F350436

General Info

Members Datasets Scaffolds Average Seq Length
237 96 474 94

Family's Representative Sequence

Representative Sequence 3300053083|Ga0495655_0216031|Ga0495655_0216031_254_559
Length 101
Sequence MERWTVRLPPGVSPPYEVYVNGVRQQEGADFERRGNVLLFAKPLVKAGKLGFWKWAMGAFGVGTYDKDDQVDVRYEAGGRPYVAQGLDIEPPGDAGAAASR

Samples

Sample ID Description Type Environment
1 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
2 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
8 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
9 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
10 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
11 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
12 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
13 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
14 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
15 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
16 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
26 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
27 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
28 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
29 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
30 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
31 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
32 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
33 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
34 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
35 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
36 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
37 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
38 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
39 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
40 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
41 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
42 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
43 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
44 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
45 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
46 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
47 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
48 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
49 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
50 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
51 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
52 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
53 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
54 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
55 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
56 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
57 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
58 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
59 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
60 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
61 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
62 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
63 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
64 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
65 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
66 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
67 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
68 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
69 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
70 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
71 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
72 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
73 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
74 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
75 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
76 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
77 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
78 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
79 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
80 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
81 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
82 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
83 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
84 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
85 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
86 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
87 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
88 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
89 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
90 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
91 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
92 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
93 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
94 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
95 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
96 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.02
Rhizosphere 69.2
Stem 0
Stem Tuber 0
Unclassified 16.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495655_0216031 3300053083 Bacteria 633
2 Ga0070709_10152459 3300005434 Unclassified 1598
3 Ga0070709_10768678 3300005434 Bacteria 754
4 Ga0070714_100221598 3300005435 Bacteria 1738
5 Ga0070714_101297997 3300005435 Bacteria 710
6 Ga0070714_101627373 3300005435 Bacteria 631
7 Ga0070714_102070196 3300005435 Bacteria 555
8 Ga0070713_100068650 3300005436 Bacteria 2987
9 Ga0070713_100100551 3300005436 Bacteria 2503
10 Ga0070713_100200554 3300005436 Unclassified 1802
11 Ga0070710_10015301 3300005437 Bacteria 3880
12 Ga0070710_10177614 3300005437 Bacteria 1331
13 Ga0070710_10609297 3300005437 Bacteria 761
14 Ga0070711_100093914 3300005439 Bacteria 2167
15 Ga0070711_100424465 3300005439 Bacteria 1084
16 Ga0070711_101858176 3300005439 Unclassified 529
17 Ga0070717_10306858 3300006028 Bacteria 1412
18 Ga0070717_10554776 3300006028 Unclassified 1040
19 Ga0070717_10852345 3300006028 Unclassified 829
20 Ga0070712_100033909 3300006175 Bacteria 3457
21 Ga0070712_100294374 3300006175 Bacteria 1312
22 Ga0070712_100404595 3300006175 Bacteria 1128
23 Ga0075434_101369349 3300006871 Bacteria 718
24 Ga0105240_12071634 3300009093 Bacteria 591
25 Ga0206355_1448743 3300020076 Bacteria 515
26 Ga0213873_10005584 3300021358 Bacteria 2424
27 Ga0213873_10027110 3300021358 Bacteria 1395
28 Ga0213873_10059589 3300021358 Bacteria 1030
29 Ga0213874_10014520 3300021377 Bacteria 2061
30 Ga0213874_10032261 3300021377 Bacteria 1520
31 Ga0213874_10045401 3300021377 Bacteria 1330
32 Ga0213874_10246300 3300021377 Unclassified 657
33 Ga0213876_10001949 3300021384 Bacteria 12358
34 Ga0213876_10006114 3300021384 Bacteria 6578
35 Ga0213876_10022192 3300021384 Bacteria 3357
36 Ga0213876_10029322 3300021384 Bacteria 2899
37 Ga0213876_10149209 3300021384 Bacteria 1243
38 Ga0213876_10175055 3300021384 Unclassified 1142
39 Ga0213876_10391742 3300021384 Bacteria 739
40 Ga0213876_10564886 3300021384 Unclassified 605
41 Ga0213875_10011280 3300021388 Bacteria 4451
42 Ga0213875_10027797 3300021388 Bacteria 2691
43 Ga0213875_10089293 3300021388 Unclassified 1437
44 Ga0213875_10094296 3300021388 Bacteria 1396
45 Ga0213875_10125707 3300021388 Bacteria 1198
46 Ga0213875_10200601 3300021388 Bacteria 938
47 Ga0207692_10012447 3300025898 Bacteria 3654
48 Ga0207692_10070978 3300025898 Bacteria 1835
49 Ga0207692_10552790 3300025898 Bacteria 736
50 Ga0207685_10165553 3300025905 Bacteria 1013
51 Ga0207699_11022413 3300025906 Bacteria 611
52 Ga0207693_10027079 3300025915 Bacteria 4534
53 Ga0207693_10281617 3300025915 Bacteria 1303
54 Ga0207693_10391747 3300025915 Bacteria 1086
55 Ga0207693_10584595 3300025915 Bacteria 870
