F350415

General Info

Members Datasets Scaffolds Average Seq Length
237 173 474 454

Family's Representative Sequence

Representative Sequence 3300050494|nmdc:mga06z11_2473_c1|nmdc:mga06z11_2473_c1_1388_2863
Length 480
Sequence MTAPMTPITTFASRTVAVFGLGISGIATCRALSAGGATVVAADDNPTGRDAASAAGFAVEDLAGADWTRFAALVLAPGVPLTHPAPHWTVAKAKAAGVEIIGDIELFCRERARLAPEAPFIAITGTNGKSTTTALIAHILRASGRDVQMGGNIGTAILALEPPAPDRFHVVEMSSFQIELTPSLDASVGVLLNISPDHLDRHGTIEHYAALKARLVEAARRPIVGEDDDWCRDICERLRLANRSWVDVLSANQRVANGWYAEGTDLISQAPWTGPLGAFADLAGLGPLRGRHNIQNALAASAACLIVGVTPGEVAAALATFPGLPHRLEEIGRIDRTLFINDSKATNADSAATALAAFAGDIHWIIGGKPKEGGITSLTEYFPRIAKAYLIGQATEEFAATLDGKVPYDRCGTLDVAVESATLDAMGGGAVAPVVLLSPACASYDQFRNFEIRGDAFRALVVALPGIELRRRDDGKVGAA

