F351032

General Info

Members Datasets Scaffolds Average Seq Length
238 157 476 357

Family's Representative Sequence

Representative Sequence 3300025940|Ga0207691_10075867|Ga0207691_100758674
Length 412
Sequence VLHCVGSVRFPPSNRGCSCSLGFLGVLYWIAGATRQKAVVAAMLHEFVAGNREELIRRCRAKVETRSIPPPTSAELEFGVPRFLDQLVYALRNHLSSNSEISRSAERHGHDLQLQGCTVSQVVHDYGDVCQSITDLALRLNAPISVEDFRTLNRCLDDAIASAVTEYGRGHQSLLDANAARDDERLGFLEHEIRNLVGTASVAFEVLRTGNVGVGGSTGGVLQRSLSALRDLINRSLGERRMRHDIRDRTQFGIGEFIAELAPAAALEARARGVVLNVVEGDPGARVDADRAILAATVENLLQNAFKFTGPGTTVTLRSRAASDRVLIEVEDECGGLPDGNASVLFQPFEQRGADRTGLGLGLAISRWGAEANGGRIYARDLPDHGCIFIVDLPRAFSLPDASVNQGVAQAG

Samples

Sample ID Description Type Environment
1 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
135 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
136 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
137 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
138 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
139 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.26
Nodule 0
Rhizoplane 1.26
Rhizosphere 97.48
Stem 0
Stem Tuber 0
Unclassified 26.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207691_10075867 3300025940 Bacteria 3030
2 JGI24034J26672_10017049 3300002239 Unclassified 1122
3 Ga0065712_10015206 3300005290 Bacteria 2972
4 Ga0065712_10144822 3300005290 Unclassified 1418
5 Ga0065707_10144432 3300005295 Bacteria 1731
6 Ga0070683_100108480 3300005329 Bacteria 2618
7 Ga0070690_100090328 3300005330 Unclassified 2016
8 Ga0070670_100122352 3300005331 Bacteria 2244
9 Ga0070677_10017726 3300005333 Unclassified 2554
10 Ga0070677_10022936 3300005333 Bacteria 2305
11 Ga0068869_100018454 3300005334 Bacteria 4749
12 Ga0068869_100045703 3300005334 Bacteria 3154
13 Ga0068869_100164848 3300005334 Unclassified 1727
14 Ga0070689_100084199 3300005340 Unclassified 2499
15 Ga0070687_100065497 3300005343 Unclassified 1933
16 Ga0070661_100162596 3300005344 Unclassified 1691
17 Ga0070669_100026056 3300005353 Bacteria 4205
18 Ga0070669_100049646 3300005353 Bacteria 3063
19 Ga0070669_100119179 3300005353 Bacteria 2011
20 Ga0070669_100128896 3300005353 Unclassified 1938
21 Ga0070675_100001341 3300005354 Bacteria 18026
22 Ga0070675_100032494 3300005354 Bacteria 4224
23 Ga0070671_100059091 3300005355 Unclassified 3191
24 Ga0070674_100001931 3300005356 Bacteria 11307
25 Ga0070674_100026255 3300005356 Bacteria 3802
26 Ga0070673_100082643 3300005364 Bacteria 2607
27 Ga0070688_100004375 3300005365 Bacteria 7349
28 Ga0070659_100207912 3300005366 Unclassified 1612
29 Ga0070714_100000044 3300005435 Bacteria 115191
30 Ga0070714_100010134 3300005435 Bacteria 7440
31 Ga0070705_100030757 3300005440 Archaea 2966
32 Ga0070705_100071864 3300005440 Bacteria 2094
33 Ga0070700_100090287 3300005441 Unclassified 1998
34 Ga0070708_100216413 3300005445 Unclassified 1796
35 Ga0070663_100191781 3300005455 Bacteria 1590
36 Ga0070678_100076350 3300005456 Bacteria 2523
37 Ga0070662_100041905 3300005457 Plasmid 3268
38 Ga0068867_100026683 3300005459 Bacteria 4148
39 Ga0068867_100078225 3300005459 Bacteria 2487
40 Ga0070685_10066791 3300005466 Bacteria 2120