56 Ga0207663_10012811 3300025916 Bacteria 4542
57 Ga0207663_10883662 3300025916 Bacteria 714
58 Ga0207663_11509847 3300025916 Unclassified 541
59 Ga0207700_10158832 3300025928 Unclassified 1876
60 Ga0207700_10331372 3300025928 Bacteria 1321
61 Ga0207700_11081925 3300025928 Bacteria 717
62 Ga0207664_10171090 3300025929 Bacteria 1859
63 Ga0207664_10295961 3300025929 Bacteria 1423
64 Ga0207664_10340768 3300025929 Bacteria 1325
65 Ga0207664_11100338 3300025929 Bacteria 710
66 Ga0207704_10731010 3300025938 Unclassified 822
67 Ga0207665_10154252 3300025939 Unclassified 1647
68 Ga0207665_11579576 3300025939 Bacteria 520
69 Ga0373923_0072778 3300035111 Bacteria 1479
70 Ga0373936_0307200 3300035113 Bacteria 717
71 Ga0373953_0128492 3300035117 Bacteria 1079
72 Ga0373954_0359507 3300035118 Bacteria 719
73 Ga0373957_0500936 3300035120 Bacteria 529
74 Ga0373943_0323123 3300035170 Bacteria 880
75 Ga0373955_0312231 3300035172 Bacteria 949
76 Ga0373927_0544334 3300035695 Bacteria 767
77 Ga0373933_0028617 3300035724 Bacteria 3217
78 Ga0373937_0004983 3300036401 Bacteria 11294
79 Ga0373937_1278929 3300036401 Bacteria 682
80 Ga0436364_0011569 3300037853 Bacteria 10709
81 Ga0436364_0339916 3300037853 Bacteria 5980
82 Ga0436364_0412200 3300037853 Bacteria 5749
83 Ga0436364_0601049 3300037853 Bacteria 2118
84 Ga0436364_0628514 3300037853 Bacteria 2261
85 Ga0436364_0860271 3300037853 Bacteria 3327
86 Ga0436364_0909761 3300037853 Bacteria 1076
87 Ga0436364_0975411 3300037853 Bacteria 1788
88 Ga0436364_1314948 3300037853 Bacteria 3301
89 Ga0436364_1433743 3300037853 Bacteria 6306
90 Ga0436365_0054776 3300039437 Bacteria 1484
91 Ga0436365_0201958 3300039437 Bacteria 19219
92 Ga0436365_0362522 3300039437 Bacteria 4805
93 Ga0436365_0679055 3300039437 Bacteria 7776
94 Ga0436365_0808580 3300039437 Bacteria 3224
95 Ga0436365_0856735 3300039437 Bacteria 10107
96 Ga0436365_1151195 3300039437 Bacteria 1515
97 Ga0436365_1292628 3300039437 Bacteria 10027
98 Ga0436365_1463153 3300039437 Bacteria 1152
99 Ga0436365_1503957 3300039437 Bacteria 8815
100 Ga0436365_1551097 3300039437 Bacteria 1111
101 Ga0436365_1589544 3300039437 Unclassified 603
102 Ga0436365_1698845 3300039437 Bacteria 1651
103 Ga0436365_1788792 3300039437 Bacteria 593
104 Ga0436361_0605888 3300039447 Bacteria 1340
105 Ga0436363_0023614 3300039450 Unclassified 1024
106 Ga0436363_0054936 3300039450 Unclassified 1238
107 Ga0436363_0081952 3300039450 Unclassified 743
108 Ga0436363_0168977 3300039450 Bacteria 1823
109 Ga0436363_0212164 3300039450 Bacteria 706
110 Ga0436363_0656631 3300039450 Bacteria 1797
111 Ga0436363_0744148 3300039450 Bacteria 5963
112 Ga0436363_0775889 3300039450 Bacteria 4809
113 Ga0436363_0855292 3300039450 Bacteria 8292
114 Ga0436363_1366250 3300039450 Bacteria 4462
115 Ga0436363_1570953 3300039450 Bacteria 665
116 Ga0436363_1656359 3300039450 Bacteria 1026
117 Ga0436362_0010475 3300039453 Bacteria 3085
118 Ga0436362_0133150 3300039453 Unclassified 1084
119 Ga0436362_0160550 3300039453 Unclassified 503
120 Ga0436362_0260857 3300039453 Bacteria 2698
121 Ga0436362_0645393 3300039453 Bacteria 1499
122 Ga0436362_0786444 3300039453 Bacteria 2225
123 Ga0466969_0095742 3300044656 Bacteria 1402
124 Ga0466969_0578479 3300044656 Unclassified 515
125 Ga0466965_0043236 3300044683 Bacteria 2224
126 Ga0466965_0456283 3300044683 Bacteria 712
127 Ga0466965_0498807 3300044683 Bacteria 682
128 Ga0466965_0570213 3300044683 Bacteria 641
129 Ga0466966_0247895 3300044684 Unclassified 1073
130 Ga0466966_0275080 3300044684 Bacteria 1013
131 Ga0466966_0651615 3300044684 Bacteria 634
132 Ga0466961_0003860 3300044693 Bacteria 9364
133 Ga0466961_0158996 3300044693 Bacteria 1408
134 Ga0466961_0557112 3300044693 Bacteria 690
135 Ga0466963_0001055 3300044694 Bacteria 14342
136 Ga0466963_0055482 3300044694 Bacteria 2635
137 Ga0466963_0066682 3300044694 Bacteria 2415