Samples

Sample ID Description Type Environment
1 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
53 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
74 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
75 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
78 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
79 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
80 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
81 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
82 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
83 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
84 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
85 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
86 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
97 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
98 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
99 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
103 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
104 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
105 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
108 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
109 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
110 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
111 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
112 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
113 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
114 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
115 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
155 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
165 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
172 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
173 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.06
Nodule 0
Rhizoplane 8.86
Rhizosphere 85.65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06z11_2473_c1 3300050494 Bacteria 7065
2 Ga0070670_100006298 3300005331 Bacteria 10047
3 Ga0068868_100083608 3300005338 Bacteria 2563
4 Ga0070660_100005903 3300005339 Bacteria 8469
5 Ga0070660_100081420 3300005339 Bacteria 2542
6 Ga0070691_10017601 3300005341 Bacteria 3288
7 Ga0070671_100012501 3300005355 Bacteria 6836
8 Ga0070674_100016809 3300005356 Bacteria 4590
9 Ga0070703_10000738 3300005406 Bacteria 10919
10 Ga0070709_10054127 3300005434 Bacteria 2529
11 Ga0070711_100022882 3300005439 Bacteria 4057
12 Ga0070705_100000774 3300005440 Bacteria 18085
13 Ga0070700_100038448 3300005441 Bacteria 2916
14 Ga0070694_100007145 3300005444 Bacteria 6798
15 Ga0070708_100089302 3300005445 Bacteria 2804
16 Ga0070663_100001086 3300005455 Bacteria 14903
17 Ga0070681_10000939 3300005458 Bacteria 24555
18 Ga0070681_10073187 3300005458 Bacteria 3389
19 Ga0070681_10146713 3300005458 Bacteria 2288
20 Ga0068867_100109074 3300005459 Bacteria 2124
21 Ga0070706_100047764 3300005467 Bacteria 3951
22 Ga0070698_100078951 3300005471 Bacteria 3289
23 Ga0070699_100001258 3300005518 Bacteria 23358
24 Ga0068853_100012916 3300005539 Bacteria 6806
25 Ga0070695_100001335 3300005545 Bacteria 13660
26 Ga0070695_100027281 3300005545 Bacteria 3537
27 Ga0070696_100000649 3300005546 Bacteria 22225
28 Ga0070704_100001140 3300005549 Bacteria 13866
29 Ga0068855_100064184 3300005563 Bacteria 4283
30 Ga0068857_100074466 3300005577 Bacteria 3025
31 Ga0068858_100037980 3300005842 Bacteria 4466
32 Ga0068862_100015087 3300005844 Bacteria 6419
33 Ga0068862_100032639 3300005844 Bacteria 4400
34 Ga0081455_10000028 3300005937 Bacteria 155778
35 Ga0075365_10010665 3300006038 Bacteria 5366
36 Ga0075363_100010173 3300006048 Bacteria 4450
37 Ga0075364_10001857 3300006051 Bacteria 11717
38 Ga0070716_100073615 3300006173 Bacteria 2016