41 Ga0070698_100000279 3300005471 Bacteria 51966
42 Ga0070679_100033434 3300005530 Bacteria 5092
43 Ga0070684_100062667 3300005535 Bacteria 3258
44 Ga0070684_100117919 3300005535 Bacteria 2385
45 Ga0068853_100230158 3300005539 Bacteria 1695
46 Ga0070672_100153243 3300005543 Bacteria 1908
47 Ga0070672_100378426 3300005543 Unclassified 1210
48 Ga0070686_100028069 3300005544 Bacteria 3410
49 Ga0070695_100088126 3300005545 Bacteria 2066
50 Ga0070696_100053848 3300005546 Bacteria 2802
51 Ga0070696_100293903 3300005546 Bacteria 1242
52 Ga0070693_100016570 3300005547 Bacteria 3817
53 Ga0070664_100178259 3300005564 Bacteria 1888
54 Ga0070664_100205151 3300005564 Unclassified 1760
55 Ga0068857_100113441 3300005577 Bacteria 2437
56 Ga0068854_100133556 3300005578 Bacteria 1897
57 Ga0068856_100227967 3300005614 Unclassified 1878
58 Ga0068852_100267285 3300005616 Unclassified 1644
59 Ga0068859_100183204 3300005617 Bacteria 2177
60 Ga0068859_100228168 3300005617 Unclassified 1950
61 Ga0068859_100254621 3300005617 Bacteria 1846
62 Ga0068861_100060931 3300005719 Unclassified 2894
63 Ga0068861_100118750 3300005719 Unclassified 2130
64 Ga0068851_10032957 3300005834 Unclassified 2579
65 Ga0068870_10096113 3300005840 Bacteria 1665
66 Ga0068863_100054029 3300005841 Bacteria 3806
67 Ga0068863_100096110 3300005841 Unclassified 2812
68 Ga0068860_100149388 3300005843 Unclassified 2249
69 Ga0075365_10031714 3300006038 Bacteria 3391
70 Ga0075362_10074704 3300006177 Bacteria 1554
71 Ga0097621_100109331 3300006237 Bacteria 2335
72 Ga0097621_100143177 3300006237 Bacteria 2044
73 Ga0097621_100145816 3300006237 Bacteria 2027
74 Ga0068871_100269529 3300006358 Unclassified 1487
75 Ga0075428_100000004 3300006844 Bacteria 326694
76 Ga0075428_100005621 3300006844 Bacteria 13928
77 Ga0075428_100025193 3300006844 Bacteria 6582
78 Ga0075428_100032430 3300006844 Bacteria 5770
79 Ga0075430_100118358 3300006846 Unclassified 2208
80 Ga0075431_100145852 3300006847 Bacteria 2439
81 Ga0075431_100435332 3300006847 Archaea 1309
82 Ga0075434_100014692 3300006871 Bacteria 7489
83 Ga0075434_100027814 3300006871 Bacteria 5552
84 Ga0075429_100035876 3300006880 Unclassified 4312
85 Ga0075429_100119909 3300006880 Bacteria 2299
86 Ga0068865_100040941 3300006881 Bacteria 3151
87 Ga0097620_100183210 3300006931 Bacteria 2177
88 Ga0097620_100228169 3300006931 Unclassified 1950
89 Ga0097620_100254632 3300006931 Bacteria 1846
90 Ga0075435_100108836 3300007076 Bacteria 2303
91 Ga0075435_100201441 3300007076 Bacteria 1687
92 Ga0105240_10297967 3300009093 Bacteria 1846
93 Ga0111539_10000005 3300009094 Bacteria 467342
94 Ga0111539_10016879 3300009094 Bacteria 9041
95 Ga0105245_10327920 3300009098 Bacteria 1510
96 Ga0105247_10056571 3300009101 Bacteria 2423
97 Ga0114129_10009827 3300009147 Bacteria 13644
98 Ga0114129_10057201 3300009147 Bacteria 5459
99 Ga0114129_10067601 3300009147 Plasmid 4984
100 Ga0114129_10157540 3300009147 Bacteria 3104
101 Ga0114129_10209046 3300009147 Bacteria 2639
102 Ga0114129_10574127 3300009147 Bacteria 1464
103 Ga0105243_10008625 3300009148 Bacteria 7820
