F350752

General Info

Members Datasets Scaffolds Average Seq Length
238 152 476 304

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100061141|Ga0070699_1000611411
Length 338
Sequence MQRSRIPTPCNPDIVYMTHPLTRIVLISSRHWPLLPLRRIFPLMPNSNWPVLILEEWQDTLATLHMWAQIVGKIRLRQTPLVNHWWNVPLYVSARGLTTSPMPYQDRILEIEFDFIDHKLRIECSDGALATLALRPQSVADFYREVFAALHGLGIDIKIWPMPVEIPNPIRFDQDLTHKSYDAEYANRFWRALVNVDDVFKGFRSRFIGKVSPVHFWWGSFDHAVTRFSGRPAPPREGVDAMNAEAYSHEVISHGFWLGGNGVQPMFYAYAAPEPAGFSESKIKPDAAFYSQEMKEFFLPYDAVRQSPSPETMLMDFLQSSYEAGASLAKWDRKALER

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
103 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
106 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
107 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
111 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
125 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
128 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
129 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
139 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
140 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
152 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 0.84
Rhizosphere 97.48
Stem 0
Stem Tuber 0
Unclassified 4.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100061141 3300005518 Bacteria 3265
2 JGI25406J46586_10039688 3300003203 Bacteria 1675
3 Ga0070676_10190107 3300005328 Bacteria 1340
4 Ga0070670_100061960 3300005331 Bacteria 3211
5 Ga0070670_100255108 3300005331 Bacteria 1528
6 Ga0068869_100124965 3300005334 Bacteria 1972
7 Ga0068869_100147945 3300005334 Bacteria 1819
8 Ga0070666_10008658 3300005335 Bacteria 6327
9 Ga0068868_100111163 3300005338 Bacteria 2227
10 Ga0070671_100004045 3300005355 Bacteria 11563
11 Ga0070673_100013249 3300005364 Bacteria 5694
12 Ga0070673_100013458 3300005364 Bacteria 5659
13 Ga0070667_100130236 3300005367 Bacteria 2195
14 Ga0070709_10012178 3300005434 Bacteria 4810
15 Ga0070711_100105656 3300005439 Bacteria 2057
16 Ga0070694_100056326 3300005444 Bacteria 2670
17 Ga0070694_100082887 3300005444 Bacteria 2234
18 Ga0070708_100051222 3300005445 Bacteria 3658
19 Ga0070708_100154388 3300005445 Bacteria 2136
20 Ga0070708_100197033 3300005445 Bacteria 1885
21 Ga0070708_100205131 3300005445 Unclassified 1847
22 Ga0070678_100012806 3300005456 Bacteria 5231
23 Ga0070681_10022700 3300005458 Bacteria 6304
24 Ga0070706_100017884 3300005467 Bacteria 6540
25 Ga0070706_100056255 3300005467 Bacteria 3631
26 Ga0070707_100007928 3300005468 Bacteria 9862
27 Ga0070698_100163823 3300005471 Bacteria 2166
28 Ga0070698_100182469 3300005471 Bacteria 2037
29 Ga0070698_100268988 3300005471 Bacteria 1636
30 Ga0070699_100014566 3300005518 Bacteria 6764
31 Ga0070699_100093681 3300005518 Bacteria 2628
32 Ga0070699_100115524 3300005518 Bacteria 2358
33 Ga0070697_100070412 3300005536 Bacteria 2867