138 Ga0466963_0112388 3300044694 Bacteria 1870
139 Ga0466963_0432750 3300044694 Bacteria 928
140 Ga0466963_0820915 3300044694 Bacteria 656
141 Ga0466963_1141641 3300044694 Unclassified 548
142 Ga0466964_0095753 3300044706 Unclassified 1300
143 Ga0466964_0166370 3300044706 Bacteria 1035
144 Ga0466964_0202198 3300044706 Unclassified 954
145 Ga0466964_0353555 3300044706 Unclassified 756
146 Ga0466964_0880414 3300044706 Unclassified 511
147 Ga0466968_0094098 3300044735 Bacteria 1332
148 Ga0466968_0121428 3300044735 Unclassified 1182
149 Ga0466968_0192989 3300044735 Bacteria 951
150 Ga0466968_0471501 3300044735 Unclassified 623
151 Ga0466968_0481325 3300044735 Bacteria 617
152 Ga0466970_0060353 3300044765 Bacteria 2031
153 Ga0466970_0085272 3300044765 Unclassified 1711
154 Ga0466970_0644416 3300044765 Bacteria 616
155 Ga0466957_0000131 3300044842 Bacteria 31453
156 Ga0466957_0092442 3300044842 Bacteria 1897
157 Ga0466957_0162978 3300044842 Bacteria 1449
158 Ga0466959_0008777 3300045049 Bacteria 7160
159 Ga0466959_0036808 3300045049 Bacteria 3615
160 Ga0466959_0069205 3300045049 Bacteria 2558
161 Ga0466959_0230352 3300045049 Unclassified 1282
162 Ga0466959_0325055 3300045049 Bacteria 1051
163 Ga0466959_0369192 3300045049 Unclassified 977
164 Ga0466959_0397077 3300045049 Bacteria 938
165 Ga0466958_0004499 3300045836 Bacteria 7364
166 Ga0466958_0005333 3300045836 Bacteria 6905
167 Ga0466958_0023133 3300045836 Bacteria 3644
168 Ga0466958_0064825 3300045836 Bacteria 2229
169 Ga0466958_0392527 3300045836 Unclassified 895
170 Ga0466958_0721165 3300045836 Unclassified 650
171 Ga0466967_0011515 3300045976 Bacteria 6705
172 Ga0466967_0090855 3300045976 Bacteria 2774
173 Ga0466967_0094349 3300045976 Bacteria 2725
174 Ga0466967_0229284 3300045976 Bacteria 1768
175 Ga0466967_0258038 3300045976 Bacteria 1667
176 Ga0466967_0310072 3300045976 Bacteria 1520
177 Ga0466967_0326022 3300045976 Bacteria 1482
178 Ga0466967_0545691 3300045976 Bacteria 1141
179 Ga0466967_1444522 3300045976 Bacteria 685
180 Ga0495592_0087078 3300046454 Bacteria 2248
181 Ga0495629_0348167 3300046459 Bacteria 1011
182 Ga0495651_0007539 3300046462 Bacteria 8324
183 Ga0495653_0021231 3300046463 Bacteria 5261
184 Ga0495664_0474019 3300046477 Bacteria 748
185 Ga0495608_0082452 3300046511 Bacteria 2088
186 Ga0495618_0026613 3300046514 Bacteria 3598
187 Ga0495628_0080146 3300046516 Bacteria 2538
188 Ga0495630_0066911 3300046517 Bacteria 2701
189 Ga0495652_0031757 3300046529 Bacteria 4622
190 Ga0495665_0207384 3300046531 Bacteria 1015
191 Ga0495640_0205062 3300046533 Bacteria 1248
192 Ga0495587_0275311 3300046536 Bacteria 944
193 Ga0495645_0357578 3300046543 Bacteria 939
194 Ga0495667_0001932 3300046559 Bacteria 13697
195 Ga0495667_0474990 3300046559 Bacteria 784
196 Ga0495634_0735729 3300046642 Unclassified 565
197 Ga0495635_0024450 3300046663 Bacteria 4210
198 Ga0495657_0004348 3300046675 Bacteria 11311
199 Ga0495623_0257653 3300046679 Bacteria 978
200 Ga0495646_0185499 3300046680 Bacteria 1139
201 Ga0495613_0217873 3300046689 Bacteria 1341
202 Ga0495600_0011831 3300046809 Bacteria 5449
203 Ga0495604_0002901 3300047317 Bacteria 13743
204 Ga0495604_0276176 3300047317 Bacteria 1137
205 Ga0495674_0044665 3300047319 Bacteria 3938
206 Ga0495676_1010807 3300047321 Bacteria 530
207 Ga0495680_0049792 3300047322 Bacteria 3279
208 Ga0495684_0423617 3300047471 Bacteria 930
209 Ga0495593_0039075 3300047673 Bacteria 2561
210 Ga0495593_0403958 3300047673 Unclassified 683
211 Ga0495602_0058729 3300048088 Bacteria 3365
212 Ga0495602_0737459 3300048088 Unclassified 666
213 Ga0496102_0269675 3300048905 Bacteria 1605
214 Ga0496104_0019691 3300048907 Bacteria 6179
215 Ga0496104_0594100 3300048907 Bacteria 1017
216 Ga0496105_0136223 3300048908 Bacteria 2023
217 Ga0496105_0522941 3300048908 Bacteria 929
218 Ga0496105_1392698 3300048908 Unclassified 508
219 Ga0496106_0572355 3300048909 Bacteria 906