39 Ga0070712_100002213 3300006175 Bacteria 11958
40 Ga0075367_10001325 3300006178 Bacteria 10500
41 Ga0075367_10008993 3300006178 Bacteria 5200
42 Ga0075367_10011745 3300006178 Bacteria 4647
43 Ga0075428_100008023 3300006844 Bacteria 11716
44 Ga0075430_100008098 3300006846 Bacteria 8883
45 Ga0075431_100021223 3300006847 Bacteria 6637
46 Ga0075431_100031095 3300006847 Bacteria 5498
47 Ga0075433_10008265 3300006852 Bacteria 8293
48 Ga0075434_100001646 3300006871 Bacteria 19020
49 Ga0075434_100031925 3300006871 Bacteria 5192
50 Ga0075435_100008568 3300007076 Bacteria 7351
51 Ga0075435_100028154 3300007076 Bacteria 4405
52 Ga0111539_10015556 3300009094 Bacteria 9458
53 Ga0111539_10029331 3300009094 Bacteria 6703
54 Ga0111539_10071250 3300009094 Bacteria 4102
55 Ga0105245_10111745 3300009098 Bacteria 2541
56 Ga0105247_10029304 3300009101 Bacteria 3334
57 Ga0114129_10006490 3300009147 Bacteria 16591
58 Ga0114129_10088933 3300009147 Bacteria 4282
59 Ga0105241_10013897 3300009174 Bacteria 5898
60 Ga0105248_10108145 3300009177 Bacteria 3136
61 Ga0105237_10006667 3300009545 Bacteria 12761
62 Ga0105237_10132092 3300009545 Bacteria 2491
63 Ga0105249_10017238 3300009553 Bacteria 6410
64 Ga0163163_10142322 3300014325 Bacteria 2441
65 Ga0157379_10266112 3300014968 Bacteria 1558
66 Ga0224572_1008034 3300024225 Bacteria 1945
67 Ga0207653_10001221 3300025885 Bacteria 8404
68 Ga0207647_10005353 3300025904 Bacteria 9429
69 Ga0207684_10035047 3300025910 Bacteria 4262
70 Ga0207707_10046458 3300025912 Bacteria 3782
71 Ga0207693_10004344 3300025915 Bacteria 11994
72 Ga0207693_10130777 3300025915 Bacteria 1973
73 Ga0207657_10030121 3300025919 Bacteria 4930
74 Ga0207650_10004547 3300025925 Bacteria 9488
75 Ga0207687_10019408 3300025927 Bacteria 4505
76 Ga0207644_10009531 3300025931 Bacteria 6378
77 Ga0207691_10134914 3300025940 Bacteria 2178
78 Ga0207689_10024023 3300025942 Bacteria 5113
79 Ga0207667_10089391 3300025949 Bacteria 3184
80 Ga0207651_10003528 3300025960 Bacteria 7691
81 Ga0207678_10000635 3300026067 Bacteria 32236
82 Ga0207708_10058621 3300026075 Bacteria 2937
83 Ga0207641_10060402 3300026088 Bacteria 3231
84 Ga0207674_10039805 3300026116 Bacteria 4871
85 Ga0207683_10127067 3300026121 Bacteria 2291
86 Ga0207428_10073716 3300027907 Bacteria 2678
87 Ga0268265_10001709 3300028380 Bacteria 17843
88 Ga0265328_10000786 3300031239 Bacteria 14685
89 Ga0265331_10001293 3300031250 Bacteria 18633
90 Ga0265327_10028856 3300031251 Bacteria 3164
91 Ga0265327_10043738 3300031251 Bacteria 2394
92 Ga0265316_10033042 3300031344 Bacteria 4217
93 Ga0316578_10055394 3300031728 Bacteria 2327
94 Ga0373940_0007870 3300035088 Bacteria 2423
95 Ga0373936_0007568 3300035113 Bacteria 4084
96 Ga0373945_0005635 3300035116 Bacteria 4014
97 Ga0373960_0001630 3300035121 Bacteria 5014
98 Ga0373960_0005915 3300035121 Bacteria 2849
99 Ga0373943_0000072 3300035170 Bacteria 35413
100 Ga0373946_0002535 3300035171 Bacteria 6456
101 Ga0373961_0005871 3300035241 Bacteria 2950
102 Ga0316574_0010508 3300035398 Bacteria 5236
103 Ga0373931_0004913 3300035691 Bacteria 6147
104 Ga0373931_0005798 3300035691 Bacteria 5742
105 Ga0373935_0011494 3300035692 Bacteria 5314
106 Ga0373927_0000537 3300035695 Bacteria 28811
107 Ga0373927_0032237 3300035695 Bacteria 3412
108 Ga0373927_0065378 3300035695 Bacteria 2353
109 Ga0373947_0000498 3300035725 Bacteria 22745
110 Ga0373925_0002114 3300037068 Bacteria 16302
111 Ga0373925_0010681 3300037068 Bacteria 6658
112 Ga0436360_0431469 3300039438 Bacteria 5641
113 Ga0436361_0983437 3300039447 Bacteria 12818
114 Ga0436362_0410818 3300039453 Bacteria 2980
115 Ga0495629_0094736 3300046459 Bacteria 2083
116 Ga0495629_0172000 3300046459 Bacteria 1503
