
139 Ga0395898_0370662 3300037466 Bacteria 1365
140 Ga0395905_0001388 3300037471 Bacteria 29372
141 Ga0395905_0024399 3300037471 Bacteria 5707
142 Ga0395905_0210581 3300037471 Bacteria 1821
143 Ga0395905_0246458 3300037471 Bacteria 1669
144 Ga0395905_0282100 3300037471 Bacteria 1547
145 Ga0395901_0000376 3300038443 Bacteria 53640
146 Ga0395901_0008470 3300038443 Bacteria 10393
147 Ga0395901_0009366 3300038443 Bacteria 9934
148 Ga0395901_0009395 3300038443 Bacteria 9920
149 Ga0395901_0009676 3300038443 Bacteria 9776
150 Ga0395901_0010444 3300038443 Bacteria 9407
151 Ga0395901_0021973 3300038443 Bacteria 6540
152 Ga0395901_0097240 3300038443 Bacteria 3086
153 Ga0395901_0297985 3300038443 Bacteria 1672
154 Ga0395901_0349273 3300038443 Bacteria 1526
155 Ga0395901_0594417 3300038443 Bacteria 1116
156 Ga0395901_0630823 3300038443 Bacteria 1077
157 Ga0451853_1574810 3300041512 Bacteria 3625
158 Ga0466964_0021198 3300044706 Bacteria 2512
159 Ga0466964_0027168 3300044706 Bacteria 2245
160 Ga0466964_0030472 3300044706 Bacteria 2135
161 Ga0466960_0112835 3300044901 Bacteria 1414
162 Ga0495641_0046285 3300046461 Bacteria 2001
163 Ga0495582_0011834 3300046473 Bacteria 4805
164 Ga0495609_0097796 3300046538 Bacteria 1273
165 Ga0495658_0027341 3300046683 Bacteria 3069
166 Ga0495671_0200525 3300046692 Bacteria 968
167 Ga0495581_0006858 3300047315 Bacteria 6604
168 Ga0495676_0018021 3300047321 Bacteria 6229
169 Ga0496100_0077185 3300048903 Bacteria 2239
170 Ga0496101_0110662 3300048904 Bacteria 2067
171 Ga0496101_0277917 3300048904 Bacteria 1308
172 Ga0496102_0027074 3300048905 Bacteria 5119
173 Ga0496102_0057601 3300048905 Bacteria 3549
174 Ga0496102_0308520 3300048905 Bacteria 1491
175 Ga0496102_0356689 3300048905 Bacteria 1376
176 Ga0496102_0383832 3300048905 Bacteria 1322
177 Ga0496102_0855549 3300048905 Bacteria 831
178 Ga0496103_0026154 3300048906 Bacteria 3532
179 Ga0496103_0034137 3300048906 Bacteria 3110
180 Ga0496103_0048602 3300048906 Bacteria 2622
181 Ga0496104_0023278 3300048907 Bacteria 5695
182 Ga0496104_0049405 3300048907 Bacteria 3967
183 Ga0496104_0129830 3300048907 Bacteria 2420
184 Ga0496105_0030190 3300048908 Bacteria 4441
185 Ga0496105_0047178 3300048908 Bacteria 3554
186 Ga0496106_0050946 3300048909 Bacteria 3121
187 Ga0496106_0449877 3300048909 Bacteria 1035
188 Ga0496107_0056083 3300048910 Bacteria 2846
189 Ga0496107_0378518 3300048910 Bacteria 1053
190 Ga0496108_0003217 3300048911 Bacteria 13137
191 Ga0496108_0003345 3300048911 Bacteria 12882
192 Ga0496109_0004063 3300048912 Bacteria 12233
193 Ga0496109_0004592 3300048912 Bacteria 11528
194 Ga0496109_0151463 3300048912 Bacteria 2171
195 Ga0496110_0002813 3300048913 Bacteria 13131
196 Ga0496110_0005214 3300048913 Bacteria 10169
197 Ga0496110_0012064 3300048913 Bacteria 7100
198 Ga0496110_0743862 3300048913 Unclassified 883
199 Ga0496111_0000239 3300048914 Bacteria 26296
200 Ga0496111_0003666 3300048914 Bacteria 9537
201 Ga0496111_0007043 3300048914 Bacteria 7346