220 Ga0496107_1112808 3300048910 Bacteria 570
221 Ga0496108_0798550 3300048911 Bacteria 814
222 Ga0496108_1227771 3300048911 Bacteria 633
223 Ga0496109_0421344 3300048912 Bacteria 1261
224 Ga0496111_0367647 3300048914 Bacteria 1064
225 Ga0496112_0094999 3300048915 Bacteria 2952
226 Ga0496113_0037020 3300048916 Bacteria 3578
227 Ga0496114_0251589 3300048917 Bacteria 1555
228 Ga0496114_1069707 3300048917 Unclassified 691
229 Ga0496114_1792616 3300048917 Bacteria 502
230 Ga0496115_0647457 3300048918 Bacteria 836
231 Ga0496115_1207575 3300048918 Unclassified 568
232 nmdc:mga0rr50_1591626_c1 3300050513 Bacteria 551
233 Ga0495595_0010894 3300053084 Bacteria 3792
234 Ga0495619_0095983 3300053085 Bacteria 2012
235 Ga0466962_0007112 3300061719 Bacteria 5361
236 Ga0466962_0084399 3300061719 Bacteria 1519
237 Ga0466962_0108306 3300061719 Bacteria 1337
238 Ga0495655_0216031
239 Ga0070709_10152459
240 Ga0070709_10768678
241 Ga0070714_100221598
242 Ga0070714_101297997
243 Ga0070714_101627373
244 Ga0070714_102070196
245 Ga0070713_100068650
246 Ga0070713_100100551
247 Ga0070713_100200554
248 Ga0070710_10015301
249 Ga0070710_10177614
250 Ga0070710_10609297
251 Ga0070711_100093914
252 Ga0070711_100424465
253 Ga0070711_101858176
254 Ga0070717_10306858
255 Ga0070717_10554776
256 Ga0070717_10852345
257 Ga0070712_100033909
258 Ga0070712_100294374
259 Ga0070712_100404595
260 Ga0075434_101369349
261 Ga0105240_12071634
262 Ga0206355_1448743
263 Ga0213873_10005584
264 Ga0213873_10027110
265 Ga0213873_10059589
266 Ga0213874_10014520
267 Ga0213874_10032261
268 Ga0213874_10045401
269 Ga0213874_10246300
270 Ga0213876_10001949
271 Ga0213876_10006114
272 Ga0213876_10022192
273 Ga0213876_10029322
274 Ga0213876_10149209
275 Ga0213876_10175055
276 Ga0213876_10391742
277 Ga0213876_10564886
278 Ga0213875_10011280
279 Ga0213875_10027797
280 Ga0213875_10089293
281 Ga0213875_10094296
282 Ga0213875_10125707
283 Ga0213875_10200601
284 Ga0207692_10012447
285 Ga0207692_10070978
286 Ga0207692_10552790
287 Ga0207685_10165553
288 Ga0207699_11022413
289 Ga0207693_10027079
290 Ga0207693_10281617
291 Ga0207693_10391747
292 Ga0207693_10584595
293 Ga0207663_10012811
294 Ga0207663_10883662
295 Ga0207663_11509847
296 Ga0207700_10158832
297 Ga0207700_10331372
298 Ga0207700_11081925
299 Ga0207664_10171090
300 Ga0207664_10295961
301 Ga0207664_10340768
302 Ga0207664_11100338
303 Ga0207704_10731010
304 Ga0207665_10154252
305 Ga0207665_11579576
306 Ga0373923_0072778
307 Ga0373936_0307200
308 Ga0373953_0128492
309 Ga0373954_0359507
310 Ga0373957_0500936
311 Ga0373943_0323123
312 Ga0373955_0312231
313 Ga0373927_0544334
314 Ga0373933_0028617
315 Ga0373937_0004983
316 Ga0373937_1278929
317 Ga0436364_0011569
318 Ga0436364_0339916
319 Ga0436364_0412200
320 Ga0436364_0601049
321 Ga0436364_0628514
322 Ga0436364_0860271
323 Ga0436364_0909761
324 Ga0436364_0975411
325 Ga0436364_1314948
326 Ga0436364_1433743
327 Ga0436365_0054776
328 Ga0436365_0201958
329 Ga0436365_0362522
330 Ga0436365_0679055
331 Ga0436365_0808580
332 Ga0436365_0856735
333 Ga0436365_1151195
334 Ga0436365_1292628
335 Ga0436365_1463153
336 Ga0436365_1503957
337 Ga0436365_1551097
338 Ga0436365_1589544
339 Ga0436365_1698845
340 Ga0436365_1788792
341 Ga0436361_0605888
342 Ga0436363_0023614
343 Ga0436363_0054936
344 Ga0436363_0081952
345 Ga0436363_0168977
346 Ga0436363_0212164
347 Ga0436363_0656631
348 Ga0436363_0744148
349 Ga0436363_0775889
350 Ga0436363_0855292
351 Ga0436363_1366250
352 Ga0436363_1570953
353 Ga0436363_1656359
354 Ga0436362_0010475
355 Ga0436362_0133150
356 Ga0436362_0160550
357 Ga0436362_0260857
358 Ga0436362_0645393
359 Ga0436362_0786444
360 Ga0466969_0095742
361 Ga0466969_0578479
362 Ga0466965_0043236
363 Ga0466965_0456283
364 Ga0466965_0498807
365 Ga0466965_0570213
366 Ga0466966_0247895
367 Ga0466966_0275080
368 Ga0466966_0651615
369 Ga0466961_0003860
370 Ga0466961_0158996