104 Ga0105243_10286527 3300009148 Unclassified 1486
105 Ga0105242_10010021 3300009176 Bacteria 7256
106 Ga0105242_10210107 3300009176 Bacteria 1734
107 Ga0105248_10046911 3300009177 Bacteria 4844
108 Ga0105238_10049734 3300009551 Archaea 4221
109 Ga0105249_10005666 3300009553 Bacteria 10806
110 Ga0105249_10108731 3300009553 Bacteria 2618
111 Ga0105239_10114150 3300010375 Bacteria 2996
112 Ga0105246_10014919 3300011119 Bacteria 4897
113 Ga0157373_10022808 3300013100 Bacteria 4539
114 Ga0157374_10048938 3300013296 Bacteria 3924
115 Ga0157378_10192090 3300013297 Unclassified 1926
116 Ga0157375_10436733 3300013308 Bacteria 1475
117 Ga0157375_10439098 3300013308 Bacteria 1471
118 Ga0163163_10382257 3300014325 Unclassified 1465
119 Ga0157380_10056619 3300014326 Bacteria 3119
120 Ga0157377_10117075 3300014745 Bacteria 1610
121 Ga0157379_10001101 3300014968 Bacteria 22079
122 Ga0157379_10089210 3300014968 Bacteria 2766
123 Ga0157379_10189451 3300014968 Bacteria 1859
124 Ga0157376_10054193 3300014969 Unclassified 3342
125 Ga0163161_10222774 3300017792 Bacteria 1461
126 Ga0207697_10001098 3300025315 Bacteria 14918
127 Ga0207656_10043256 3300025321 Unclassified 1920
128 Ga0207682_10016141 3300025893 Unclassified 2910
129 Ga0207688_10108490 3300025901 Unclassified 1609
130 Ga0207647_10040915 3300025904 Bacteria 2917
131 Ga0207645_10013848 3300025907 Bacteria 5413
132 Ga0207645_10131150 3300025907 Bacteria 1631
133 Ga0207643_10005406 3300025908 Bacteria 6836
134 Ga0207643_10014965 3300025908 Archaea 4221
135 Ga0207643_10034263 3300025908 Bacteria 2845
136 Ga0207643_10136281 3300025908 Bacteria 1464
137 Ga0207654_10055841 3300025911 Unclassified 2288
138 Ga0207671_10058539 3300025914 Archaea 2857
139 Ga0207660_10027125 3300025917 Bacteria 3905
140 Ga0207662_10026784 3300025918 Bacteria 3327
141 Ga0207657_10090527 3300025919 Unclassified 2553
142 Ga0207681_10052913 3300025923 Bacteria 2754
143 Ga0207681_10121361 3300025923 Unclassified 1917
144 Ga0207681_10159408 3300025923 Unclassified 1699
145 Ga0207650_10219447 3300025925 Bacteria 1530
146 Ga0207659_10013297 3300025926 Bacteria 5265
147 Ga0207659_10065301 3300025926 Bacteria 2637
148 Ga0207659_10108883 3300025926 Unclassified 2102
149 Ga0207659_10150775 3300025926 Bacteria 1815
150 Ga0207687_10211612 3300025927 Bacteria 1521
151 Ga0207664_10000044 3300025929 Bacteria 147216
152 Ga0207644_10042819 3300025931 Bacteria 3210
153 Ga0207644_10066024 3300025931 Unclassified 2633
154 Ga0207706_10097706 3300025933 Bacteria 2583
155 Ga0207686_10011165 3300025934 Bacteria 4910
156 Ga0207669_10001002 3300025937 Bacteria 12040
157 Ga0207669_10096676 3300025937 Unclassified 1939
158 Ga0207669_10122270 3300025937 Bacteria 1770
159 Ga0207669_10138811 3300025937 Unclassified 1684
160 Ga0207704_10039567 3300025938 Unclassified 2747
161 Ga0207704_10040667 3300025938 Bacteria 2720
162 Ga0207665_10039610 3300025939 Bacteria 3142
163 Ga0207691_10054361 3300025940 Unclassified 3653
164 Ga0207691_10064415 3300025940 Plasmid 3321
165 Ga0207711_10119619 3300025941 Bacteria 2350
166 Ga0207711_10247707 3300025941 Unclassified 1635