34 Ga0070697_100117781 3300005536 Bacteria 2219
35 Ga0070695_100244188 3300005545 Bacteria 1304
36 Ga0070665_100004615 3300005548 Bacteria 14402
37 Ga0070704_100312698 3300005549 Bacteria 1313
38 Ga0070704_100575497 3300005549 Bacteria 987
39 Ga0070664_100537393 3300005564 Bacteria 1080
40 Ga0068859_100027669 3300005617 Bacteria 5688
41 Ga0068859_100047498 3300005617 Bacteria 4313
42 Ga0068864_100176323 3300005618 Bacteria 1952
43 Ga0068866_10013131 3300005718 Bacteria 3624
44 Ga0068863_100004952 3300005841 Bacteria 13130
45 Ga0068858_100259996 3300005842 Bacteria 1650
46 Ga0081455_10002558 3300005937 Bacteria 21600
47 Ga0081455_10228583 3300005937 Bacteria 1374
48 Ga0081539_10000069 3300005985 Bacteria 236854
49 Ga0081539_10029771 3300005985 Bacteria 3403
50 Ga0070717_10394369 3300006028 Bacteria 1243
51 Ga0070715_10000005 3300006163 Bacteria 298716
52 Ga0097621_100320775 3300006237 Unclassified 1372
53 Ga0068871_100159743 3300006358 Bacteria 1927
54 Ga0068871_100376844 3300006358 Bacteria 1260
55 Ga0075428_100003101 3300006844 Bacteria 18136
56 Ga0075428_100250137 3300006844 Bacteria 1910
57 Ga0075428_100398221 3300006844 Unclassified 1476
58 Ga0075428_100450842 3300006844 Bacteria 1378
59 Ga0075430_100012679 3300006846 Bacteria 7180
60 Ga0075430_100242029 3300006846 Bacteria 1495
61 Ga0075431_100000401 3300006847 Bacteria 34959
62 Ga0075431_100040043 3300006847 Bacteria 4829
63 Ga0075431_100088940 3300006847 Bacteria 3188
64 Ga0075433_10001951 3300006852 Bacteria 15508
65 Ga0075433_10070912 3300006852 Bacteria 3063
66 Ga0075433_10310479 3300006852 Bacteria 1396
67 Ga0075434_100029345 3300006871 Bacteria 5410
68 Ga0075434_100031101 3300006871 Bacteria 5261
69 Ga0075434_100120078 3300006871 Bacteria 2643
70 Ga0075434_100201254 3300006871 Bacteria 2011
71 Ga0075434_100260390 3300006871 Bacteria 1753
72 Ga0075429_100003985 3300006880 Bacteria 12636
73 Ga0075429_100030778 3300006880 Bacteria 4663
74 Ga0075436_100003330 3300006914 Bacteria 10998
75 Ga0075436_100007090 3300006914 Bacteria 7671
76 Ga0075436_100175509 3300006914 Bacteria 1513
77 Ga0097620_100027669 3300006931 Bacteria 5688
78 Ga0097620_100047498 3300006931 Bacteria 4313
79 Ga0075435_100000282 3300007076 Bacteria 31568
80 Ga0075435_100009591 3300007076 Bacteria 7023
81 Ga0075435_100141655 3300007076 Unclassified 2017
82 Ga0075435_100165541 3300007076 Bacteria 1864
83 Ga0105240_10000001 3300009093 Bacteria 2887840
84 Ga0105240_10108774 3300009093 Bacteria 3358
85 Ga0111539_10033262 3300009094 Bacteria 6261
86 Ga0105245_10794319 3300009098 Bacteria 984
87 Ga0114129_10005073 3300009147 Bacteria 18536
88 Ga0114129_10011186 3300009147 Bacteria 12793
89 Ga0114129_10040873 3300009147 Bacteria 6536
90 Ga0114129_10057139 3300009147 Bacteria 5463
91 Ga0114129_10436872 3300009147 Bacteria 1719
92 Ga0105243_10411924 3300009148 Bacteria 1258