117 Ga0495580_0011312 3300046472 Bacteria 6905
118 Ga0495662_0001370 3300046476 Bacteria 12055
119 Ga0495664_0000848 3300046477 Bacteria 15717
120 Ga0495584_0015332 3300046491 Bacteria 3905
121 Ga0495618_0000287 3300046514 Bacteria 36354
122 Ga0495618_0045656 3300046514 Bacteria 2764
123 Ga0495628_0132620 3300046516 Bacteria 1904
124 Ga0495630_0004466 3300046517 Bacteria 9809
125 Ga0495630_0011085 3300046517 Bacteria 6520
126 Ga0495652_0038551 3300046529 Bacteria 4139
127 Ga0495665_0013022 3300046531 Bacteria 4503
128 Ga0495665_0016769 3300046531 Bacteria 3943
129 Ga0495665_0069534 3300046531 Bacteria 1856
130 Ga0495640_0002916 3300046533 Bacteria 13760
131 Ga0495586_0004595 3300046535 Bacteria 7379
132 Ga0495645_0001744 3300046543 Bacteria 14776
133 Ga0495645_0057156 3300046543 Bacteria 2833
134 Ga0495634_0006420 3300046642 Bacteria 8935
135 Ga0495634_0013754 3300046642 Bacteria 5844
136 Ga0495635_0000681 3300046663 Bacteria 21881
137 Ga0495635_0130599 3300046663 Bacteria 1712
138 Ga0495599_0064707 3300046678 Bacteria 2284
139 Ga0495646_0017518 3300046680 Bacteria 4544
140 Ga0495647_0010312 3300046681 Bacteria 3180
141 Ga0495658_0012969 3300046683 Bacteria 4234
142 Ga0495613_0010574 3300046689 Bacteria 6845
143 Ga0495624_0000871 3300046690 Bacteria 23947
144 Ga0495581_0008606 3300047315 Bacteria 5913
145 Ga0495581_0029083 3300047315 Bacteria 3203
146 Ga0495581_0042119 3300047315 Bacteria 2643
147 Ga0495604_0077607 3300047317 Bacteria 2496
148 Ga0495674_0010177 3300047319 Bacteria 8910
149 Ga0495676_0126620 3300047321 Bacteria 1850
150 Ga0495684_0007208 3300047471 Bacteria 8629
151 Ga0495684_0012611 3300047471 Bacteria 6520
152 Ga0495684_0040750 3300047471 Bacteria 3559
153 Ga0495593_0012695 3300047673 Bacteria 4810
154 Ga0495602_0028376 3300048088 Bacteria 5357
155 Ga0496102_0007492 3300048905 Bacteria 9332
156 Ga0496102_0246729 3300048905 Bacteria 1683
157 Ga0496102_0368013 3300048905 Bacteria 1353
158 Ga0496103_0029672 3300048906 Bacteria 3324
159 Ga0496104_0000896 3300048907 Bacteria 25644
160 Ga0496104_0003861 3300048907 Bacteria 12964
161 Ga0496105_0019762 3300048908 Bacteria 5435
162 Ga0496106_0002044 3300048909 Bacteria 15165
163 Ga0496106_0041804 3300048909 Bacteria 3436
164 Ga0496107_0113264 3300048910 Bacteria 1995
165 Ga0496107_0180991 3300048910 Bacteria 1565
166 Ga0496108_0001756 3300048911 Bacteria 17236
167 Ga0496109_0007783 3300048912 Bacteria 9072
168 Ga0496109_0283158 3300048912 Bacteria 1562
169 Ga0496110_0006306 3300048913 Bacteria 9366
170 Ga0496110_0075536 3300048913 Bacteria 2994
171 Ga0496111_0020287 3300048914 Bacteria 4625
172 Ga0496112_0004975 3300048915 Bacteria 11392
173 Ga0496112_0013522 3300048915 Bacteria 7539
174 Ga0496112_0270569 3300048915 Bacteria 1647
175 Ga0496113_0015848 3300048916 Bacteria 5194
176 Ga0501034_0000068 3300049571 Bacteria 182904
177 Ga0501034_0090848 3300049571 Bacteria 3051
178 Ga0501037_0057761 3300049573 Bacteria 2832
179 Ga0501038_0017625 3300049574 Bacteria 6453
180 Ga0501039_0000138 3300049575 Bacteria 49539
181 Ga0501039_0212692 3300049575 Bacteria 1520
182 Ga0501040_0053963 3300049576 Bacteria 2755
183 Ga0501040_0134016 3300049576 Bacteria 1743
184 Ga0501046_0000246 3300049580 Bacteria 55453
185 Ga0501046_0001138 3300049580 Bacteria 25939
186 Ga0501046_0052594 3300049580 Bacteria 3210
187 Ga0501047_0000873 3300049581 Bacteria 30764
188 Ga0501067_0000581 3300049583 Bacteria 19821
189 Ga0501068_0209470 3300049584 Bacteria 1238
190 Ga0501070_0025582 3300049586 Bacteria 4951
191 Ga0501072_0017115 3300049588 Bacteria 5570
192 Ga0501072_0038848 3300049588 Bacteria 3736
193 Ga0501072_0060970 3300049588 Bacteria 2974
194 Ga0501074_0088455 3300049590 Bacteria 2218
195 Ga0501076_0033009 3300049592 Bacteria 4041