167 Ga0207689_10009994 3300025942 Bacteria 8179
168 Ga0207689_10182633 3300025942 Bacteria 1730
169 Ga0207651_10096365 3300025960 Bacteria 2181
170 Ga0207712_10030281 3300025961 Bacteria 3637
171 Ga0207712_10088746 3300025961 Bacteria 2272
172 Ga0207668_10011300 3300025972 Bacteria 5420
173 Ga0207668_10056721 3300025972 Bacteria 2729
174 Ga0207640_10095728 3300025981 Bacteria 2068
175 Ga0207658_10091754 3300025986 Unclassified 2357
176 Ga0207658_10389499 3300025986 Unclassified 1222
177 Ga0207677_10018286 3300026023 Bacteria 4202
178 Ga0207703_10086790 3300026035 Bacteria 2622
179 Ga0207703_10183956 3300026035 Bacteria 1846
180 Ga0207639_10108680 3300026041 Unclassified 2255
181 Ga0207678_10032319 3300026067 Bacteria 4560
182 Ga0207708_10068822 3300026075 Archaea 2709
183 Ga0207648_10001404 3300026089 Bacteria 26508
184 Ga0207674_10026849 3300026116 Bacteria 6107
185 Ga0207675_100008737 3300026118 Bacteria 9516
186 Ga0207675_100051927 3300026118 Bacteria 3826
187 Ga0207675_100058482 3300026118 Unclassified 3597
188 Ga0207683_10012855 3300026121 Bacteria 7144
189 Ga0207683_10076642 3300026121 Archaea 2961
190 Ga0207683_10132855 3300026121 Bacteria 2239
191 Ga0207683_10289426 3300026121 Unclassified 1498
192 Ga0209971_1017501 3300027682 Bacteria 1698
193 Ga0207428_10000024 3300027907 Bacteria 265587
194 Ga0268266_10087165 3300028379 Unclassified 2730
195 Ga0268266_10284871 3300028379 Bacteria 1537
196 Ga0268265_10211353 3300028380 Unclassified 1691
197 Ga0268264_10158822 3300028381 Unclassified 2034
198 Ga0268264_10193692 3300028381 Bacteria 1855
199 Ga0307405_10018076 3300031731 Bacteria 3882
200 Ga0307413_10125428 3300031824 Bacteria 1747
201 Ga0307406_10014982 3300031901 Bacteria 4476
202 Ga0307407_10133907 3300031903 Bacteria 1589
203 Ga0307409_100191570 3300031995 Bacteria 1820
204 Ga0307415_100016881 3300032126 Bacteria 4365
205 Ga0373935_0006207 3300035692 Bacteria 7114
206 Ga0439450_000967 3300042008 Unclassified 4018
207 Ga0450894_006112 3300042131 Unclassified 1557
208 Ga0450906_004414 3300042145 Bacteria 2949
209 Ga0439446_0001935 3300042156 Bacteria 4878
210 Ga0450908_007123 3300042184 Unclassified 2113
211 Ga0439435_0014382 3300042436 Bacteria 1954
212 Ga0451576_0268176 3300045051 Bacteria 1785
213 Ga0495580_0012616 3300046472 Bacteria 6478
214 Ga0495636_0085968 3300047318 Bacteria 1360
215 Ga0496102_0419467 3300048905 Unclassified 1257
216 Ga0496110_0039119 3300048913 Bacteria 4129
217 Ga0496112_0290079 3300048915 Bacteria 1582
218 Ga0501074_0013282 3300049590 Bacteria 5988
219 Ga0501080_0091217 3300049742 Unclassified 2830
220 nmdc:mga0yw44_21199_c1 3300050492 Bacteria 3621
221 nmdc:mga05p37_176945_c1 3300050507 Bacteria 2599
222 nmdc:mga05p37_260689_c1 3300050507 Unclassified 2075
223 nmdc:mga05p37_27632_c1 3300050507 Bacteria 6911
224 nmdc:mga05p37_379023_c1 3300050507 Unclassified 1658
225 nmdc:mga09592_122903_c1 3300050508 Bacteria 2230
226 nmdc:mga09592_38380_c1 3300050508 Unclassified 4020
227 nmdc:mga0qj67_156966_c1 3300050509 Bacteria 1847
228 nmdc:mga0qj67_59671_c1 3300050509 Bacteria 3026
229 nmdc:mga06r32_247517_c1 3300050510 Bacteria 1770