93 Ga0105242_10040320 3300009176 Bacteria 3763
94 Ga0105248_10006270 3300009177 Bacteria 13042
95 Ga0105248_10034375 3300009177 Bacteria 5668
96 Ga0105239_10074887 3300010375 Unclassified 3722
97 Ga0157374_10005093 3300013296 Bacteria 11021
98 Ga0157374_10005895 3300013296 Bacteria 10350
99 Ga0157374_10224442 3300013296 Bacteria 1844
100 Ga0157378_10687810 3300013297 Bacteria 1041
101 Ga0163162_10013958 3300013306 Bacteria 7851
102 Ga0163163_10009498 3300014325 Bacteria 8687
103 Ga0163163_10129025 3300014325 Unclassified 2568
104 Ga0163163_10202748 3300014325 Bacteria 2032
105 Ga0163163_10970427 3300014325 Bacteria 913
106 Ga0157379_10092224 3300014968 Bacteria 2717
107 Ga0157379_10221173 3300014968 Unclassified 1716
108 Ga0157376_10629400 3300014969 Bacteria 1071
109 Ga0224572_1000968 3300024225 Bacteria 3952
110 Ga0207680_10002955 3300025903 Bacteria 7974
111 Ga0207685_10000020 3300025905 Bacteria 138584
112 Ga0207645_10189120 3300025907 Bacteria 1352
113 Ga0207684_10098632 3300025910 Bacteria 2495
114 Ga0207684_10137064 3300025910 Bacteria 2102
115 Ga0207707_10143426 3300025912 Bacteria 2088
116 Ga0207652_10002356 3300025921 Bacteria 15979
117 Ga0207646_10006193 3300025922 Bacteria 12432
118 Ga0207646_10095538 3300025922 Bacteria 2663
119 Ga0207646_10355002 3300025922 Bacteria 1325
120 Ga0207650_10464320 3300025925 Bacteria 1055
121 Ga0207644_10001941 3300025931 Bacteria 13420
122 Ga0207704_10291918 3300025938 Bacteria 1245
123 Ga0207704_10295860 3300025938 Bacteria 1238
124 Ga0207711_10059354 3300025941 Bacteria 3294
125 Ga0207711_10280731 3300025941 Bacteria 1534
126 Ga0207651_10004272 3300025960 Bacteria 7169
127 Ga0207668_10088328 3300025972 Bacteria 2270
128 Ga0207640_10059569 3300025981 Bacteria 2520
129 Ga0207658_10080948 3300025986 Bacteria 2489
130 Ga0207677_10052999 3300026023 Bacteria 2759
131 Ga0207641_10005740 3300026088 Bacteria 10544
132 Ga0207674_10022267 3300026116 Bacteria 6807
133 Ga0207675_100003953 3300026118 Bacteria 14387
134 Ga0207683_10002543 3300026121 Bacteria 15918
135 Ga0207683_10376877 3300026121 Bacteria 1304
136 Ga0209995_1002621 3300027471 Bacteria 2847
137 Ga0207428_10002998 3300027907 Bacteria 16680
138 Ga0268266_10221485 3300028379 Unclassified 1739
139 Ga0265332_10003336 3300031238 Bacteria 7785
140 Ga0265340_10000694 3300031247 Bacteria 18937
141 Ga0265339_10004401 3300031249 Bacteria 9610
142 Ga0307408_100104538 3300031548 Bacteria 2164
143 Ga0265342_10000178 3300031712 Bacteria 70648
144 Ga0307406_10039200 3300031901 Bacteria 2938
145 Ga0373937_0100682 3300036401 Bacteria 2681
146 Ga0373937_0173687 3300036401 Bacteria 2022
147 Ga0395900_0285804 3300037418 Bacteria 1640
148 Ga0395898_0273317 3300037466 Bacteria 1612
149 Ga0395905_0542138 3300037471 Bacteria 1064
150 Ga0436364_0331938 3300037853 Bacteria 90610
