F350410

General Info

Members Datasets Scaffolds Average Seq Length
237 191 231 392

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_54822_c1|nmdc:mga0yw44_54822_c1_746_1930
Length 369
Sequence MSAYVYASLRSPFGKFNGALAGCRPDDLAAGVIAGVMRRVPELDPAVIGDVIWGNANGAGEDNRNVGRMATLLAGLPVEVPATTVNRLCGSSLDAVMIGSRTIESGDADVVLTGGVESMTRAPWVLPKPARAFPAGDATAVSTTLGWRLVNPAMPPEWTVSLGEANEQLQERFAISRERQDAFAARSHQLASQAWEDGFYDDLVAPVDGVDLLRDEGIRVGSTADSLAGLKPVFRKDGTITAGNASPLSDGASAAALEPQSFGYAPVEAANRALARAGITWEQVGAVELNEAFAVQSLACVDAWQVDPDIVNTRGGAIALGHPLGASGGRVIGTLAKVLRERGQRWGVAAICIGVGQGLAVVLENEEAA

Samples

Sample ID Description Type Environment
1 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
2 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
3 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
4 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
5 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
6 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
123 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
124 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
140 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
179 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
180 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
190 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.62
Metatranscriptomes 0.84
Isolates 2.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.06
Nodule 0.42
Rhizoplane 8.44
Rhizosphere 80.59
Stem 0
Stem Tuber 0
Unclassified 5.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1002708 3300002773 Bacteria 6476
2 JGI25160J50197_1000293 3300003354 Bacteria 35871
3 Ga0070676_10020772 3300005328 Bacteria 3670
4 Ga0070683_100079208 3300005329 Bacteria 3075
5 Ga0070690_100050747 3300005330 Bacteria 2647
6 Ga0070670_100038782 3300005331 Bacteria 4096
7 Ga0068869_100010865 3300005334 Bacteria 5955
8 Ga0068869_100111360 3300005334 Bacteria 2083
9 Ga0070682_100065022 3300005337 Bacteria 2317
10 Ga0068868_100009959 3300005338 Bacteria 6866
11 Ga0070660_100016310 3300005339 Bacteria 5390
12 Ga0070689_100102535 3300005340 Bacteria 2266
13 Ga0070691_10002978 3300005341 Bacteria 7581
14 Ga0070669_100189206 3300005353 Bacteria 1614
15 Ga0070671_100004979 3300005355 Bacteria 10579
16 Ga0070673_100072647 3300005364 Bacteria 2767
17 Ga0070688_100007714 3300005365 Bacteria 5812
18 Ga0070659_100051604 3300005366 Bacteria 3234
19 Ga0070709_10025984 3300005434 Bacteria 3465
20 Ga0070713_100013208 3300005436 Bacteria 6089
21 Ga0070701_10030790 3300005438 Bacteria 2657
22 Ga0070711_100070445 3300005439 Bacteria 2462
23 Ga0070663_100002665 3300005455 Bacteria 10115
24 Ga0070663_100116051 3300005455 Bacteria 2017
25 Ga0070684_100066648 3300005535 Bacteria 3160
26 Ga0068853_100033283 3300005539 Bacteria 4372
27 Ga0070672_100125400 3300005543 Bacteria 2105
28 Ga0070693_100001130 3300005547 Bacteria 11958
29 Ga0070665_100018069 3300005548 Bacteria 7077
30 Ga0070664_100189305 3300005564 Bacteria 1833
31 Ga0068857_100154109 3300005577 Bacteria 2083
32 Ga0068854_100062982 3300005578 Bacteria 2691
33 Ga0068856_100046363 3300005614 Bacteria 4281
34 Ga0068856_100152138 3300005614 Bacteria 2323
35 Ga0070702_100077219 3300005615 Bacteria 1984
36 Ga0068852_100202934 3300005616 Bacteria 1877
37 Ga0068864_100053553 3300005618 Bacteria 3481
38 Ga0068866_10014332 3300005718 Bacteria 3498
39 Ga0068866_10102524 3300005718 Bacteria 1581
40 Ga0068861_100011634 3300005719 Bacteria 6122
41 Ga0068851_10003029 3300005834 Bacteria 7426
42 Ga0068870_10033508 3300005840 Bacteria 2621
43 Ga0068863_100151836 3300005841 Bacteria 2216
44 Ga0068858_100013248 3300005842 Bacteria 7771
45 Ga0068860_100001348 3300005843 Bacteria 26684
46 Ga0068860_100051963 3300005843 Bacteria 3898
47 Ga0081538_10001354 3300005981 Bacteria 25218
48 Ga0075363_100036264 3300006048 Bacteria 2586
49 Ga0097621_100048763 3300006237 Bacteria 3437
50 Ga0075433_10030675 3300006852 Bacteria 4589
51 Ga0075434_100002700 3300006871 Bacteria 15678
52 Ga0075429_100187656 3300006880 Bacteria 1812
53 Ga0075436_100001293 3300006914 Bacteria 17017
54 Ga0075435_100003653 3300007076 Bacteria 10477
55 Ga0105245_10004971 3300009098 Bacteria 11693
56 Ga0105245_10244352 3300009098 Bacteria 1741