196 Ga0501077_0012557 3300049593 Bacteria 5305
197 Ga0501077_0049539 3300049593 Bacteria 2669
198 Ga0501079_0050788 3300049741 Bacteria 3200
199 Ga0501079_0184353 3300049741 Bacteria 1629
200 Ga0501079_0185629 3300049741 Bacteria 1623
201 Ga0501080_0000001 3300049742 Bacteria 241365
202 Ga0501081_0014413 3300049743 Bacteria 5215
203 Ga0501081_0262013 3300049743 Bacteria 1263
204 Ga0501035_0000015 3300049822 Bacteria 246493
205 Ga0501044_0000026 3300049823 Bacteria 183624
206 Ga0501045_0046881 3300049824 Bacteria 3147
207 nmdc:mga03n38_3206_c1 3300050490 Bacteria 5212
208 nmdc:mga00v17_43929_c1 3300050491 Bacteria 2693
209 nmdc:mga06z11_31444_c1 3300050494 Bacteria 2579
210 nmdc:mga09592_79597_c1 3300050508 Bacteria 2790
211 nmdc:mga0qj67_5024_c1 3300050509 Bacteria 9611
212 nmdc:mga06r32_16064_c1 3300050510 Bacteria 6816
213 nmdc:mga06r32_178931_c1 3300050510 Bacteria 2106
214 nmdc:mga06r32_29332_c1 3300050510 Bacteria 5155
215 nmdc:mga08y16_84659_c1 3300050511 Bacteria 3305
216 nmdc:mga0n895_10602_c1 3300050512 Bacteria 8157
217 nmdc:mga0n895_34632_c1 3300050512 Bacteria 4863
218 nmdc:mga0rr50_43083_c1 3300050513 Bacteria 3300
219 nmdc:mga0a205_2329_c1 3300050515 Bacteria 16759
220 nmdc:mga0a205_239229_c1 3300050515 Bacteria 1696
221 nmdc:mga0a205_99543_c1 3300050515 Bacteria 2805
222 Ga0495601_0010747 3300053077 Bacteria 5461
223 Ga0495612_0000095 3300053078 Bacteria 38147
224 Ga0495595_0011852 3300053084 Bacteria 3655
225 Ga0495619_0001557 3300053085 Bacteria 15086
226 Ga0495619_0057989 3300053085 Bacteria 2569
227 Ga0495619_0084022 3300053085 Bacteria 2148
228 Ga0500562_004536 3300053108 Bacteria 3508
229 Ga0500616_0001472 3300053153 Bacteria 22431
230 Ga0501084_0015177 3300054114 Bacteria 6385
231 Ga0501082_0008009 3300060353 Bacteria 9123
232 Ga0501082_0045904 3300060353 Bacteria 3767
233 Ga0501082_0067571 3300060353 Bacteria 3078
234 Ga0501082_0128973 3300060353 Bacteria 2194
235 Ga0530510_0017882 3300061734 Bacteria 5027
236 2671693357 2671180139 Bacteria 4196045
237 2917557287 2917554339 Bacteria 4987857
238 nmdc:mga06z11_2473_c1
239 Ga0070670_100006298
240 Ga0068868_100083608
241 Ga0070660_100005903
242 Ga0070660_100081420
243 Ga0070691_10017601
244 Ga0070671_100012501
245 Ga0070674_100016809
246 Ga0070703_10000738
247 Ga0070709_10054127
248 Ga0070711_100022882
249 Ga0070705_100000774
250 Ga0070700_100038448
251 Ga0070694_100007145
252 Ga0070708_100089302
253 Ga0070663_100001086
254 Ga0070681_10000939
255 Ga0070681_10073187
256 Ga0070681_10146713
257 Ga0068867_100109074
258 Ga0070706_100047764
259 Ga0070698_100078951
260 Ga0070699_100001258
261 Ga0068853_100012916
262 Ga0070695_100001335
263 Ga0070695_100027281
264 Ga0070696_100000649
265 Ga0070704_100001140
266 Ga0068855_100064184
267 Ga0068857_100074466
268 Ga0068858_100037980
269 Ga0068862_100015087
270 Ga0068862_100032639
271 Ga0081455_10000028
272 Ga0075365_10010665
273 Ga0075363_100010173
274 Ga0075364_10001857
275 Ga0070716_100073615
276 Ga0070712_100002213
277 Ga0075367_10001325
278 Ga0075367_10008993
279 Ga0075367_10011745
280 Ga0075428_100008023
281 Ga0075430_100008098
282 Ga0075431_100021223
283 Ga0075431_100031095
284 Ga0075433_10008265
285 Ga0075434_100001646
286 Ga0075434_100031925
287 Ga0075435_100008568
288 Ga0075435_100028154
289 Ga0111539_10015556
290 Ga0111539_10029331
291 Ga0111539_10071250
292 Ga0105245_10111745
293 Ga0105247_10029304
294 Ga0114129_10006490
295 Ga0114129_10088933
296 Ga0105241_10013897
297 Ga0105248_10108145
298 Ga0105237_10006667
299 Ga0105237_10132092
300 Ga0105249_10017238
301 Ga0163163_10142322
302 Ga0157379_10266112
303 Ga0224572_1008034
304 Ga0207653_10001221
305 Ga0207647_10005353
306 Ga0207684_10035047
307 Ga0207707_10046458
308 Ga0207693_10004344
309 Ga0207693_10130777