151 Ga0395901_0165927 3300038443 Bacteria 2319
152 Ga0436365_0224732 3300039437 Bacteria 4603
153 Ga0436363_0460296 3300039450 Bacteria 5376
154 Ga0451577_0269605 3300042876 Bacteria 1542
155 Ga0495629_0000809 3300046459 Bacteria 25310
156 Ga0495629_0021193 3300046459 Bacteria 4639
157 Ga0495651_0115786 3300046462 Bacteria 1976
158 Ga0495653_0127547 3300046463 Bacteria 1805
159 Ga0495580_0042314 3300046472 Bacteria 3246
160 Ga0495580_0157840 3300046472 Bacteria 1570
161 Ga0495582_0001689 3300046473 Bacteria 12456
162 Ga0495582_0038082 3300046473 Bacteria 2645
163 Ga0495639_0025454 3300046475 Bacteria 2610
164 Ga0495662_0005130 3300046476 Bacteria 6561
165 Ga0495664_0006161 3300046477 Bacteria 6620
166 Ga0495594_0001103 3300046499 Bacteria 14074
167 Ga0495594_0001935 3300046499 Bacteria 10808
168 Ga0495596_0029539 3300046500 Bacteria 2197
169 Ga0495628_0023165 3300046516 Bacteria 5099
170 Ga0495630_0317069 3300046517 Bacteria 1192
171 Ga0495644_0000634 3300046523 Bacteria 14670
172 Ga0495642_0014980 3300046528 Bacteria 3009
173 Ga0495652_0012687 3300046529 Bacteria 7591
174 Ga0495665_0000762 3300046531 Bacteria 16745
175 Ga0495640_0074564 3300046533 Bacteria 2268
176 Ga0495586_0001143 3300046535 Bacteria 14883
177 Ga0495645_0005854 3300046543 Bacteria 8487
178 Ga0495667_0355863 3300046559 Bacteria 925
179 Ga0495668_0078783 3300046616 Bacteria 1809
180 Ga0495668_0084633 3300046616 Bacteria 1739
181 Ga0495634_0012504 3300046642 Bacteria 6141
182 Ga0495625_0023035 3300046660 Bacteria 4763
183 Ga0495635_0022110 3300046663 Bacteria 4431
184 Ga0495635_0170169 3300046663 Bacteria 1482
185 Ga0495588_0050422 3300046674 Bacteria 2142
186 Ga0495588_0109716 3300046674 Bacteria 1453
187 Ga0495599_0016602 3300046678 Bacteria 4571
188 Ga0495599_0257824 3300046678 Unclassified 1060
189 Ga0495646_0157603 3300046680 Bacteria 1259
190 Ga0495647_0057058 3300046681 Bacteria 1532
191 Ga0495658_0045779 3300046683 Bacteria 2457
192 Ga0495669_0015606 3300046684 Bacteria 3253
193 Ga0495613_0007443 3300046689 Bacteria 8159
194 Ga0495613_0009411 3300046689 Bacteria 7246
195 Ga0495624_0002140 3300046690 Bacteria 15050
196 Ga0495600_0009056 3300046809 Bacteria 6137
197 Ga0495600_0201719 3300046809 Bacteria 1277
198 Ga0495600_0228900 3300046809 Bacteria 1187
199 Ga0495581_0002383 3300047315 Bacteria 10612
200 Ga0495581_0302425 3300047315 Unclassified 935
201 Ga0495604_0017066 3300047317 Bacteria 5807
202 Ga0495604_0244037 3300047317 Bacteria 1227
203 Ga0495636_0038033 3300047318 Bacteria 1989
204 Ga0495636_0147648 3300047318 Bacteria 1053
205 Ga0495674_0004076 3300047319 Bacteria 14129
206 Ga0495674_0076528 3300047319 Bacteria 2878
207 Ga0495676_0002596 3300047321 Bacteria 16115
208 Ga0495676_0181055 3300047321 Bacteria 1477
209 Ga0495680_0006884 3300047322 Bacteria 10494
210 Ga0495675_0007301 3300047444 Bacteria 6809