57 Ga0105247_10058000 3300009101 Bacteria 2395
58 Ga0105243_10052562 3300009148 Bacteria 3227
59 Ga0105243_10114399 3300009148 Bacteria 2264
60 Ga0105241_10002429 3300009174 Bacteria 13980
61 Ga0105242_10013039 3300009176 Bacteria 6414
62 Ga0105237_10052722 3300009545 Bacteria 4082
63 Ga0105238_10154979 3300009551 Bacteria 2266
64 Ga0105249_10005642 3300009553 Bacteria 10830
65 Ga0105239_10088527 3300010375 Bacteria 3414
66 Ga0105246_10006706 3300011119 Bacteria 7038
67 Ga0157370_10028779 3300013104 Bacteria 5462
68 Ga0157369_10151602 3300013105 Bacteria 2450
69 Ga0157374_10057894 3300013296 Bacteria 3620
70 Ga0163162_10018219 3300013306 Bacteria 6877
71 Ga0163162_10431244 3300013306 Bacteria 1450
72 Ga0157375_10062095 3300013308 Bacteria 3712
73 Ga0157375_10138713 3300013308 Bacteria 2557
74 Ga0163163_10154836 3300014325 Bacteria 2336
75 Ga0163163_10262461 3300014325 Bacteria 1778
76 Ga0157377_10021730 3300014745 Bacteria 3379
77 Ga0206354_10543614 3300020081 Bacteria 2666
78 Ga0206353_10206619 3300020082 Bacteria 2427
79 Ga0213875_10002818 3300021388 Bacteria 10202
80 Ga0209129_1000130 3300025258 Bacteria 128065
81 Ga0209025_1000364 3300025294 Bacteria 96280
82 Ga0207426_1000759 3300025302 Bacteria 35923
83 Ga0207656_10014206 3300025321 Bacteria 3062
84 Ga0207642_10111820 3300025899 Bacteria 1392
85 Ga0207688_10001145 3300025901 Bacteria 13661
86 Ga0207688_10004270 3300025901 Bacteria 7791
87 Ga0207688_10074231 3300025901 Bacteria 1934
88 Ga0207645_10012427 3300025907 Bacteria 5774
89 Ga0207643_10000511 3300025908 Bacteria 24818
90 Ga0207705_10006029 3300025909 Bacteria 9017
91 Ga0207654_10016744 3300025911 Bacteria 3820
92 Ga0207663_10139950 3300025916 Bacteria 1684
93 Ga0207662_10070327 3300025918 Bacteria 2117
94 Ga0207657_10046760 3300025919 Bacteria 3789
95 Ga0207657_10076887 3300025919 Bacteria 2815
96 Ga0207649_10067106 3300025920 Bacteria 2276
97 Ga0207652_10058777 3300025921 Bacteria 3313
98 Ga0207650_10007054 3300025925 Bacteria 7660
99 Ga0207659_10099422 3300025926 Bacteria 2190
100 Ga0207687_10054491 3300025927 Bacteria 2798
101 Ga0207687_10073261 3300025927 Bacteria 2452
102 Ga0207687_10125404 3300025927 Bacteria 1927
103 Ga0207700_10032454 3300025928 Bacteria 3725
104 Ga0207644_10202446 3300025931 Bacteria 1566
105 Ga0207690_10019898 3300025932 Bacteria 4138
106 Ga0207690_10033347 3300025932 Bacteria 3311
107 Ga0207706_10007151 3300025933 Bacteria 10323
108 Ga0207706_10120776 3300025933 Bacteria 2304
109 Ga0207706_10200610 3300025933 Bacteria 1750
110 Ga0207686_10045836 3300025934 Bacteria 2693
111 Ga0207709_10113879 3300025935 Bacteria 1814
112 Ga0207670_10043370 3300025936 Bacteria 2970
113 Ga0207691_10106934 3300025940 Bacteria 2491
114 Ga0207691_10128489 3300025940 Bacteria 2240
115 Ga0207689_10037417 3300025942 Bacteria 4024
116 Ga0207689_10155326 3300025942 Bacteria 1886
117 Ga0207661_10037594 3300025944 Bacteria 3787
118 Ga0207661_10056308 3300025944 Bacteria 3156
119 Ga0207679_10061757 3300025945 Bacteria 2790
120 Ga0207712_10006472 3300025961 Bacteria 7385
121 Ga0207668_10120236 3300025972 Bacteria 1988
122 Ga0207658_10010287 3300025986 Bacteria 6357
123 Ga0207677_10052488 3300026023 Bacteria 2770
124 Ga0207639_10076521 3300026041 Bacteria 2635
125 Ga0207678_10000720 3300026067 Bacteria 30194
126 Ga0207678_10220498 3300026067 Bacteria 1623
127 Ga0207708_10033798 3300026075 Bacteria 3887
128 Ga0207702_10004169 3300026078 Bacteria 12947
129 Ga0207702_10006187 3300026078 Bacteria 10353
130 Ga0207641_10021577 3300026088 Bacteria 5291
131 Ga0207676_10001854 3300026095 Bacteria 15472
132 Ga0207674_10117822 3300026116 Bacteria 2626
133 Ga0207675_100208537 3300026118 Bacteria 1879
134 Ga0207683_10001996 3300026121 Bacteria 18056
135 Ga0207698_10003644 3300026142 Bacteria 9298
136 Ga0207698_10130717 3300026142 Bacteria 2145
137 Ga0207428_10005656 3300027907 Bacteria 11618
138 Ga0268266_10026002 3300028379 Bacteria 4979
139 Ga0268266_10051725 3300028379 Bacteria 3527
140 Ga0268264_10001378 3300028381 Bacteria 22756
141 Ga0307511_10000489 3300030521 Bacteria 42801
142 Ga0307512_10017367 3300030522 Bacteria 6605
143 Ga0265340_10005950 3300031247 Bacteria 6740
144 Ga0307408_100029752 3300031548 Bacteria 3787