310 Ga0207657_10030121
311 Ga0207650_10004547
312 Ga0207687_10019408
313 Ga0207644_10009531
314 Ga0207691_10134914
315 Ga0207689_10024023
316 Ga0207667_10089391
317 Ga0207651_10003528
318 Ga0207678_10000635
319 Ga0207708_10058621
320 Ga0207641_10060402
321 Ga0207674_10039805
322 Ga0207683_10127067
323 Ga0207428_10073716
324 Ga0268265_10001709
325 Ga0265328_10000786
326 Ga0265331_10001293
327 Ga0265327_10028856
328 Ga0265327_10043738
329 Ga0265316_10033042
330 Ga0316578_10055394
331 Ga0373940_0007870
332 Ga0373936_0007568
333 Ga0373945_0005635
334 Ga0373960_0001630
335 Ga0373960_0005915
336 Ga0373943_0000072
337 Ga0373946_0002535
338 Ga0373961_0005871
339 Ga0316574_0010508
340 Ga0373931_0004913
341 Ga0373931_0005798
342 Ga0373935_0011494
343 Ga0373927_0000537
344 Ga0373927_0032237
345 Ga0373927_0065378
346 Ga0373947_0000498
347 Ga0373925_0002114
348 Ga0373925_0010681
349 Ga0436360_0431469
350 Ga0436361_0983437
351 Ga0436362_0410818
352 Ga0495629_0094736
353 Ga0495629_0172000
354 Ga0495580_0011312
355 Ga0495662_0001370
356 Ga0495664_0000848
357 Ga0495584_0015332
358 Ga0495618_0000287
359 Ga0495618_0045656
360 Ga0495628_0132620
361 Ga0495630_0004466
362 Ga0495630_0011085
363 Ga0495652_0038551
364 Ga0495665_0013022
365 Ga0495665_0016769
366 Ga0495665_0069534
367 Ga0495640_0002916
368 Ga0495586_0004595
369 Ga0495645_0001744
370 Ga0495645_0057156
371 Ga0495634_0006420
372 Ga0495634_0013754
373 Ga0495635_0000681
374 Ga0495635_0130599
375 Ga0495599_0064707
376 Ga0495646_0017518
377 Ga0495647_0010312
378 Ga0495658_0012969
379 Ga0495613_0010574
380 Ga0495624_0000871
381 Ga0495581_0008606
382 Ga0495581_0029083
383 Ga0495581_0042119
384 Ga0495604_0077607
385 Ga0495674_0010177
386 Ga0495676_0126620
387 Ga0495684_0007208
388 Ga0495684_0012611
389 Ga0495684_0040750
390 Ga0495593_0012695
391 Ga0495602_0028376
392 Ga0496102_0007492
393 Ga0496102_0246729
394 Ga0496102_0368013
395 Ga0496103_0029672
396 Ga0496104_0000896
397 Ga0496104_0003861
398 Ga0496105_0019762
399 Ga0496106_0002044
400 Ga0496106_0041804
401 Ga0496107_0113264
402 Ga0496107_0180991
403 Ga0496108_0001756
404 Ga0496109_0007783
405 Ga0496109_0283158
406 Ga0496110_0006306
407 Ga0496110_0075536
408 Ga0496111_0020287
409 Ga0496112_0004975
410 Ga0496112_0013522
411 Ga0496112_0270569
412 Ga0496113_0015848
413 Ga0501034_0000068
414 Ga0501034_0090848
415 Ga0501037_0057761
416 Ga0501038_0017625
417 Ga0501039_0000138
418 Ga0501039_0212692
419 Ga0501040_0053963
420 Ga0501040_0134016
421 Ga0501046_0000246
422 Ga0501046_0001138
423 Ga0501046_0052594
424 Ga0501047_0000873
425 Ga0501067_0000581
426 Ga0501068_0209470
427 Ga0501070_0025582
428 Ga0501072_0017115
429 Ga0501072_0038848
430 Ga0501072_0060970
431 Ga0501074_0088455
432 Ga0501076_0033009
433 Ga0501077_0012557
434 Ga0501077_0049539
435 Ga0501079_0050788
436 Ga0501079_0184353
437 Ga0501079_0185629
438 Ga0501080_0000001
439 Ga0501081_0014413
440 Ga0501081_0262013
441 Ga0501035_0000015
442 Ga0501044_0000026
443 Ga0501045_0046881
444 nmdc:mga03n38_3206_c1
445 nmdc:mga00v17_43929_c1
446 nmdc:mga06z11_31444_c1
447 nmdc:mga09592_79597_c1
448 nmdc:mga0qj67_5024_c1
449 nmdc:mga06r32_16064_c1
450 nmdc:mga06r32_178931_c1
451 nmdc:mga06r32_29332_c1
452 nmdc:mga08y16_84659_c1
453 nmdc:mga0n895_10602_c1
454 nmdc:mga0n895_34632_c1
455 nmdc:mga0rr50_43083_c1
456 nmdc:mga0a205_2329_c1
457 nmdc:mga0a205_239229_c1
458 nmdc:mga0a205_99543_c1
459 Ga0495601_0010747
460 Ga0495612_0000095
461 Ga0495595_0011852
462 Ga0495619_0001557
463 Ga0495619_0057989
464 Ga0495619_0084022
465 Ga0500562_004536
466 Ga0500616_0001472
467 Ga0501084_0015177
468 Ga0501082_0008009
469 Ga0501082_0045904
470 Ga0501082_0067571
471 Ga0501082_0128973
472 Ga0530510_0017882
473 2671693357
474 2917557287