230 nmdc:mga06r32_72905_c1 3300050510 Unclassified 3325
231 nmdc:mga06r32_8558_c1 3300050510 Bacteria 9224
232 nmdc:mga08y16_6_c1 3300050511 Bacteria 622294
233 nmdc:mga0n895_18377_c1 3300050512 Bacteria 6467
234 nmdc:mga0n895_74926_c1 3300050512 Bacteria 3363
235 nmdc:mga0rr50_38913_c1 3300050513 Plasmid 3446
236 nmdc:mga08x19_97620_c1 3300050514 Bacteria 1945
237 nmdc:mga0a205_163985_c1 3300050515 Bacteria 2118
238 nmdc:mga0a205_216247_c1 3300050515 Bacteria 1803
239 Ga0207691_10075867
240 JGI24034J26672_10017049
241 Ga0065712_10015206
242 Ga0065712_10144822
243 Ga0065707_10144432
244 Ga0070683_100108480
245 Ga0070690_100090328
246 Ga0070670_100122352
247 Ga0070677_10017726
248 Ga0070677_10022936
249 Ga0068869_100018454
250 Ga0068869_100045703
251 Ga0068869_100164848
252 Ga0070689_100084199
253 Ga0070687_100065497
254 Ga0070661_100162596
255 Ga0070669_100026056
256 Ga0070669_100049646
257 Ga0070669_100119179
258 Ga0070669_100128896
259 Ga0070675_100001341
260 Ga0070675_100032494
261 Ga0070671_100059091
262 Ga0070674_100001931
263 Ga0070674_100026255
264 Ga0070673_100082643
265 Ga0070688_100004375
266 Ga0070659_100207912
267 Ga0070714_100000044
268 Ga0070714_100010134
269 Ga0070705_100030757
270 Ga0070705_100071864
271 Ga0070700_100090287
272 Ga0070708_100216413
273 Ga0070663_100191781
274 Ga0070678_100076350
275 Ga0070662_100041905
276 Ga0068867_100026683
277 Ga0068867_100078225
278 Ga0070685_10066791
279 Ga0070698_100000279
280 Ga0070679_100033434
281 Ga0070684_100062667
282 Ga0070684_100117919
283 Ga0068853_100230158
284 Ga0070672_100153243
285 Ga0070672_100378426
286 Ga0070686_100028069
287 Ga0070695_100088126
288 Ga0070696_100053848
289 Ga0070696_100293903
290 Ga0070693_100016570
291 Ga0070664_100178259
292 Ga0070664_100205151
293 Ga0068857_100113441
294 Ga0068854_100133556
295 Ga0068856_100227967
296 Ga0068852_100267285
297 Ga0068859_100183204
298 Ga0068859_100228168
299 Ga0068859_100254621
300 Ga0068861_100060931
301 Ga0068861_100118750
302 Ga0068851_10032957
303 Ga0068870_10096113
304 Ga0068863_100054029
305 Ga0068863_100096110
306 Ga0068860_100149388
307 Ga0075365_10031714
308 Ga0075362_10074704
309 Ga0097621_100109331
310 Ga0097621_100143177
311 Ga0097621_100145816
312 Ga0068871_100269529
313 Ga0075428_100000004
314 Ga0075428_100005621
315 Ga0075428_100025193
316 Ga0075428_100032430
317 Ga0075430_100118358
318 Ga0075431_100145852
319 Ga0075431_100435332
320 Ga0075434_100014692
321 Ga0075434_100027814
322 Ga0075429_100035876
323 Ga0075429_100119909
324 Ga0068865_100040941
325 Ga0097620_100183210
326 Ga0097620_100228169
327 Ga0097620_100254632
328 Ga0075435_100108836
329 Ga0075435_100201441
330 Ga0105240_10297967
331 Ga0111539_10000005
332 Ga0111539_10016879
333 Ga0105245_10327920
334 Ga0105247_10056571
335 Ga0114129_10009827
336 Ga0114129_10057201
337 Ga0114129_10067601
338 Ga0114129_10157540
339 Ga0114129_10209046
340 Ga0114129_10574127
341 Ga0105243_10008625
342 Ga0105243_10286527
343 Ga0105242_10010021
344 Ga0105242_10210107
345 Ga0105248_10046911
346 Ga0105238_10049734
347 Ga0105249_10005666