145 Ga0307508_10003150 3300031616 Bacteria 16890
146 Ga0307508_10022188 3300031616 Bacteria 5769
147 Ga0307405_10026028 3300031731 Bacteria 3368
148 Ga0307410_10198957 3300031852 Bacteria 1529
149 Ga0307406_10026042 3300031901 Bacteria 3507
150 Ga0307406_10097630 3300031901 Bacteria 1993
151 Ga0307407_10000556 3300031903 Bacteria 11697
152 Ga0307412_10048673 3300031911 Bacteria 2789
153 Ga0307409_100222858 3300031995 Bacteria 1703
154 Ga0307411_10039662 3300032005 Bacteria 2980
155 Ga0307411_10043543 3300032005 Bacteria 2872
156 Ga0307415_100026256 3300032126 Bacteria 3670
157 Ga0307415_100073483 3300032126 Bacteria 2413
158 Ga0307415_100121790 3300032126 Bacteria 1957
159 Ga0307510_10142491 3300033180 Bacteria 2037
160 Ga0395898_0038143 3300037466 Bacteria 4764
161 Ga0395898_0269650 3300037466 Bacteria 1623
162 Ga0436364_0656866 3300037853 Bacteria 1407
163 Ga0436364_1048401 3300037853 Bacteria 20608
164 Ga0395901_0056955 3300038443 Bacteria 4066
165 Ga0395901_0090665 3300038443 Bacteria 3199
166 Ga0439448_0026965 3300042005 Bacteria 1809
167 Ga0439464_0021465 3300042439 Bacteria 1773
168 Ga0466961_0002332 3300044693 Bacteria 11791
169 Ga0466970_0028041 3300044765 Bacteria 2958
170 Ga0466960_0004323 3300044901 Bacteria 5539
171 Ga0466960_0054757 3300044901 Bacteria 1938
172 Ga0466959_0047782 3300045049 Bacteria 3147
173 Ga0466958_0009312 3300045836 Bacteria 5471
174 Ga0466958_0020593 3300045836 Bacteria 3848
175 Ga0466967_0081394 3300045976 Bacteria 2925
176 Ga0495618_0006768 3300046514 Bacteria 6942
177 Ga0496100_0007273 3300048903 Bacteria 6091
178 Ga0496101_0038827 3300048904 Bacteria 3383
179 Ga0496102_0004650 3300048905 Bacteria 11621
180 Ga0496102_0044785 3300048905 Bacteria 4016
181 Ga0496103_0007677 3300048906 Bacteria 6415
182 Ga0496104_0002829 3300048907 Bacteria 14970
183 Ga0496105_0002610 3300048908 Bacteria 13110
184 Ga0496106_0004424 3300048909 Bacteria 10410
185 Ga0496106_0010373 3300048909 Bacteria 6883
186 Ga0496107_0011640 3300048910 Bacteria 6130
187 Ga0496108_0047822 3300048911 Bacteria 3576
188 Ga0496108_0100606 3300048911 Bacteria 2465
189 Ga0496109_0070693 3300048912 Bacteria 3203
190 Ga0496109_0095459 3300048912 Bacteria 2753
191 Ga0496109_0309795 3300048912 Bacteria 1489
192 Ga0496110_0026193 3300048913 Bacteria 4987
193 Ga0496111_0011160 3300048914 Bacteria 6048
194 Ga0496112_0188529 3300048915 Bacteria 2025
195 Ga0496113_0067908 3300048916 Bacteria 2704
196 Ga0496114_0121877 3300048917 Bacteria 2243
197 Ga0496123_0032910 3300048926 Bacteria 3741
198 Ga0496125_0157983 3300048928 Bacteria 1545
199 Ga0501031_0141970 3300049568 Bacteria 1570
200 Ga0501032_0008299 3300049569 Bacteria 7569
201 Ga0501034_0010475 3300049571 Bacteria 9654
202 Ga0501036_0183052 3300049572 Bacteria 1763
203 Ga0501037_0087548 3300049573 Bacteria 2254
204 Ga0501038_0000694 3300049574 Bacteria 29922
205 Ga0501039_0094941 3300049575 Bacteria 2325
206 Ga0501042_0002903 3300049578 Bacteria 10640
207 Ga0501042_0054389 3300049578 Bacteria 2855
208 Ga0501047_0000092 3300049581 Bacteria 111389
209 Ga0501047_0323265 3300049581 Bacteria 1382
210 Ga0501067_0000740 3300049583 Bacteria 17563
211 Ga0501067_0004832 3300049583 Bacteria 7472
212 Ga0501035_0000909 3300049822 Bacteria 31331
213 Ga0501044_0041602 3300049823 Bacteria 4784
214 Ga0501044_0044854 3300049823 Bacteria 4585
215 Ga0501045_0015552 3300049824 Bacteria 5398
216 nmdc:mga03n38_25674_c1 3300050490 Bacteria 2423
217 nmdc:mga00v17_18186_c1 3300050491 Bacteria 3987
218 nmdc:mga0yw44_143412_c1 3300050492 Bacteria 1553
219 nmdc:mga0yw44_225634_c1 3300050492 Bacteria 1242
220 nmdc:mga0yw44_54822_c1 3300050492 Bacteria 2424
221 nmdc:mga05p37_178040_c1 3300050507 Bacteria 2589
222 nmdc:mga09592_101682_c1 3300050508 Bacteria 2462
223 nmdc:mga08y16_47301_c1 3300050511 Bacteria 4503
224 nmdc:mga0n895_132738_c1 3300050512 Bacteria 2516
225 nmdc:mga0rr50_2059_c1 3300050513 Bacteria 11221
226 nmdc:mga08x19_27646_c1 3300050514 Bacteria 3549
227 nmdc:mga0a205_30059_c1 3300050515 Bacteria 5200
228 Ga0495601_0001111 3300053077 Bacteria 14751
229 Ga0495612_0029097 3300053078 Bacteria 2224
230 Ga0500616_0000131 3300053153 Bacteria 131881
231 Ga0501082_0053642 3300060353 Bacteria 3475