371 Ga0466961_0557112
372 Ga0466963_0001055
373 Ga0466963_0055482
374 Ga0466963_0066682
375 Ga0466963_0112388
376 Ga0466963_0432750
377 Ga0466963_0820915
378 Ga0466963_1141641
379 Ga0466964_0095753
380 Ga0466964_0166370
381 Ga0466964_0202198
382 Ga0466964_0353555
383 Ga0466964_0880414
384 Ga0466968_0094098
385 Ga0466968_0121428
386 Ga0466968_0192989
387 Ga0466968_0471501
388 Ga0466968_0481325
389 Ga0466970_0060353
390 Ga0466970_0085272
391 Ga0466970_0644416
392 Ga0466957_0000131
393 Ga0466957_0092442
394 Ga0466957_0162978
395 Ga0466959_0008777
396 Ga0466959_0036808
397 Ga0466959_0069205
398 Ga0466959_0230352
399 Ga0466959_0325055
400 Ga0466959_0369192
401 Ga0466959_0397077
402 Ga0466958_0004499
403 Ga0466958_0005333
404 Ga0466958_0023133
405 Ga0466958_0064825
406 Ga0466958_0392527
407 Ga0466958_0721165
408 Ga0466967_0011515
409 Ga0466967_0090855
410 Ga0466967_0094349
411 Ga0466967_0229284
412 Ga0466967_0258038
413 Ga0466967_0310072
414 Ga0466967_0326022
415 Ga0466967_0545691
416 Ga0466967_1444522
417 Ga0495592_0087078
418 Ga0495629_0348167
419 Ga0495651_0007539
420 Ga0495653_0021231
421 Ga0495664_0474019
422 Ga0495608_0082452
423 Ga0495618_0026613
424 Ga0495628_0080146
425 Ga0495630_0066911
426 Ga0495652_0031757
427 Ga0495665_0207384
428 Ga0495640_0205062
429 Ga0495587_0275311
430 Ga0495645_0357578
431 Ga0495667_0001932
432 Ga0495667_0474990
433 Ga0495634_0735729
434 Ga0495635_0024450
435 Ga0495657_0004348
436 Ga0495623_0257653
437 Ga0495646_0185499
438 Ga0495613_0217873
439 Ga0495600_0011831
440 Ga0495604_0002901
441 Ga0495604_0276176
442 Ga0495674_0044665
443 Ga0495676_1010807
444 Ga0495680_0049792
445 Ga0495684_0423617
446 Ga0495593_0039075
447 Ga0495593_0403958
448 Ga0495602_0058729
449 Ga0495602_0737459
450 Ga0496102_0269675
451 Ga0496104_0019691
452 Ga0496104_0594100
453 Ga0496105_0136223
454 Ga0496105_0522941
455 Ga0496105_1392698
456 Ga0496106_0572355
457 Ga0496107_1112808
458 Ga0496108_0798550
459 Ga0496108_1227771
460 Ga0496109_0421344
461 Ga0496111_0367647
462 Ga0496112_0094999
463 Ga0496113_0037020
464 Ga0496114_0251589
465 Ga0496114_1069707
466 Ga0496114_1792616
467 Ga0496115_0647457
468 Ga0496115_1207575
469 nmdc:mga0rr50_1591626_c1
470 Ga0495595_0010894
471 Ga0495619_0095983
472 Ga0466962_0007112
473 Ga0466962_0084399
474 Ga0466962_0108306

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ea2-assembly1.cif.gz_A x-ray crystal structure of pf-m1 in complex with inhibitor (6h) and catalytic zinc ion 0.6752 4 40
4j3b-assembly1.cif.gz_A a naturally variable residue in the s1 subsite of m1-family aminopeptidases modulates catalytic properties and promotes functional specialization 0.6682 4 40
4r5t-assembly1.cif.gz_A structure of the m1 alanylaminopeptidase from malaria complexed with a hydroxamic acid-based inhibitor 0.6662 4 40
5y1h-assembly1.cif.gz_A crystal structure of plasmodium falciparum aminopeptidase n in complex with (s)-2-(3-(2,4-difluorobenzyl)ureido)-n-hydroxy-4-methylpentanamide 0.6567 4 40
7xre-assembly1.cif.gz_E crystal structure of dgpa 0.6556 61 84
ID Description Score Start End Superfamily
af_P21803_40_129_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7042 3 84 2.60.40.10
3ebgA01 Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain 0.6724 4 40 2.60.40.1730
af_Q58368_49_364_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6707 68 90 2.130.10.10
af_G5ED65_663_732_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6605 5 86 2.60.40.10
af_P43146_329_417_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6543 16 86 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A6J7D8Q3-F1-model_v4 Unannotated protein 0.9172 2 90
AF-A0A7M2Z1L9-F1-model_v4 Uncharacterized protein 0.9063 3 92
AF-A0A7V8XEJ8-F1-model_v4 Uncharacterized protein 0.8952 1 92
AF-A0A7V8XEJ8-F1-model_v4 Uncharacterized protein 0.8863 1 92
AF-A0A6J7D8Q3-F1-model_v4 Unannotated protein 0.8804 2 90

Map