202 Ga0496111_0112349 3300048914 Bacteria 2007
203 Ga0496111_0164819 3300048914 Unclassified 1646
204 Ga0496111_0529820 3300048914 Bacteria 866
205 Ga0496112_0171451 3300048915 Bacteria 2135
206 Ga0496114_0008945 3300048917 Bacteria 7938
207 Ga0496114_0039736 3300048917 Bacteria 3893
208 Ga0496114_0064193 3300048917 Bacteria 3075
209 Ga0496115_0159235 3300048918 Bacteria 1865
210 Ga0501067_0000043 3300049583 Bacteria 75533
211 Ga0501067_0005949 3300049583 Bacteria 6762
212 Ga0501067_0007536 3300049583 Bacteria 6049
213 Ga0501067_0022106 3300049583 Bacteria 3519
214 Ga0501067_0056653 3300049583 Bacteria 2171
215 Ga0501068_0000353 3300049584 Bacteria 23073
216 Ga0501068_0202785 3300049584 Bacteria 1258
217 Ga0501069_0000188 3300049585 Bacteria 27727
218 Ga0501069_0021441 3300049585 Bacteria 3506
219 Ga0501069_0102255 3300049585 Bacteria 1627
220 Ga0501069_0256499 3300049585 Bacteria 1020
221 Ga0501070_0350887 3300049586 Bacteria 1197
222 Ga0501071_0079383 3300049587 Bacteria 2399
223 Ga0501076_0127494 3300049592 Bacteria 2063
224 Ga0501077_0033950 3300049593 Unclassified 3247
225 Ga0501079_0261129 3300049741 Bacteria 1354
226 Ga0501081_0030160 3300049743 Bacteria 3670
227 nmdc:mga0yw44_147232_c1 3300050492 Bacteria 1534
228 nmdc:mga05p37_210131_c1 3300050507 Bacteria 2353
229 nmdc:mga05p37_324398_c1 3300050507 Bacteria 1821
230 nmdc:mga06r32_378662_c1 3300050510 Bacteria 1398
231 nmdc:mga08y16_146127_c1 3300050511 Bacteria 2458
232 nmdc:mga08y16_81889_c1 3300050511 Bacteria 3365
233 nmdc:mga0n895_116338_c1 3300050512 Bacteria 2693
234 nmdc:mga0n895_253377_c1 3300050512 Bacteria 1786
235 nmdc:mga08x19_96809_c1 3300050514 Bacteria 1954
236 Ga0495601_0092310 3300053077 Bacteria 1950
237 Ga0530510_0007000 3300061734 Bacteria 7855
238 Ga0530510_0015453 3300061734 Bacteria 5394
239 Ga0395901_0079292
240 Ga0070683_100171666
241 Ga0070691_10016449
242 Ga0070687_100226912
243 Ga0070692_10156604
244 Ga0070668_100026560
245 Ga0070675_100224756
246 Ga0070714_100013438
247 Ga0070710_10041290
248 Ga0070711_100025118
249 Ga0070711_100092458
250 Ga0070700_100021946
251 Ga0070708_100031280
252 Ga0070708_100169344
253 Ga0070708_100298163
254 Ga0070678_100022871
255 Ga0070662_100022137
256 Ga0070662_100059843
257 Ga0068867_100077732
258 Ga0070706_100002633
259 Ga0070706_100189824
260 Ga0070706_100407106
261 Ga0070698_100008109
262 Ga0070699_100071108
263 Ga0070684_100031115
264 Ga0068853_100103132
265 Ga0070695_100222851
266 Ga0070696_100030740
267 Ga0070693_100121517
268 Ga0070704_100321084
269 Ga0068855_100093334
270 Ga0068854_100022619
271 Ga0068856_100357196
272 Ga0070702_100023336
273 Ga0070702_100095004
274 Ga0068852_100157109
275 Ga0068861_100026182
276 Ga0068861_100474549
277 Ga0081455_10017539
278 Ga0081539_10002754
279 Ga0075365_10051717
280 Ga0070712_100008220
281 Ga0070712_100016590
282 Ga0097621_100023027
283 Ga0075431_100178311
284 Ga0075434_100157336
285 Ga0068865_100027816
286 Ga0068865_100166274
287 Ga0075436_100004999
