F350334

General Info

Members Datasets Scaffolds Average Seq Length
237 129 474 313

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0230979|Ga0496110_0230979_521_1537
Length 338
Sequence LAQPCFVRGCAVEFLDEASYVTSLPAQSISAIVATVGRPELLKLCLDSLAKQTVPVSEVVVVHCGEDAETPALTNDPRWPEAGLNVRYFHHRERNCAQQRNFGIQEAESDNLLLVDDDVEVDAHWAEELFKPIWSDKRVGATMGRLVNQPMAAPTLFWRIYRRVLYGRVKGLEPGRLIGAALPNGFPTTAEQPIKCEWVAGGASALRREAFESVGGFASFFEGSSPGEDLDLGYRLSRAWKVYFVPSARCIHHQSPRGREASDQHQYLSMRSRFGILTITMGKKRHVALAHIALWALVQFLSEVASLRHGVLRSDLPRAWSGRLRGFVSCLTATDVRG

Samples

Sample ID Description Type Environment
1 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
111 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
112 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
113 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
119 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
120 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
121 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
122 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
123 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
129 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.69
Rhizosphere 98.31
Stem 0
Stem Tuber 0
Unclassified 16.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496110_0230979 3300048913 Unclassified 1683
2 MRS1b_contig_8848258 2162886011 Bacteria 2032
3 CNAas_1000201 3300000532 Bacteria 5544
4 JGI24751J29686_10000033 3300002459 Bacteria 87652
5 JGI25406J46586_10023574 3300003203 Bacteria 2430
6 Ga0065712_10067742 3300005290 Bacteria 73878
7 Ga0065715_10003764 3300005293 Bacteria 5663
8 Ga0065715_10004275 3300005293 Bacteria 5321
9 Ga0065715_10090589 3300005293 Bacteria 6778
10 Ga0065715_10095475 3300005293 Bacteria 4075
11 Ga0065707_10180021 3300005295 Bacteria 1424
12 Ga0070670_100000118 3300005331 Bacteria 73231
13 Ga0070680_100003618 3300005336 Bacteria 11540
14 Ga0070682_100003508 3300005337 Bacteria 8676
15 Ga0070687_100010040 3300005343 Bacteria 4076
16 Ga0070692_10010468 3300005345 Bacteria 4222
17 Ga0070669_100042078 3300005353 Bacteria 3324
18 Ga0070673_100058703 3300005364 Bacteria 3043
19 Ga0070673_100104420 3300005364 Unclassified 2339
20 Ga0070703_10001414 3300005406 Bacteria 7252
21 Ga0070700_100000444 3300005441 Bacteria 20953
22 Ga0070694_100007599 3300005444 Bacteria 6616
23 Ga0070694_100009145 3300005444 Bacteria 6077
24 Ga0070694_100016315 3300005444 Bacteria 4675
25 Ga0070694_100025423 3300005444 Bacteria 3830
26 Ga0070681_10000100 3300005458 Bacteria 63828
27 Ga0070706_100000002 3300005467 Bacteria 326510
28 Ga0070698_100028470 3300005471 Bacteria 5803
29 Ga0070699_100001161 3300005518 Bacteria 24445
30 Ga0070679_100000011 3300005530 Bacteria 162902
31 Ga0070679_100021571 3300005530 Bacteria 6289
32 Ga0070686_100050169 3300005544 Bacteria 2651
33 Ga0070695_100098926 3300005545 Bacteria 1961
34 Ga0070695_100161791 3300005545 Bacteria 1572
35 Ga0070695_100174158 3300005545 Unclassified 1520
36 Ga0070696_100127405 3300005546 Bacteria 1849
37 Ga0070693_100034505 3300005547 Bacteria 2800
38 Ga0070693_100050663 3300005547 Bacteria 2374
39 Ga0070693_100064932 3300005547 Bacteria 2132
40 Ga0070704_100053669 3300005549 Bacteria 2849
41 Ga0070704_100214244 3300005549 Bacteria 1562
42 Ga0068857_100046181 3300005577 Unclassified 3865
43 Ga0068857_100179062 3300005577 Unclassified 1929
44 Ga0068857_100284287 3300005577 Bacteria 1522
45 Ga0068854_100263066 3300005578 Unclassified 1382
46 Ga0068852_100161611 3300005616 Bacteria 2092
47 Ga0068859_100009008 3300005617 Bacteria 10079
48 Ga0068859_100080791 3300005617 Bacteria 3292
49 Ga0068859_100095293 3300005617 Unclassified 3029
50 Ga0068859_100108147 3300005617 Unclassified 2842