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0323265 Ga0501047_0323265_362_1348 328
2 3300042005 Ga0439448_0026965 Ga0439448_0026965_22_1092 355
3 3300048926 Ga0496123_0032910 Ga0496123_0032910_14_1090 356
4 3300026118 Ga0207675_100208537 Ga0207675_1002085372 365
5 3300042439 Ga0439464_0021465 Ga0439464_0021465_405_1583 367
6 3300050492 nmdc:mga0yw44_54822_c1 nmdc:mga0yw44_54822_c1_746_1930 369
7 3300021388 Ga0213875_10002818 Ga0213875_100028187 370
8 3300037853 Ga0436364_1048401 Ga0436364_1048401_8731_9954 370
9 3300025927 Ga0207687_10125404 Ga0207687_101254042 371
10 3300048912 Ga0496109_0309795 Ga0496109_0309795_290_1471 371
11 3300050492 nmdc:mga0yw44_143412_c1 nmdc:mga0yw44_143412_c1_25_1218 375
12 3300046514 Ga0495618_0006768 Ga0495618_0006768_812_2008 376
13 3300053077 Ga0495601_0001111 Ga0495601_0001111_10582_11778 376
14 3300053078 Ga0495612_0029097 Ga0495612_0029097_906_2102 376
15 3300031548 Ga0307408_100029752 Ga0307408_1000297522 377
16 3300031731 Ga0307405_10026028 Ga0307405_100260283 377
17 3300031901 Ga0307406_10026042 Ga0307406_100260424 377
18 3300031903 Ga0307407_10000556 Ga0307407_1000055613 377
19 3300031911 Ga0307412_10048673 Ga0307412_100486732 377
20 3300031995 Ga0307409_100222858 Ga0307409_1002228582 377
21 3300032005 Ga0307411_10039662 Ga0307411_100396623 377
22 3300032126 Ga0307415_100026256 Ga0307415_1000262563 377
23 3300037466 Ga0395898_0038143 Ga0395898_0038143_1975_3165 377
24 3300005329 Ga0070683_100079208 Ga0070683_1000792082 378
25 3300025944 Ga0207661_10056308 Ga0207661_100563084 378
26 3300049569 Ga0501032_0008299 Ga0501032_0008299_1538_2725 379
27 3300049571 Ga0501034_0010475 Ga0501034_0010475_2570_3757 379
28 3300049572 Ga0501036_0183052 Ga0501036_0183052_343_1530 379
29 3300049574 Ga0501038_0000694 Ga0501038_0000694_2910_4097 379
30 3300049578 Ga0501042_0002903 Ga0501042_0002903_9360_10547 379
31 3300049822 Ga0501035_0000909 Ga0501035_0000909_30103_31290 379
32 3300049823 Ga0501044_0041602 Ga0501044_0041602_1778_2965 379
33 3300003354 JGI25160J50197_1000293 JGI25160J50197_100029320 380
34 3300025302 Ga0207426_1000759 Ga0207426_100075917 381
35 3300050492 nmdc:mga0yw44_225634_c1 nmdc:mga0yw44_225634_c1_29_1177 382
36 3300050507 nmdc:mga05p37_178040_c1 nmdc:mga05p37_178040_c1_925_2157 385
37 3300032126 Ga0307415_100121790 Ga0307415_1001217901 386
38 3300005339 Ga0070660_100016310 Ga0070660_1000163106 389
39 3300025919 Ga0207657_10076887 Ga0207657_100768872 389
40 iso_pu_bacteria 2687453743 2689990519 389
41 iso_pu_bacteria 2751185782 2753265872 390
42 iso_pu_bacteria 2811994874 2812334501 390
43 3300030521 Ga0307511_10000489 Ga0307511_1000048914 391
44 3300031852 Ga0307410_10198957 Ga0307410_101989572 391
45 3300037853 Ga0436364_0656866 Ga0436364_0656866_106_1290 391
46 3300044901 Ga0466960_0054757 Ga0466960_0054757_217_1392 391
47 iso_pu_bacteria 2891554331 2891557337 391
48 3300005564 Ga0070664_100189305 Ga0070664_1001893052 392
49 3300025932 Ga0207690_10033347 Ga0207690_100333472 392
50 iso_pu_bacteria 2837183177 2837186549 392
51 iso_pu_bacteria 2919713450 2919719600 392
52 3300005328 Ga0070676_10020772 Ga0070676_100207724 393
53 3300005330 Ga0070690_100050747 Ga0070690_1000507472 393
54 3300005331 Ga0070670_100038782 Ga0070670_1000387824 393
55 3300005334 Ga0068869_100010865 Ga0068869_1000108653 393
56 3300005338 Ga0068868_100009959 Ga0068868_1000099593 393
57 3300005340 Ga0070689_100102535 Ga0070689_1001025352 393
58 3300005341 Ga0070691_10002978 Ga0070691_100029785 393
59 3300005355 Ga0070671_100004979 Ga0070671_1000049798 393
60 3300005364 Ga0070673_100072647 Ga0070673_1000726471 393