211 Ga0495677_0024967 3300047445 Bacteria 2168
212 Ga0495593_0026117 3300047673 Bacteria 3228
213 Ga0495614_0001905 3300048089 Bacteria 9153
214 Ga0495614_0086436 3300048089 Bacteria 1361
215 Ga0496102_0063210 3300048905 Bacteria 3389
216 Ga0496112_0045409 3300048915 Bacteria 4307
217 nmdc:mga05p37_20149_c1 3300050507 Bacteria 8071
218 nmdc:mga05p37_248463_c1 3300050507 Bacteria 2135
219 nmdc:mga05p37_2_c1 3300050507 Bacteria 173421
220 nmdc:mga05p37_87418_c1 3300050507 Bacteria 3841
221 nmdc:mga05p37_95723_c1 3300050507 Bacteria 3658
222 nmdc:mga09592_1984_c1 3300050508 Bacteria 16502
223 nmdc:mga09592_95819_c1 3300050508 Bacteria 2539
224 nmdc:mga0qj67_6565_c1 3300050509 Bacteria 8544
225 nmdc:mga06r32_4786_c1 3300050510 Bacteria 12179
226 nmdc:mga06r32_5560_c1 3300050510 Bacteria 11354
227 nmdc:mga0n895_83200_c1 3300050512 Bacteria 3192
228 nmdc:mga0n895_87053_c1 3300050512 Bacteria 3121
229 nmdc:mga0rr50_225693_c1 3300050513 Bacteria 1548
230 nmdc:mga0rr50_43694_c1 3300050513 Bacteria 3282
231 nmdc:mga0rr50_8480_c1 3300050513 Bacteria 6402
232 nmdc:mga08x19_2792_c1 3300050514 Bacteria 10542
233 nmdc:mga08x19_3994_c1 3300050514 Bacteria 8778
234 nmdc:mga0a205_1020_c1 3300050515 Bacteria 23290
235 nmdc:mga0a205_375509_c1 3300050515 Unclassified 1287
236 Ga0495601_0018184 3300053077 Bacteria 4275
237 Ga0495601_0250294 3300053077 Bacteria 1157
238 Ga0500616_0002615 3300053153 Bacteria 14700
239 Ga0070699_100061141
240 JGI25406J46586_10039688
241 Ga0070676_10190107
242 Ga0070670_100061960
243 Ga0070670_100255108
244 Ga0068869_100124965
245 Ga0068869_100147945
246 Ga0070666_10008658
247 Ga0068868_100111163
248 Ga0070671_100004045
249 Ga0070673_100013249
250 Ga0070673_100013458
251 Ga0070667_100130236
252 Ga0070709_10012178
253 Ga0070711_100105656
254 Ga0070694_100056326
255 Ga0070694_100082887
256 Ga0070708_100051222
257 Ga0070708_100154388
258 Ga0070708_100197033
259 Ga0070708_100205131
260 Ga0070678_100012806
261 Ga0070681_10022700
262 Ga0070706_100017884
263 Ga0070706_100056255
264 Ga0070707_100007928
265 Ga0070698_100163823
266 Ga0070698_100182469
267 Ga0070698_100268988
268 Ga0070699_100014566
269 Ga0070699_100093681
270 Ga0070699_100115524
271 Ga0070697_100070412
272 Ga0070697_100117781
273 Ga0070695_100244188
274 Ga0070665_100004615
275 Ga0070704_100312698
276 Ga0070704_100575497
277 Ga0070664_100537393
278 Ga0068859_100027669
279 Ga0068859_100047498
280 Ga0068864_100176323
281 Ga0068866_10013131
282 Ga0068863_100004952
283 Ga0068858_100259996
284 Ga0081455_10002558
285 Ga0081455_10228583
286 Ga0081539_10000069
287 Ga0081539_10029771
288 Ga0070717_10394369
289 Ga0070715_10000005
290 Ga0097621_100320775
291 Ga0068871_100159743
292 Ga0068871_100376844
293 Ga0075428_100003101
294 Ga0075428_100250137
295 Ga0075428_100398221
296 Ga0075428_100450842
297 Ga0075430_100012679