51 Ga0068859_100146550 3300005617 Bacteria 2436
52 Ga0068864_100079493 3300005618 Bacteria 2871
53 Ga0068864_100105874 3300005618 Bacteria 2500
54 Ga0068864_100112098 3300005618 Bacteria 2431
55 Ga0068864_100225239 3300005618 Bacteria 1732
56 Ga0068864_100291877 3300005618 Bacteria 1524
57 Ga0068864_100382504 3300005618 Bacteria 1334
58 Ga0068866_10067913 3300005718 Unclassified 1873
59 Ga0068861_100096849 3300005719 Bacteria 2339
60 Ga0068861_100097279 3300005719 Unclassified 2334
61 Ga0068851_10010668 3300005834 Bacteria 4291
62 Ga0068870_10020008 3300005840 Bacteria 3253
63 Ga0068858_100071194 3300005842 Bacteria 3225
64 Ga0068858_100146253 3300005842 Bacteria 2219
65 Ga0068858_100149198 3300005842 Bacteria 2197
66 Ga0068860_100053727 3300005843 Bacteria 3829
67 Ga0068860_100199286 3300005843 Unclassified 1939
68 Ga0068860_100262505 3300005843 Bacteria 1684
69 Ga0068862_100087082 3300005844 Bacteria 2716
70 Ga0068862_100321231 3300005844 Bacteria 1429
71 Ga0081539_10000508 3300005985 Bacteria 80945
72 Ga0081539_10001267 3300005985 Bacteria 44584
73 Ga0070716_100081625 3300006173 Bacteria 1931
74 Ga0097621_100002056 3300006237 Bacteria 13762
75 Ga0097621_100069899 3300006237 Bacteria 2899
76 Ga0068871_100010392 3300006358 Bacteria 6792
77 Ga0075428_100276168 3300006844 Bacteria 1808
78 Ga0075428_100418787 3300006844 Bacteria 1435
79 Ga0075430_100099429 3300006846 Unclassified 2429
80 Ga0075431_100093981 3300006847 Bacteria 3094
81 Ga0075433_10044082 3300006852 Bacteria 3875
82 Ga0075433_10195022 3300006852 Bacteria 1802
83 Ga0075433_10273002 3300006852 Bacteria 1498
84 Ga0075434_100058646 3300006871 Bacteria 3825
85 Ga0075434_100193778 3300006871 Bacteria 2053
86 Ga0075429_100033017 3300006880 Bacteria 4498
87 Ga0075436_100152581 3300006914 Bacteria 1626
88 Ga0097620_100009008 3300006931 Bacteria 10079
89 Ga0097620_100020524 3300006931 Bacteria 6630
90 Ga0097620_100020894 3300006931 Bacteria 6571
91 Ga0097620_100050195 3300006931 Bacteria 4191
92 Ga0097620_100080798 3300006931 Bacteria 3292
93 Ga0097620_100095299 3300006931 Unclassified 3029
94 Ga0097620_100108147 3300006931 Unclassified 2842
95 Ga0097620_100146550 3300006931 Bacteria 2436
96 Ga0075435_100063658 3300007076 Bacteria 2995
97 Ga0105240_10035945 3300009093 Bacteria 6378
98 Ga0111539_10023470 3300009094 Bacteria 7578
99 Ga0111539_10257981 3300009094 Bacteria 2030
100 Ga0105245_10202181 3300009098 Unclassified 1908
101 Ga0114129_10002436 3300009147 Bacteria 25821
102 Ga0114129_10036682 3300009147 Bacteria 6921
103 Ga0114129_10386338 3300009147 Bacteria 1847
104 Ga0105243_10016360 3300009148 Bacteria 5611
105 Ga0105243_10515518 3300009148 Unclassified 1136
106 Ga0105241_10034489 3300009174 Bacteria 3802
107 Ga0105241_10063451 3300009174 Unclassified 2850
108 Ga0105241_10178465 3300009174 Bacteria 1760
109 Ga0105241_10183380 3300009174 Bacteria 1738
110 Ga0105241_10265667 3300009174 Unclassified 1460
111 Ga0105242_10022858 3300009176 Bacteria 4924
112 Ga0105242_10093608 3300009176 Bacteria 2533
113 Ga0105248_10003801 3300009177 Bacteria 16737
114 Ga0105248_10018530 3300009177 Bacteria 7695
115 Ga0105248_10137235 3300009177 Bacteria 2759
116 Ga0105248_10138751 3300009177 Bacteria 2742
117 Ga0105248_10323049 3300009177 Bacteria 1738
118 Ga0105237_10004118 3300009545 Bacteria 16956
119 Ga0105237_10119685 3300009545 Bacteria 2627
120 Ga0105237_10129679 3300009545 Bacteria 2516
121 Ga0105238_10004854 3300009551 Bacteria 13306
122 Ga0105238_10025573 3300009551 Bacteria 6019
123 Ga0105249_10012097 3300009553 Bacteria 7597
124 Ga0105249_10145184 3300009553 Bacteria 2279
125 Ga0157373_10018409 3300013100 Bacteria 5085
126 Ga0157378_10077652 3300013297 Bacteria 2994