61 3300005365 Ga0070688_100007714 Ga0070688_1000077146 393
62 3300005366 Ga0070659_100051604 Ga0070659_1000516043 393
63 3300005434 Ga0070709_10025984 Ga0070709_100259844 393
64 3300005436 Ga0070713_100013208 Ga0070713_1000132085 393
65 3300005438 Ga0070701_10030790 Ga0070701_100307903 393
66 3300005439 Ga0070711_100070445 Ga0070711_1000704452 393
67 3300005455 Ga0070663_100002665 Ga0070663_10000266511 393
68 3300005535 Ga0070684_100066648 Ga0070684_1000666483 393
69 3300005539 Ga0068853_100033283 Ga0068853_1000332834 393
70 3300005543 Ga0070672_100125400 Ga0070672_1001254002 393
71 3300005547 Ga0070693_100001130 Ga0070693_1000011308 393
72 3300005548 Ga0070665_100018069 Ga0070665_1000180697 393
73 3300005578 Ga0068854_100062982 Ga0068854_1000629822 393
74 3300005614 Ga0068856_100046363 Ga0068856_1000463634 393
75 3300005614 Ga0068856_100152138 Ga0068856_1001521382 393
76 3300005615 Ga0070702_100077219 Ga0070702_1000772192 393
77 3300005618 Ga0068864_100053553 Ga0068864_1000535534 393
78 3300005718 Ga0068866_10102524 Ga0068866_101025242 393
79 3300005834 Ga0068851_10003029 Ga0068851_100030295 393
80 3300005840 Ga0068870_10033508 Ga0068870_100335082 393
81 3300005841 Ga0068863_100151836 Ga0068863_1001518362 393
82 3300005842 Ga0068858_100013248 Ga0068858_1000132486 393
83 3300005843 Ga0068860_100051963 Ga0068860_1000519634 393
84 3300006237 Ga0097621_100048763 Ga0097621_1000487633 393
85 3300006852 Ga0075433_10030675 Ga0075433_100306753 393
86 3300006871 Ga0075434_100002700 Ga0075434_1000027005 393
87 3300006880 Ga0075429_100187656 Ga0075429_1001876562 393
88 3300006914 Ga0075436_100001293 Ga0075436_10000129312 393
89 3300007076 Ga0075435_100003653 Ga0075435_10000365311 393
90 3300009101 Ga0105247_10058000 Ga0105247_100580003 393
91 3300009148 Ga0105243_10114399 Ga0105243_101143992 393
92 3300009174 Ga0105241_10002429 Ga0105241_100024295 393
93 3300009545 Ga0105237_10052722 Ga0105237_100527222 393
94 3300009551 Ga0105238_10154979 Ga0105238_101549792 393
95 3300010375 Ga0105239_10088527 Ga0105239_100885273 393
96 3300011119 Ga0105246_10006706 Ga0105246_100067066 393
97 3300013104 Ga0157370_10028779 Ga0157370_100287793 393
98 3300013296 Ga0157374_10057894 Ga0157374_100578943 393
99 3300013306 Ga0163162_10431244 Ga0163162_104312441 393
100 3300013308 Ga0157375_10138713 Ga0157375_101387134 393
101 3300014325 Ga0163163_10154836 Ga0163163_101548362 393
102 3300014745 Ga0157377_10021730 Ga0157377_100217303 393
103 3300020081 Ga0206354_10543614 Ga0206354_105436143 393
104 3300025321 Ga0207656_10014206 Ga0207656_100142063 393
105 3300025901 Ga0207688_10001145 Ga0207688_100011455 393
106 3300025907 Ga0207645_10012427 Ga0207645_100124274 393
107 3300025908 Ga0207643_10000511 Ga0207643_100005117 393
108 3300025909 Ga0207705_10006029 Ga0207705_100060292 393
109 3300025911 Ga0207654_10016744 Ga0207654_100167444 393
110 3300025916 Ga0207663_10139950 Ga0207663_101399502 393
111 3300025918 Ga0207662_10070327 Ga0207662_100703272 393
112 3300025919 Ga0207657_10046760 Ga0207657_100467602 393
113 3300025920 Ga0207649_10067106 Ga0207649_100671062 393
114 3300025921 Ga0207652_10058777 Ga0207652_100587772 393
115 3300025925 Ga0207650_10007054 Ga0207650_100070542 393
116 3300025926 Ga0207659_10099422 Ga0207659_100994222 393
117 3300025927 Ga0207687_10073261 Ga0207687_100732613 393
118 3300025928 Ga0207700_10032454 Ga0207700_100324543 393
119 3300025931 Ga0207644_10202446 Ga0207644_102024462 393
120 3300025932 Ga0207690_10019898 Ga0207690_100198983 393
121 3300025933 Ga0207706_10200610 Ga0207706_102006102 393
