F350249

General Info

Members Datasets Scaffolds Average Seq Length
237 150 474 110

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0207600|Ga0466961_0207600_683_1009
Length 108
Sequence VKRGDIYMVSLDPAVGHEQRGHRPVLVIPATEFNNATRLPVVLPITSGGEFARRIGFAVPLFGLHTTGVVRCDQPRVLDLYARNGRKVESLPPEILEEVLARTITLFS

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
92 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
93 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
95 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
96 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
97 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
98 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
99 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
100 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
101 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
102 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
136 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
143 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
144 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
147 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
150 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.42
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0
Rhizoplane 0
Rhizosphere 96.62
Stem 0
Stem Tuber 0
Unclassified 23.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0207600 3300044693 Bacteria 1210
2 Ga0070658_10418290 3300005327 Bacteria 1152
3 Ga0070683_102134545 3300005329 Unclassified 538
4 Ga0068869_100574966 3300005334 Bacteria 949
5 Ga0070689_101169853 3300005340 Bacteria 689
6 Ga0070671_100516022 3300005355 Unclassified 1029
7 Ga0070673_102277844 3300005364 Bacteria 515
8 Ga0070667_100371375 3300005367 Bacteria 1298
9 Ga0070708_100746142 3300005445 Bacteria 921
10 Ga0070681_10029901 3300005458 Bacteria 5467
11 Ga0070681_10209182 3300005458 Unclassified 1867
12 Ga0070681_10480019 3300005458 Unclassified 1156
13 Ga0068867_100808898 3300005459 Bacteria 836
14 Ga0070706_100482204 3300005467 Bacteria 1154
15 Ga0070707_100004656 3300005468 Bacteria 12843
16 Ga0070707_101148424 3300005468 Bacteria 743
17 Ga0070698_100147762 3300005471 Unclassified 2299
18 Ga0070699_101314152 3300005518 Bacteria 663
19 Ga0070679_100000958 3300005530 Bacteria 25121
20 Ga0070679_100076509 3300005530 Bacteria 3336
21 Ga0070679_100252197 3300005530 Unclassified 1721
22 Ga0070679_101056174 3300005530 Bacteria 757
23 Ga0070684_100448704 3300005535 Bacteria 1192
24 Ga0070684_100803686 3300005535 Unclassified 879
25 Ga0070697_100444567 3300005536 Bacteria 1129
26 Ga0070686_100946216 3300005544 Unclassified 703
27 Ga0070693_101437113 3300005547 Bacteria 537
28 Ga0068855_100006076 3300005563 Bacteria 14721
29 Ga0068855_100287881 3300005563 Bacteria 1822
30 Ga0068855_100519366 3300005563 Unclassified 1292
31 Ga0068855_102541469 3300005563 Bacteria 509
32 Ga0070664_100165925 3300005564 Bacteria 1957
33 Ga0068857_100906319 3300005577 Unclassified 845
34 Ga0068856_100039175 3300005614 Unclassified 4653
35 Ga0068852_100994789 3300005616 Bacteria 857
36 Ga0068859_100690014 3300005617 Bacteria 1112
37 Ga0068864_100053365 3300005618 Bacteria 3487
38 Ga0068864_101219087 3300005618 Bacteria 751
39 Ga0068864_101613182 3300005618 Bacteria 653
40 Ga0068866_10799659 3300005718 Unclassified 655
41 Ga0068863_100022339 3300005841 Bacteria 6041
42 Ga0068863_100723165 3300005841 Bacteria 990
43 Ga0068863_102009567 3300005841 Bacteria 588
44 Ga0068858_100232520 3300005842 Bacteria 1748
45 Ga0068858_100862137 3300005842 Bacteria 885
46 Ga0068860_100138083 3300005843 Bacteria 2342
47 Ga0070717_10035109 3300006028 Bacteria 4056
48 Ga0070717_10586414 3300006028 Unclassified 1011
49 Ga0075436_100892936 3300006914 Unclassified 664
50 Ga0097620_100690065 3300006931 Bacteria 1112
51 Ga0105240_10012392 3300009093 Bacteria 11774
52 Ga0105240_12185745 3300009093 Bacteria 574
53 Ga0105245_10226681 3300009098 Bacteria 1806
54 Ga0105245_10300104 3300009098 Bacteria 1576
55 Ga0105245_10409379 3300009098 Bacteria 1357
56 Ga0105247_10573866 3300009101 Bacteria 833
57 Ga0105241_10006723 3300009174 Bacteria 8461
58 Ga0105241_11511083 3300009174 Bacteria 647