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02875

Mur_ligase_C

Mur ligase, glutamate ligase domain

326

441

0.86

PF08245

Mur_ligase_M

Mur ligase middle domain

123

304

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ond-assembly1.cif.gz_B crystal structure of lupinus luteus s-adenosyl-l-homocysteine hydrolase in complex with adenosine 0.8984 7 74
5v96-assembly1.cif.gz_A crystal structure of s-adenosyl-l-homocysteine hydrolase from naegleria fowleri with bound nad and adenosine 0.8958 7 74
3h9u-assembly1.cif.gz_B s-adenosyl homocysteine hydrolase (sahh) from trypanosoma brucei 0.892 7 76
3mtg-assembly1.cif.gz_A-2 crystal structure of human s-adenosyl homocysteine hydrolase-like 1 protein 0.8851 7 76
3g1u-assembly1.cif.gz_C crystal structure of leishmania major s-adenosylhomocysteine hydrolase 0.8849 7 77
ID Description Score Start End Superfamily
af_Q6IRI9_1_226_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9129 10 39 3.50.50.60
3ondB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8983 7 74 3.40.50.720
af_Q2FZ92_312_442_3.90.190.20 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain 0.8934 300 431 3.90.190.20
3lk7A03 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain 0.8851 301 434 3.90.190.20
af_Q58783_187_343_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8834 7 76 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2W4KNT3-F1-model_v4 UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase (EC 6.3.2.9) 0.9916 1 116 GO:0005524
GO:0005737
GO:0008360
GO:0008764
GO:0051301
AF-A0A529HNV6-F1-model_v4 UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase (EC 6.3.2.9) 0.9912 1 172 GO:0005524
GO:0005737
GO:0008360
GO:0008764
GO:0009058
GO:0051301
AF-A0A4U8Z0E9-F1-model_v4 UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase 0.9886 2 116 GO:0005524
GO:0005737
GO:0008360
GO:0008764
GO:0051301
AF-A0A659UZ91-F1-model_v4 UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase (EC 6.3.2.9) 0.9875 1 216 GO:0004326
GO:0005524
GO:0005737
GO:0008360
GO:0008764
GO:0051301
AF-A0A529HNV6-F1-model_v4 UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase (EC 6.3.2.9) 0.9855 1 172 GO:0005524
GO:0005737
GO:0008360
GO:0008764
GO:0009058
GO:0051301

Map