122 3300025936 Ga0207670_10043370 Ga0207670_100433703 393
123 3300025940 Ga0207691_10106934 Ga0207691_101069342 393
124 3300025942 Ga0207689_10037417 Ga0207689_100374173 393
125 3300025944 Ga0207661_10037594 Ga0207661_100375944 393
126 3300025945 Ga0207679_10061757 Ga0207679_100617573 393
127 3300026023 Ga0207677_10052488 Ga0207677_100524882 393
128 3300026041 Ga0207639_10076521 Ga0207639_100765213 393
129 3300026067 Ga0207678_10000720 Ga0207678_1000072016 393
130 3300026075 Ga0207708_10033798 Ga0207708_100337983 393
131 3300026078 Ga0207702_10004169 Ga0207702_100041693 393
132 3300026078 Ga0207702_10006187 Ga0207702_100061872 393
133 3300026088 Ga0207641_10021577 Ga0207641_100215773 393
134 3300026095 Ga0207676_10001854 Ga0207676_100018548 393
135 3300026116 Ga0207674_10117822 Ga0207674_101178222 393
136 3300026121 Ga0207683_10001996 Ga0207683_100019967 393
137 3300026142 Ga0207698_10003644 Ga0207698_1000364411 393
138 3300027907 Ga0207428_10005656 Ga0207428_1000565611 393
139 3300028379 Ga0268266_10026002 Ga0268266_100260023 393
140 3300044901 Ga0466960_0004323 Ga0466960_0004323_396_1577 393
141 3300045836 Ga0466958_0009312 Ga0466958_0009312_3810_5003 393
142 3300048903 Ga0496100_0007273 Ga0496100_0007273_4345_5526 393
143 3300048904 Ga0496101_0038827 Ga0496101_0038827_542_1723 393
144 3300048905 Ga0496102_0004650 Ga0496102_0004650_9636_10817 393
145 3300048905 Ga0496102_0044785 Ga0496102_0044785_1639_2820 393
146 3300048906 Ga0496103_0007677 Ga0496103_0007677_4221_5402 393
147 3300048907 Ga0496104_0002829 Ga0496104_0002829_7107_8288 393
148 3300048908 Ga0496105_0002610 Ga0496105_0002610_10755_11936 393
149 3300048909 Ga0496106_0004424 Ga0496106_0004424_8923_10104 393
150 3300048909 Ga0496106_0010373 Ga0496106_0010373_1725_2906 393
151 3300048910 Ga0496107_0011640 Ga0496107_0011640_1112_2293 393
152 3300048911 Ga0496108_0100606 Ga0496108_0100606_257_1438 393
153 3300048912 Ga0496109_0070693 Ga0496109_0070693_1562_2743 393
154 3300048913 Ga0496110_0026193 Ga0496110_0026193_2261_3442 393
155 3300048914 Ga0496111_0011160 Ga0496111_0011160_503_1684 393
156 3300048915 Ga0496112_0188529 Ga0496112_0188529_181_1362 393
157 3300048916 Ga0496113_0067908 Ga0496113_0067908_1202_2383 393
158 3300048917 Ga0496114_0121877 Ga0496114_0121877_627_1808 393
159 3300048928 Ga0496125_0157983 Ga0496125_0157983_283_1464 393
160 3300049573 Ga0501037_0087548 Ga0501037_0087548_430_1623 393
161 3300049578 Ga0501042_0054389 Ga0501042_0054389_1361_2554 393
162 3300049581 Ga0501047_0000092 Ga0501047_0000092_36628_37821 393
163 3300049583 Ga0501067_0000740 Ga0501067_0000740_16075_17256 393
164 3300049583 Ga0501067_0004832 Ga0501067_0004832_375_1556 393
165 3300049823 Ga0501044_0044854 Ga0501044_0044854_3287_4480 393
166 3300050508 nmdc:mga09592_101682_c1 nmdc:mga09592_101682_c1_110_1291 393
167 3300050511 nmdc:mga08y16_47301_c1 nmdc:mga08y16_47301_c1_2028_3209 393
168 3300050512 nmdc:mga0n895_132738_c1 nmdc:mga0n895_132738_c1_210_1391 393
169 3300050513 nmdc:mga0rr50_2059_c1 nmdc:mga0rr50_2059_c1_9639_10820 393
170 3300050514 nmdc:mga08x19_27646_c1 nmdc:mga08x19_27646_c1_502_1683 393
171 3300050515 nmdc:mga0a205_30059_c1 nmdc:mga0a205_30059_c1_2501_3682 393
172 3300020082 Ga0206353_10206619 Ga0206353_102066192 394
173 3300038443 Ga0395901_0056955 Ga0395901_0056955_668_1852 394
174 3300044693 Ga0466961_0002332 Ga0466961_0002332_5792_6976 394
175 3300045049 Ga0466959_0047782 Ga0466959_0047782_1400_2584 394
176 3300045836 Ga0466958_0020593 Ga0466958_0020593_2369_3553 394
177 3300045976 Ga0466967_0081394 Ga0466967_0081394_611_1795 394