127 Ga0163162_10086318 3300013306 Unclassified 3216
128 Ga0163162_10179487 3300013306 Bacteria 2243
129 Ga0157375_10025713 3300013308 Bacteria 5477
130 Ga0157375_10105979 3300013308 Bacteria 2902
131 Ga0157375_10148978 3300013308 Bacteria 2474
132 Ga0163163_10000263 3300014325 Bacteria 53159
133 Ga0163163_10042984 3300014325 Bacteria 4428
134 Ga0157380_10002244 3300014326 Bacteria 13000
135 Ga0157379_10257083 3300014968 Bacteria 1586
136 Ga0207653_10001505 3300025885 Bacteria 7543
137 Ga0207710_10014588 3300025900 Bacteria 3316
138 Ga0207647_10007422 3300025904 Bacteria 7922
139 Ga0207643_10025764 3300025908 Bacteria 3253
140 Ga0207684_10000065 3300025910 Bacteria 194463
141 Ga0207654_10025018 3300025911 Bacteria 3215
142 Ga0207654_10337935 3300025911 Unclassified 1034
143 Ga0207707_10000028 3300025912 Bacteria 167115
144 Ga0207707_10022914 3300025912 Bacteria 5462
145 Ga0207695_10359532 3300025913 Bacteria 1342
146 Ga0207671_10051877 3300025914 Bacteria 3039
147 Ga0207660_10008499 3300025917 Bacteria 6640
148 Ga0207662_10031359 3300025918 Bacteria 3088
149 Ga0207662_10251845 3300025918 Bacteria 1159
150 Ga0207652_10000443 3300025921 Bacteria 42831
151 Ga0207652_10045620 3300025921 Bacteria 3737
152 Ga0207681_10033911 3300025923 Bacteria 3352
153 Ga0207681_10119933 3300025923 Bacteria 1927
154 Ga0207694_10008235 3300025924 Bacteria 7881
155 Ga0207694_10170215 3300025924 Unclassified 1763
156 Ga0207650_10000046 3300025925 Bacteria 178190
157 Ga0207650_10097930 3300025925 Bacteria 2252
158 Ga0207686_10065836 3300025934 Unclassified 2312
159 Ga0207709_10002396 3300025935 Bacteria 11810
160 Ga0207670_10003000 3300025936 Bacteria 8910
161 Ga0207665_10064367 3300025939 Bacteria 2491
162 Ga0207711_10037848 3300025941 Bacteria 4100
163 Ga0207711_10111852 3300025941 Bacteria 2430
164 Ga0207711_10131970 3300025941 Bacteria 2241
165 Ga0207711_10211522 3300025941 Bacteria 1771
166 Ga0207689_10172289 3300025942 Unclassified 1784
167 Ga0207651_10285149 3300025960 Bacteria 1367
168 Ga0207712_10010515 3300025961 Bacteria 5874
169 Ga0207712_10140491 3300025961 Bacteria 1852
170 Ga0207640_10108284 3300025981 Unclassified 1964
171 Ga0207640_10161169 3300025981 Bacteria 1660
172 Ga0207703_10050285 3300026035 Bacteria 3373
173 Ga0207703_10077476 3300026035 Unclassified 2760
174 Ga0207703_10144521 3300026035 Bacteria 2068
175 Ga0207708_10000133 3300026075 Bacteria 58317
176 Ga0207708_10002368 3300026075 Bacteria 13844
177 Ga0207708_10015491 3300026075 Bacteria 5718
178 Ga0207702_10022387 3300026078 Bacteria 5239
179 Ga0207641_10116695 3300026088 Unclassified 2375
180 Ga0207641_10119230 3300026088 Bacteria 2352
181 Ga0207648_10155137 3300026089 Bacteria 2021
182 Ga0207676_10008506 3300026095 Bacteria 7297
183 Ga0207676_10031943 3300026095 Bacteria 3962
184 Ga0207676_10162624 3300026095 Unclassified 1936
185 Ga0207676_10245156 3300026095 Bacteria 1610
186 Ga0207676_10256159 3300026095 Bacteria 1578
187 Ga0207674_10007064 3300026116 Bacteria 13122
188 Ga0207674_10105346 3300026116 Unclassified 2798
189 Ga0207674_10113638 3300026116 Bacteria 2680
190 Ga0207674_10132278 3300026116 Bacteria 2457
191 Ga0207674_10187228 3300026116 Bacteria 2020
192 Ga0207674_10323521 3300026116 Bacteria 1491
193 Ga0207675_100019051 3300026118 Bacteria 6406
194 Ga0207675_100036677 3300026118 Unclassified 4573
195 Ga0207675_100327758 3300026118 Bacteria 1496
196 Ga0207675_100504297 3300026118 Bacteria 1205
197 Ga0207698_10007986 3300026142 Bacteria 6666
198 Ga0268265_10011062 3300028380 Bacteria 6097
199 Ga0268265_10365331 3300028380 Bacteria 1323
200 Ga0268264_10034668 3300028381 Bacteria 4153
201 Ga0268264_10125297 3300028381 Unclassified 2269
202 Ga0268264_10128982 3300028381 Bacteria 2239