298 Ga0075430_100242029
299 Ga0075431_100000401
300 Ga0075431_100040043
301 Ga0075431_100088940
302 Ga0075433_10001951
303 Ga0075433_10070912
304 Ga0075433_10310479
305 Ga0075434_100029345
306 Ga0075434_100031101
307 Ga0075434_100120078
308 Ga0075434_100201254
309 Ga0075434_100260390
310 Ga0075429_100003985
311 Ga0075429_100030778
312 Ga0075436_100003330
313 Ga0075436_100007090
314 Ga0075436_100175509
315 Ga0097620_100027669
316 Ga0097620_100047498
317 Ga0075435_100000282
318 Ga0075435_100009591
319 Ga0075435_100141655
320 Ga0075435_100165541
321 Ga0105240_10000001
322 Ga0105240_10108774
323 Ga0111539_10033262
324 Ga0105245_10794319
325 Ga0114129_10005073
326 Ga0114129_10011186
327 Ga0114129_10040873
328 Ga0114129_10057139
329 Ga0114129_10436872
330 Ga0105243_10411924
331 Ga0105242_10040320
332 Ga0105248_10006270
333 Ga0105248_10034375
334 Ga0105239_10074887
335 Ga0157374_10005093
336 Ga0157374_10005895
337 Ga0157374_10224442
338 Ga0157378_10687810
339 Ga0163162_10013958
340 Ga0163163_10009498
341 Ga0163163_10129025
342 Ga0163163_10202748
343 Ga0163163_10970427
344 Ga0157379_10092224
345 Ga0157379_10221173
346 Ga0157376_10629400
347 Ga0224572_1000968
348 Ga0207680_10002955
349 Ga0207685_10000020
350 Ga0207645_10189120
351 Ga0207684_10098632
352 Ga0207684_10137064
353 Ga0207707_10143426
354 Ga0207652_10002356
355 Ga0207646_10006193
356 Ga0207646_10095538
357 Ga0207646_10355002
358 Ga0207650_10464320
359 Ga0207644_10001941
360 Ga0207704_10291918
361 Ga0207704_10295860
362 Ga0207711_10059354
363 Ga0207711_10280731
364 Ga0207651_10004272
365 Ga0207668_10088328
366 Ga0207640_10059569
367 Ga0207658_10080948
368 Ga0207677_10052999
369 Ga0207641_10005740
370 Ga0207674_10022267
371 Ga0207675_100003953
372 Ga0207683_10002543
373 Ga0207683_10376877
374 Ga0209995_1002621
375 Ga0207428_10002998
376 Ga0268266_10221485
377 Ga0265332_10003336
378 Ga0265340_10000694
379 Ga0265339_10004401
380 Ga0307408_100104538
381 Ga0265342_10000178
382 Ga0307406_10039200
383 Ga0373937_0100682
384 Ga0373937_0173687
385 Ga0395900_0285804
386 Ga0395898_0273317
387 Ga0395905_0542138
388 Ga0436364_0331938
389 Ga0395901_0165927
390 Ga0436365_0224732
391 Ga0436363_0460296
392 Ga0451577_0269605
393 Ga0495629_0000809
394 Ga0495629_0021193
395 Ga0495651_0115786
396 Ga0495653_0127547
397 Ga0495580_0042314
398 Ga0495580_0157840
399 Ga0495582_0001689
400 Ga0495582_0038082
401 Ga0495639_0025454
402 Ga0495662_0005130
403 Ga0495664_0006161
404 Ga0495594_0001103
405 Ga0495594_0001935
406 Ga0495596_0029539
407 Ga0495628_0023165
408 Ga0495630_0317069
409 Ga0495644_0000634
410 Ga0495642_0014980
411 Ga0495652_0012687
412 Ga0495665_0000762
413 Ga0495640_0074564
414 Ga0495586_0001143
415 Ga0495645_0005854
416 Ga0495667_0355863
417 Ga0495668_0078783
418 Ga0495668_0084633
419 Ga0495634_0012504
420 Ga0495625_0023035
421 Ga0495635_0022110