348 Ga0105249_10108731
349 Ga0105239_10114150
350 Ga0105246_10014919
351 Ga0157373_10022808
352 Ga0157374_10048938
353 Ga0157378_10192090
354 Ga0157375_10436733
355 Ga0157375_10439098
356 Ga0163163_10382257
357 Ga0157380_10056619
358 Ga0157377_10117075
359 Ga0157379_10001101
360 Ga0157379_10089210
361 Ga0157379_10189451
362 Ga0157376_10054193
363 Ga0163161_10222774
364 Ga0207697_10001098
365 Ga0207656_10043256
366 Ga0207682_10016141
367 Ga0207688_10108490
368 Ga0207647_10040915
369 Ga0207645_10013848
370 Ga0207645_10131150
371 Ga0207643_10005406
372 Ga0207643_10014965
373 Ga0207643_10034263
374 Ga0207643_10136281
375 Ga0207654_10055841
376 Ga0207671_10058539
377 Ga0207660_10027125
378 Ga0207662_10026784
379 Ga0207657_10090527
380 Ga0207681_10052913
381 Ga0207681_10121361
382 Ga0207681_10159408
383 Ga0207650_10219447
384 Ga0207659_10013297
385 Ga0207659_10065301
386 Ga0207659_10108883
387 Ga0207659_10150775
388 Ga0207687_10211612
389 Ga0207664_10000044
390 Ga0207644_10042819
391 Ga0207644_10066024
392 Ga0207706_10097706
393 Ga0207686_10011165
394 Ga0207669_10001002
395 Ga0207669_10096676
396 Ga0207669_10122270
397 Ga0207669_10138811
398 Ga0207704_10039567
399 Ga0207704_10040667
400 Ga0207665_10039610
401 Ga0207691_10054361
402 Ga0207691_10064415
403 Ga0207711_10119619
404 Ga0207711_10247707
405 Ga0207689_10009994
406 Ga0207689_10182633
407 Ga0207651_10096365
408 Ga0207712_10030281
409 Ga0207712_10088746
410 Ga0207668_10011300
411 Ga0207668_10056721
412 Ga0207640_10095728
413 Ga0207658_10091754
414 Ga0207658_10389499
415 Ga0207677_10018286
416 Ga0207703_10086790
417 Ga0207703_10183956
418 Ga0207639_10108680
419 Ga0207678_10032319
420 Ga0207708_10068822
421 Ga0207648_10001404
422 Ga0207674_10026849
423 Ga0207675_100008737
424 Ga0207675_100051927
425 Ga0207675_100058482
426 Ga0207683_10012855
427 Ga0207683_10076642
428 Ga0207683_10132855
429 Ga0207683_10289426
430 Ga0209971_1017501
431 Ga0207428_10000024
432 Ga0268266_10087165
433 Ga0268266_10284871
434 Ga0268265_10211353
435 Ga0268264_10158822
436 Ga0268264_10193692
437 Ga0307405_10018076
438 Ga0307413_10125428
439 Ga0307406_10014982
440 Ga0307407_10133907
441 Ga0307409_100191570
442 Ga0307415_100016881
443 Ga0373935_0006207
444 Ga0439450_000967
445 Ga0450894_006112
446 Ga0450906_004414
447 Ga0439446_0001935
448 Ga0450908_007123
449 Ga0439435_0014382
450 Ga0451576_0268176
451 Ga0495580_0012616
452 Ga0495636_0085968
453 Ga0496102_0419467
454 Ga0496110_0039119
455 Ga0496112_0290079
456 Ga0501074_0013282
457 Ga0501080_0091217
458 nmdc:mga0yw44_21199_c1
459 nmdc:mga05p37_176945_c1
460 nmdc:mga05p37_260689_c1
461 nmdc:mga05p37_27632_c1
462 nmdc:mga05p37_379023_c1
463 nmdc:mga09592_122903_c1
464 nmdc:mga09592_38380_c1
465 nmdc:mga0qj67_156966_c1
466 nmdc:mga0qj67_59671_c1
467 nmdc:mga06r32_247517_c1
468 nmdc:mga06r32_72905_c1
469 nmdc:mga06r32_8558_c1
470 nmdc:mga08y16_6_c1
471 nmdc:mga0n895_18377_c1
472 nmdc:mga0n895_74926_c1
473 nmdc:mga0rr50_38913_c1
474 nmdc:mga08x19_97620_c1
475 nmdc:mga0a205_163985_c1
476 nmdc:mga0a205_216247_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

289

396

0.91

Map