288 Ga0075435_100080418
289 Ga0075435_100125492
290 Ga0105240_10361003
291 Ga0111539_10011176
292 Ga0111539_10035121
293 Ga0105245_10207630
294 Ga0114129_10062947
295 Ga0114129_10143170
296 Ga0114129_10398586
297 Ga0114129_10504755
298 Ga0105243_10054255
299 Ga0105243_10154021
300 Ga0105241_10139430
301 Ga0105242_10145260
302 Ga0105242_10329440
303 Ga0105248_10291077
304 Ga0105249_10023389
305 Ga0105249_10315392
306 Ga0105239_10074330
307 Ga0157374_10475370
308 Ga0163162_10019912
309 Ga0163162_10119554
310 Ga0157375_10605888
311 Ga0182008_10004566
312 Ga0157376_10067978
313 Ga0157376_10167290
314 Ga0182007_10004997
315 Ga0163161_10047313
316 Ga0207688_10101474
317 Ga0207685_10010402
318 Ga0207684_10142746
319 Ga0207693_10004240
320 Ga0207693_10011767
321 Ga0207693_10013575
322 Ga0207663_10004702
323 Ga0207662_10006868
324 Ga0207662_10016714
325 Ga0207687_10155298
326 Ga0207700_10232436
327 Ga0207664_10024462
328 Ga0207664_10186618
329 Ga0207644_10537356
330 Ga0207706_10005919
331 Ga0207706_10232656
332 Ga0207686_10038721
333 Ga0207686_10086083
334 Ga0207709_10166190
335 Ga0207665_10001031
336 Ga0207665_10250718
337 Ga0207667_10100118
338 Ga0207667_10166430
339 Ga0207712_10065798
340 Ga0207712_10196645
341 Ga0207712_10215153
342 Ga0207640_10083329
343 Ga0207678_10025427
344 Ga0207708_10001245
345 Ga0207702_10022325
346 Ga0207702_10125680
347 Ga0207674_10314636
348 Ga0207675_100000420
349 Ga0207675_100030366
350 Ga0207675_100170033
351 Ga0207698_10091204
352 Ga0307416_100018682
353 Ga0373958_0001659
354 Ga0373932_0017353
355 Ga0373962_0016473
356 Ga0395899_0021584
357 Ga0395899_0022646
358 Ga0395899_0044302
359 Ga0395899_0204024
360 Ga0395900_0002588
361 Ga0395900_0006041
362 Ga0395900_0008740
363 Ga0395900_0052419
364 Ga0395900_0056047
365 Ga0395900_0104161
366 Ga0395900_0120965
367 Ga0395900_0179610
368 Ga0395900_0314874
369 Ga0395900_0509818
370 Ga0395900_0642459
371 Ga0395898_0005154
372 Ga0395898_0006453
373 Ga0395898_0013489
374 Ga0395898_0017746
375 Ga0395898_0023929
376 Ga0395898_0144764
377 Ga0395898_0370662
378 Ga0395905_0001388
379 Ga0395905_0024399
380 Ga0395905_0210581
381 Ga0395905_0246458
382 Ga0395905_0282100
383 Ga0395901_0000376
384 Ga0395901_0008470
385 Ga0395901_0009366
386 Ga0395901_0009395
387 Ga0395901_0009676
388 Ga0395901_0010444
389 Ga0395901_0021973
390 Ga0395901_0097240
391 Ga0395901_0297985
392 Ga0395901_0349273
393 Ga0395901_0594417
394 Ga0395901_0630823
395 Ga0451853_1574810
396 Ga0466964_0021198
397 Ga0466964_0027168
398 Ga0466964_0030472
399 Ga0466960_0112835
400 Ga0495641_0046285
401 Ga0495582_0011834
402 Ga0495609_0097796
403 Ga0495658_0027341
404 Ga0495671_0200525
405 Ga0495581_0006858
406 Ga0495676_0018021
407 Ga0496100_0077185
408 Ga0496101_0110662
409 Ga0496101_0277917
410 Ga0496102_0027074
411 Ga0496102_0057601
412 Ga0496102_0308520
413 Ga0496102_0356689
414 Ga0496102_0383832
415 Ga0496102_0855549
416 Ga0496103_0026154
417 Ga0496103_0034137
418 Ga0496103_0048602
419 Ga0496104_0023278
420 Ga0496104_0049405