178 3300049568 Ga0501031_0141970 Ga0501031_0141970_52_1245 394
179 3300005843 Ga0068860_100001348 Ga0068860_1000013488 395
180 3300006048 Ga0075363_100036264 Ga0075363_1000362643 395
181 3300013308 Ga0157375_10062095 Ga0157375_100620953 395
182 3300025935 Ga0207709_10113879 Ga0207709_101138792 395
183 3300025940 Ga0207691_10128489 Ga0207691_101284892 395
184 3300025972 Ga0207668_10120236 Ga0207668_101202362 395
185 3300025986 Ga0207658_10010287 Ga0207658_100102875 395
186 3300028381 Ga0268264_10001378 Ga0268264_1000137817 395
187 3300030522 Ga0307512_10017367 Ga0307512_100173672 395
188 3300031616 Ga0307508_10022188 Ga0307508_100221885 395
189 3300044765 Ga0466970_0028041 Ga0466970_0028041_1410_2597 395
190 3300049575 Ga0501039_0094941 Ga0501039_0094941_421_1608 395
191 3300050490 nmdc:mga03n38_25674_c1 nmdc:mga03n38_25674_c1_751_1950 395
192 3300050491 nmdc:mga00v17_18186_c1 nmdc:mga00v17_18186_c1_1500_2699 395
193 3300031247 Ga0265340_10005950 Ga0265340_100059504 396
194 3300031616 Ga0307508_10003150 Ga0307508_1000315014 396
195 3300049824 Ga0501045_0015552 Ga0501045_0015552_1869_3068 396
196 3300053153 Ga0500616_0000131 Ga0500616_0000131_24178_25458 396
197 3300060353 Ga0501082_0053642 Ga0501082_0053642_1668_2867 396
198 3300005337 Ga0070682_100065022 Ga0070682_1000650222 397
199 3300005353 Ga0070669_100189206 Ga0070669_1001892062 397
200 3300005455 Ga0070663_100116051 Ga0070663_1001160513 397
201 3300005577 Ga0068857_100154109 Ga0068857_1001541092 397
202 3300005616 Ga0068852_100202934 Ga0068852_1002029342 397
203 3300005718 Ga0068866_10014332 Ga0068866_100143322 397
204 3300005719 Ga0068861_100011634 Ga0068861_1000116343 397
205 3300009098 Ga0105245_10004971 Ga0105245_100049719 397
206 3300009148 Ga0105243_10052562 Ga0105243_100525622 397
207 3300009176 Ga0105242_10013039 Ga0105242_100130397 397
208 3300009553 Ga0105249_10005642 Ga0105249_100056426 397
209 3300013306 Ga0163162_10018219 Ga0163162_100182197 397
210 3300025899 Ga0207642_10111820 Ga0207642_101118202 397
211 3300025901 Ga0207688_10004270 Ga0207688_100042702 397
212 3300025927 Ga0207687_10054491 Ga0207687_100544912 397
213 3300025933 Ga0207706_10007151 Ga0207706_100071514 397
214 3300025934 Ga0207686_10045836 Ga0207686_100458362 397
215 3300025961 Ga0207712_10006472 Ga0207712_100064723 397
216 3300026067 Ga0207678_10220498 Ga0207678_102204982 397
217 3300026142 Ga0207698_10130717 Ga0207698_101307172 397
218 3300048911 Ga0496108_0047822 Ga0496108_0047822_617_1810 397
219 3300048912 Ga0496109_0095459 Ga0496109_0095459_1079_2272 397
220 3300002773 JGI25152J39213_1002708 JGI25152J39213_10027081 398
221 3300005334 Ga0068869_100111360 Ga0068869_1001113603 398
222 3300005981 Ga0081538_10001354 Ga0081538_1000135428 398
223 3300009098 Ga0105245_10244352 Ga0105245_102443522 398
224 3300013105 Ga0157369_10151602 Ga0157369_101516022 398
225 3300014325 Ga0163163_10262461 Ga0163163_102624612 398
226 3300025258 Ga0209129_1000130 Ga0209129_100013079 398
227 3300025294 Ga0209025_1000364 Ga0209025_100036447 398
228 3300025901 Ga0207688_10074231 Ga0207688_100742311 398
229 3300025933 Ga0207706_10120776 Ga0207706_101207761 398
230 3300025942 Ga0207689_10155326 Ga0207689_101553262 398
231 3300028379 Ga0268266_10051725 Ga0268266_100517253 398
232 3300031901 Ga0307406_10097630 Ga0307406_100976302 398
233 3300032005 Ga0307411_10043543 Ga0307411_100435432 398
234 3300032126 Ga0307415_100073483 Ga0307415_1000734832 398
235 3300033180 Ga0307510_10142491 Ga0307510_101424912 398
236 3300037466 Ga0395898_0269650 Ga0395898_0269650_66_1262 398
237 3300038443 Ga0395901_0090665 Ga0395901_0090665_1330_2526 398