203 Ga0268264_10130871 3300028381 Bacteria 2224
204 Ga0268264_10261337 3300028381 Unclassified 1613
205 Ga0307405_10223441 3300031731 Bacteria 1383
206 Ga0307406_10144925 3300031901 Archaea 1686
207 Ga0307412_10056724 3300031911 Unclassified 2612
208 Ga0373942_0017301 3300035207 Bacteria 1776
209 Ga0242420_004278 3300038996 Bacteria 2152
210 Ga0439448_0058208 3300042005 Bacteria 1274
211 Ga0439458_0012196 3300042157 Bacteria 1927
212 Ga0451576_0570721 3300045051 Bacteria 1189
213 Ga0496108_0179549 3300048911 Bacteria 1833
214 Ga0496112_0042746 3300048915 Unclassified 4435
215 Ga0496113_0278081 3300048916 Bacteria 1338
216 Ga0501298_003441 3300049521 Bacteria 2452
217 Ga0501298_006398 3300049521 Bacteria 1925
218 Ga0501206_003740 3300049653 Bacteria 1936
219 Ga0501235_004650 3300049669 Bacteria 2968
220 Ga0501257_005407 3300049686 Unclassified 2816
221 Ga0501225_0044092 3300049705 Unclassified 1233
222 Ga0501229_013780 3300049706 Unclassified 1039
223 nmdc:mga05p37_726672_c1 3300050507 Unclassified 1099
224 nmdc:mga06r32_457592_c1 3300050510 Unclassified 1255
225 nmdc:mga06r32_714432_c1 3300050510 Unclassified 967
226 nmdc:mga08y16_104682_c1 3300050511 Bacteria 2945
227 nmdc:mga08y16_212786_c1 3300050511 Bacteria 2002
228 nmdc:mga08y16_224044_c1 3300050511 Bacteria 1946
229 nmdc:mga08y16_44863_c1 3300050511 Bacteria 4633
230 nmdc:mga0n895_128931_c1 3300050512 Bacteria 2554
231 nmdc:mga0n895_168398_c1 3300050512 Unclassified 2223
232 nmdc:mga0n895_22519_c1 3300050512 Bacteria 5909
233 nmdc:mga08x19_46069_c1 3300050514 Bacteria 2788
234 nmdc:mga0a205_194078_c1 3300050515 Bacteria 1922
235 nmdc:mga0a205_253683_c1 3300050515 Bacteria 1638
236 nmdc:mga0a205_311727_c1 3300050515 Bacteria 1446
237 nmdc:mga0a205_31897_c1 3300050515 Bacteria 5050
238 Ga0496110_0230979
239 MRS1b_contig_8848258
240 CNAas_1000201
241 JGI24751J29686_10000033
242 JGI25406J46586_10023574
243 Ga0065712_10067742
244 Ga0065715_10003764
245 Ga0065715_10004275
246 Ga0065715_10090589
247 Ga0065715_10095475
248 Ga0065707_10180021
249 Ga0070670_100000118
250 Ga0070680_100003618
251 Ga0070682_100003508
252 Ga0070687_100010040
253 Ga0070692_10010468
254 Ga0070669_100042078
255 Ga0070673_100058703
256 Ga0070673_100104420
257 Ga0070703_10001414
258 Ga0070700_100000444
259 Ga0070694_100007599
260 Ga0070694_100009145
261 Ga0070694_100016315
262 Ga0070694_100025423
263 Ga0070681_10000100
264 Ga0070706_100000002
265 Ga0070698_100028470
266 Ga0070699_100001161
267 Ga0070679_100000011
268 Ga0070679_100021571
269 Ga0070686_100050169
270 Ga0070695_100098926
271 Ga0070695_100161791
272 Ga0070695_100174158
273 Ga0070696_100127405
274 Ga0070693_100034505
275 Ga0070693_100050663
276 Ga0070693_100064932
277 Ga0070704_100053669
278 Ga0070704_100214244
279 Ga0068857_100046181
280 Ga0068857_100179062
281 Ga0068857_100284287
282 Ga0068854_100263066
283 Ga0068852_100161611
284 Ga0068859_100009008
285 Ga0068859_100080791
286 Ga0068859_100095293
287 Ga0068859_100108147
288 Ga0068859_100146550
289 Ga0068864_100079493
290 Ga0068864_100105874
291 Ga0068864_100112098
292 Ga0068864_100225239
293 Ga0068864_100291877
294 Ga0068864_100382504
295 Ga0068866_10067913
296 Ga0068861_100096849
297 Ga0068861_100097279
298 Ga0068851_10010668
299 Ga0068870_10020008
300 Ga0068858_100071194
301 Ga0068858_100146253
302 Ga0068858_100149198
303 Ga0068860_100053727
304 Ga0068860_100199286
305 Ga0068860_100262505
306 Ga0068862_100087082
307 Ga0068862_100321231
308 Ga0081539_10000508
309 Ga0081539_10001267
310 Ga0070716_100081625
311 Ga0097621_100002056
312 Ga0097621_100069899
313 Ga0068871_100010392
314 Ga0075428_100276168
315 Ga0075428_100418787
316 Ga0075430_100099429
317 Ga0075431_100093981
318 Ga0075433_10044082