421 Ga0496104_0129830
422 Ga0496105_0030190
423 Ga0496105_0047178
424 Ga0496106_0050946
425 Ga0496106_0449877
426 Ga0496107_0056083
427 Ga0496107_0378518
428 Ga0496108_0003217
429 Ga0496108_0003345
430 Ga0496109_0004063
431 Ga0496109_0004592
432 Ga0496109_0151463
433 Ga0496110_0002813
434 Ga0496110_0005214
435 Ga0496110_0012064
436 Ga0496110_0743862
437 Ga0496111_0000239
438 Ga0496111_0003666
439 Ga0496111_0007043
440 Ga0496111_0112349
441 Ga0496111_0164819
442 Ga0496111_0529820
443 Ga0496112_0171451
444 Ga0496114_0008945
445 Ga0496114_0039736
446 Ga0496114_0064193
447 Ga0496115_0159235
448 Ga0501067_0000043
449 Ga0501067_0005949
450 Ga0501067_0007536
451 Ga0501067_0022106
452 Ga0501067_0056653
453 Ga0501068_0000353
454 Ga0501068_0202785
455 Ga0501069_0000188
456 Ga0501069_0021441
457 Ga0501069_0102255
458 Ga0501069_0256499
459 Ga0501070_0350887
460 Ga0501071_0079383
461 Ga0501076_0127494
462 Ga0501077_0033950
463 Ga0501079_0261129
464 Ga0501081_0030160
465 nmdc:mga0yw44_147232_c1
466 nmdc:mga05p37_210131_c1
467 nmdc:mga05p37_324398_c1
468 nmdc:mga06r32_378662_c1
469 nmdc:mga08y16_146127_c1
470 nmdc:mga08y16_81889_c1
471 nmdc:mga0n895_116338_c1
472 nmdc:mga0n895_253377_c1
473 nmdc:mga08x19_96809_c1
474 Ga0495601_0092310
475 Ga0530510_0007000
476 Ga0530510_0015453

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

4

294

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mfj-assembly1.cif.gz_AAA structural characterization of beta cyanoalanine synthase from tetranychus urticae 0.927 1 290
6pmu-assembly1.cif.gz_A structural characterization of beta cyanoalanine synthase from tetranychus urticae 0.9268 2 290
4air-assembly1.cif.gz_A leishmania major cysteine synthase 0.9245 1 292
6pmu-assembly1.cif.gz_B structural characterization of beta cyanoalanine synthase from tetranychus urticae 0.9204 1 290
7mfj-assembly1.cif.gz_BBB structural characterization of beta cyanoalanine synthase from tetranychus urticae 0.9164 1 290
ID Description Score Start End Superfamily
3x44B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9362 35 145 3.40.50.1100
af_Q2G0V4_40_140_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9348 43 150 3.40.50.1100
5b1iC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9316 42 145 3.40.50.1100
af_Q965I8_90_187_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9315 37 146 3.40.50.1100
3rr2A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9255 43 150 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A538JWY2-F1-model_v4 Cysteine synthase family protein 0.9657 1 292 GO:0006535
GO:0016765
AF-A0A538JWY2-F1-model_v4 Cysteine synthase family protein 0.953 1 292 GO:0006535
GO:0016765
AF-A0A537KM25-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.946 6 195 GO:0006535
GO:0016765
AF-A0A7C4CY41-F1-model_v4 Cysteine synthase family protein 0.9426 1 174 GO:0006534
GO:0009069
GO:0044272
AF-A0A3N5YSU2-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9416 5 158 GO:0006535
GO:0016765

Map