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02803

Thiolase_C

Thiolase, C-terminal domain

247

365

0.97

PF00108

Thiolase_N

Thiolase, N-terminal domain

3

261

0.91

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

20

138

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vtr-assembly1.cif.gz_C-2 3-ketoacyl-coa thiolase tfu_0875 0.9476 1 391
7vtr-assembly1.cif.gz_C-2 3-ketoacyl-coa thiolase tfu_0875 0.9452 1 391
6pcd-assembly1.cif.gz_B crystal structure of beta-ketoadipyl-coa thiolase mutant (c90s-h356a) in complex octanoyl coenzyme a 0.9419 1 392
6pcc-assembly1.cif.gz_C crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex hexanoyl coenzyme a 0.9406 1 392
6pcc-assembly1.cif.gz_A crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex hexanoyl coenzyme a 0.9398 1 392
ID Description Score Start End Superfamily
af_A0A096MJY8_281_393_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9636 277 386 3.40.47.10
af_O53871_287_399_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9568 277 386 3.40.47.10
af_P76461_265_393_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.954 268 392 3.40.47.10
6bjaA02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9491 161 388 3.40.47.10
af_P0C7L2_1_401_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9399 1 392 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A7V4PRG6-F1-model_v4 acetyl-CoA C-acyltransferase (EC 2.3.1.16) 0.9671 271 392 GO:0003988
GO:0006635
GO:0010124
AF-A0A6V8KZ75-F1-model_v4 Thiolase C-terminal domain-containing protein 0.9659 259 394 GO:0003985
GO:0006635
AF-A0A7Y3CCX7-F1-model_v4 Acetyl-CoA C-acetyltransferase (EC 2.3.1.9) 0.9629 273 391 GO:0003985
GO:0006635
AF-A0A7S2EGS6-F1-model_v4 Thiolase C-terminal domain-containing protein 0.9618 273 392 GO:0003988
GO:0006635
GO:0010124
AF-A0A3Y9C792-F1-model_v4 Acetyl-CoA C-acyltransferase (EC 2.3.1.16) 0.9603 1 124 GO:0003988
GO:0044281

Feature Viewer

pLDDT pTM Quality
85.08 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map