319 Ga0075433_10195022
320 Ga0075433_10273002
321 Ga0075434_100058646
322 Ga0075434_100193778
323 Ga0075429_100033017
324 Ga0075436_100152581
325 Ga0097620_100009008
326 Ga0097620_100020524
327 Ga0097620_100020894
328 Ga0097620_100050195
329 Ga0097620_100080798
330 Ga0097620_100095299
331 Ga0097620_100108147
332 Ga0097620_100146550
333 Ga0075435_100063658
334 Ga0105240_10035945
335 Ga0111539_10023470
336 Ga0111539_10257981
337 Ga0105245_10202181
338 Ga0114129_10002436
339 Ga0114129_10036682
340 Ga0114129_10386338
341 Ga0105243_10016360
342 Ga0105243_10515518
343 Ga0105241_10034489
344 Ga0105241_10063451
345 Ga0105241_10178465
346 Ga0105241_10183380
347 Ga0105241_10265667
348 Ga0105242_10022858
349 Ga0105242_10093608
350 Ga0105248_10003801
351 Ga0105248_10018530
352 Ga0105248_10137235
353 Ga0105248_10138751
354 Ga0105248_10323049
355 Ga0105237_10004118
356 Ga0105237_10119685
357 Ga0105237_10129679
358 Ga0105238_10004854
359 Ga0105238_10025573
360 Ga0105249_10012097
361 Ga0105249_10145184
362 Ga0157373_10018409
363 Ga0157378_10077652
364 Ga0163162_10086318
365 Ga0163162_10179487
366 Ga0157375_10025713
367 Ga0157375_10105979
368 Ga0157375_10148978
369 Ga0163163_10000263
370 Ga0163163_10042984
371 Ga0157380_10002244
372 Ga0157379_10257083
373 Ga0207653_10001505
374 Ga0207710_10014588
375 Ga0207647_10007422
376 Ga0207643_10025764
377 Ga0207684_10000065
378 Ga0207654_10025018
379 Ga0207654_10337935
380 Ga0207707_10000028
381 Ga0207707_10022914
382 Ga0207695_10359532
383 Ga0207671_10051877
384 Ga0207660_10008499
385 Ga0207662_10031359
386 Ga0207662_10251845
387 Ga0207652_10000443
388 Ga0207652_10045620
389 Ga0207681_10033911
390 Ga0207681_10119933
391 Ga0207694_10008235
392 Ga0207694_10170215
393 Ga0207650_10000046
394 Ga0207650_10097930
395 Ga0207686_10065836
396 Ga0207709_10002396
397 Ga0207670_10003000
398 Ga0207665_10064367
399 Ga0207711_10037848
400 Ga0207711_10111852
401 Ga0207711_10131970
402 Ga0207711_10211522
403 Ga0207689_10172289
404 Ga0207651_10285149
405 Ga0207712_10010515
406 Ga0207712_10140491
407 Ga0207640_10108284
408 Ga0207640_10161169
409 Ga0207703_10050285
410 Ga0207703_10077476
411 Ga0207703_10144521
412 Ga0207708_10000133
413 Ga0207708_10002368
414 Ga0207708_10015491
415 Ga0207702_10022387
416 Ga0207641_10116695
417 Ga0207641_10119230
418 Ga0207648_10155137
419 Ga0207676_10008506
420 Ga0207676_10031943
421 Ga0207676_10162624
422 Ga0207676_10245156
423 Ga0207676_10256159
424 Ga0207674_10007064
425 Ga0207674_10105346
426 Ga0207674_10113638
427 Ga0207674_10132278
428 Ga0207674_10187228
429 Ga0207674_10323521
430 Ga0207675_100019051
431 Ga0207675_100036677
432 Ga0207675_100327758
433 Ga0207675_100504297
434 Ga0207698_10007986
435 Ga0268265_10011062
436 Ga0268265_10365331
437 Ga0268264_10034668
438 Ga0268264_10125297
439 Ga0268264_10128982
440 Ga0268264_10130871
441 Ga0268264_10261337
442 Ga0307405_10223441
443 Ga0307406_10144925
444 Ga0307412_10056724
445 Ga0373942_0017301
446 Ga0242420_004278
447 Ga0439448_0058208
448 Ga0439458_0012196
449 Ga0451576_0570721
450 Ga0496108_0179549
451 Ga0496112_0042746
452 Ga0496113_0278081
453 Ga0501298_003441
454 Ga0501298_006398
455 Ga0501206_003740
456 Ga0501235_004650
457 Ga0501257_005407
458 Ga0501225_0044092
459 Ga0501229_013780
460 nmdc:mga05p37_726672_c1
461 nmdc:mga06r32_457592_c1
462 nmdc:mga06r32_714432_c1
463 nmdc:mga08y16_104682_c1
464 nmdc:mga08y16_212786_c1
465 nmdc:mga08y16_224044_c1
466 nmdc:mga08y16_44863_c1
467 nmdc:mga0n895_128931_c1
468 nmdc:mga0n895_168398_c1
469 nmdc:mga0n895_22519_c1
470 nmdc:mga08x19_46069_c1
471 nmdc:mga0a205_194078_c1
472 nmdc:mga0a205_253683_c1
473 nmdc:mga0a205_311727_c1
474 nmdc:mga0a205_31897_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