422 Ga0495635_0170169
423 Ga0495588_0050422
424 Ga0495588_0109716
425 Ga0495599_0016602
426 Ga0495599_0257824
427 Ga0495646_0157603
428 Ga0495647_0057058
429 Ga0495658_0045779
430 Ga0495669_0015606
431 Ga0495613_0007443
432 Ga0495613_0009411
433 Ga0495624_0002140
434 Ga0495600_0009056
435 Ga0495600_0201719
436 Ga0495600_0228900
437 Ga0495581_0002383
438 Ga0495581_0302425
439 Ga0495604_0017066
440 Ga0495604_0244037
441 Ga0495636_0038033
442 Ga0495636_0147648
443 Ga0495674_0004076
444 Ga0495674_0076528
445 Ga0495676_0002596
446 Ga0495676_0181055
447 Ga0495680_0006884
448 Ga0495675_0007301
449 Ga0495677_0024967
450 Ga0495593_0026117
451 Ga0495614_0001905
452 Ga0495614_0086436
453 Ga0496102_0063210
454 Ga0496112_0045409
455 nmdc:mga05p37_20149_c1
456 nmdc:mga05p37_248463_c1
457 nmdc:mga05p37_2_c1
458 nmdc:mga05p37_87418_c1
459 nmdc:mga05p37_95723_c1
460 nmdc:mga09592_1984_c1
461 nmdc:mga09592_95819_c1
462 nmdc:mga0qj67_6565_c1
463 nmdc:mga06r32_4786_c1
464 nmdc:mga06r32_5560_c1
465 nmdc:mga0n895_83200_c1
466 nmdc:mga0n895_87053_c1
467 nmdc:mga0rr50_225693_c1
468 nmdc:mga0rr50_43694_c1
469 nmdc:mga0rr50_8480_c1
470 nmdc:mga08x19_2792_c1
471 nmdc:mga08x19_3994_c1
472 nmdc:mga0a205_1020_c1
473 nmdc:mga0a205_375509_c1
474 Ga0495601_0018184
475 Ga0495601_0250294
476 Ga0500616_0002615

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19459

DUF5996

Family of unknown function (DUF5996)

49

338

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z1p-assembly1.cif.gz_AJ structure of the mitochondrial ribosome from tetrahymena thermophila 0.7834 79 109
2ymz-assembly2.cif.gz_C crystal structure of chicken galectin 2 0.768 67 93
3fif-assembly6.cif.gz_F crystal structure of the ygdr protein from e.coli. northeast structural genomics target er382a. 0.6793 71 93
1wlc-assembly1.cif.gz_A-2 congerin ii y16s/t88i double mutant 0.6558 67 93
1gan-assembly1.cif.gz_B complex of toad ovary galectin with n-acetylgalactose 0.6538 62 95
ID Description Score Start End Superfamily
af_D3ZS58_1_97_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7849 79 113 3.40.30.10
af_I1KX48_23_256_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.7821 62 92 2.60.120.200
af_Q9VV99_449_608_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7621 60 98 2.130.10.10
af_Q9W2H2_383_537_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.7399 52 94 2.60.120.200
af_A0A0P0WS15_683_864_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.701 71 94 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A2V5KNI0-F1-model_v4 Uncharacterized protein 0.992 226 296
AF-A0A7V9GKF5-F1-model_v4 Uncharacterized protein 0.9913 208 295
AF-A0A535P5J5-F1-model_v4 Ava_C0101 and related proteins 0.9897 27 299
AF-A0A2T4VRC4-F1-model_v4 Ava_C0101 and related proteins 0.9857 8 300
AF-B9XK59-F1-model_v4 Ava_C0101 and related proteins 0.9844 8 305

Map