30

215

0.83

PF13632

Glyco_trans_2_3

Glycosyl transferase family group 2

183

328

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7509 2 229
6p61-assembly2.cif.gz_B structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7482 2 227
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7473 2 229
6p61-assembly2.cif.gz_B structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7411 2 227
6iwr-assembly2.cif.gz_D crystal structure of galnac-t7 with udp, galnac and mn2+ 0.7394 3 248
ID Description Score Start End Superfamily
af_P9WMX7_1_219_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7661 1 235 3.90.550.10
af_A0A2R8QCE8_89_340_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7608 3 129 3.90.550.10
af_P75905_64_287_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7515 3 235 3.90.550.10
af_P9WLV3_5_208_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7514 2 235 3.90.550.10
5yrtJ00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Diol/glycerol dehydratase, large subunit 0.7512 2 39 3.20.20.350
ID Description Score Start End GO Terms
AF-A0A0S7X2K8-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.8558 1 307 GO:0016020
AF-A0A0F8NXG9-F1-model_v4 Glycosyltransferase family 2 protein 0.8554 4 307 GO:0016740
AF-A0A7V9WPN8-F1-model_v4 Glycosyltransferase 0.8545 1 314 GO:0016740
AF-A0A3D0S060-F1-model_v4 Glycosyl transferase 0.8512 2 107 GO:0016740
AF-A0A7U4KH47-F1-model_v4 deleted 0.8485 2 307

Map