59 Ga0105242_10162673 3300009176 Bacteria 1955
60 Ga0105242_10191984 3300009176 Bacteria 1809
61 Ga0105242_10791048 3300009176 Bacteria 938
62 Ga0105248_10149393 3300009177 Plasmid 2636
63 Ga0105248_10259888 3300009177 Bacteria 1955
64 Ga0105248_10478044 3300009177 Bacteria 1404
65 Ga0105248_11714103 3300009177 Bacteria 712
66 Ga0105248_12087220 3300009177 Bacteria 644
67 Ga0105248_13112831 3300009177 Unclassified 528
68 Ga0105237_10020965 3300009545 Bacteria 6727
69 Ga0105238_10005860 3300009551 Bacteria 12174
70 Ga0105249_10003515 3300009553 Bacteria 13559
71 Ga0099796_10558291 3300010159 Bacteria 515
72 Ga0105239_10017817 3300010375 Bacteria 7856
73 Ga0157373_11235886 3300013100 Unclassified 564
74 Ga0157370_10012678 3300013104 Bacteria 8728
75 Ga0157370_10363652 3300013104 Bacteria 1333
76 Ga0157370_10514718 3300013104 Bacteria 1099
77 Ga0157370_10876255 3300013104 Bacteria 815
78 Ga0157369_12484341 3300013105 Bacteria 525
79 Ga0157378_10037455 3300013297 Bacteria 4295
80 Ga0157378_10091760 3300013297 Unclassified 2762
81 Ga0157378_10795752 3300013297 Unclassified 971
82 Ga0157375_10006348 3300013308 Bacteria 10303
83 Ga0157375_11758280 3300013308 Bacteria 735
84 Ga0157375_12168113 3300013308 Unclassified 662
85 Ga0163163_10056367 3300014325 Bacteria 3884
86 Ga0163163_10435021 3300014325 Bacteria 1371
87 Ga0157376_10200947 3300014969 Bacteria 1834
88 Ga0157376_10272796 3300014969 Bacteria 1590
89 Ga0157376_10418830 3300014969 Bacteria 1299
90 Ga0157376_11506800 3300014969 Bacteria 706
91 Ga0213876_10161228 3300021384 Bacteria 1193
92 Ga0228598_1017994 3300024227 Bacteria 1394
93 Ga0207692_10004896 3300025898 Bacteria 5334
94 Ga0207684_10062216 3300025910 Bacteria 3169
95 Ga0207654_10007066 3300025911 Bacteria 5656
96 Ga0207707_10005022 3300025912 Bacteria 11621
97 Ga0207707_11551262 3300025912 Bacteria 523
98 Ga0207695_10053416 3300025913 Unclassified 4226
99 Ga0207695_10377576 3300025913 Bacteria 1303
100 Ga0207671_10520202 3300025914 Bacteria 949
101 Ga0207660_10028342 3300025917 Bacteria 3830
102 Ga0207652_10002262 3300025921 Bacteria 16333
103 Ga0207652_10050191 3300025921 Bacteria 3574
104 Ga0207652_10243854 3300025921 Unclassified 1620
105 Ga0207646_10414411 3300025922 Bacteria 1216
106 Ga0207646_11375998 3300025922 Bacteria 614
107 Ga0207694_10623987 3300025924 Unclassified 907
108 Ga0207687_11751080 3300025927 Unclassified 532
109 Ga0207644_10176685 3300025931 Unclassified 1671
110 Ga0207686_10218454 3300025934 Bacteria 1375
111 Ga0207670_11061835 3300025936 Bacteria 683
112 Ga0207665_10627010 3300025939 Bacteria 841
113 Ga0207711_10451020 3300025941 Unclassified 1197
114 Ga0207661_10147102 3300025944 Bacteria 2034
115 Ga0207679_10836882 3300025945 Bacteria 840
116 Ga0207667_10015873 3300025949 Bacteria 8530
117 Ga0207667_10135026 3300025949 Unclassified 2541
118 Ga0207667_10434783 3300025949 Bacteria 1334
119 Ga0207712_10097964 3300025961 Bacteria 2174
120 Ga0207658_10762034 3300025986 Bacteria 877
121 Ga0207703_10512550 3300026035 Bacteria 1127
122 Ga0207703_10621500 3300026035 Bacteria 1023
123 Ga0207702_10937572 3300026078 Bacteria 858
124 Ga0207641_10030682 3300026088 Bacteria 4453
125 Ga0207676_10035136 3300026095 Unclassified 3801
126 Ga0207676_11504738 3300026095 Bacteria 670
127 Ga0207674_10013684 3300026116 Bacteria 8988
128 Ga0207698_11093456 3300026142 Bacteria 810
129 Ga0268264_10439719 3300028381 Bacteria 1261
130 Ga0265319_1146373 3300028563 Unclassified 732
131 Ga0265338_10167971 3300028800 Bacteria 1687
132 Ga0265762_1099540 3300030760 Bacteria 643
133 Ga0265325_10010208 3300031241 Bacteria 5449
134 Ga0265325_10029890 3300031241 Bacteria 2925
135 Ga0265325_10210575 3300031241 Bacteria 893
136 Ga0265325_10430299 3300031241 Unclassified 576
137 Ga0265339_10282121 3300031249 Bacteria 796
138 Ga0265316_10002151 3300031344 Bacteria 20712
139 Ga0265316_10312328 3300031344 Bacteria 1143
140 Ga0265316_10598107 3300031344 Unclassified 782
141 Ga0265316_11179092 3300031344 Unclassified 530
142 Ga0265313_10139349 3300031595 Bacteria 1044
143 Ga0265313_10140560 3300031595 Bacteria 1038
144 Ga0265313_10423657 3300031595 Bacteria 520
145 Ga0265314_10076650 3300031711 Bacteria 2221
146 Ga0265342_10220629 3300031712 Bacteria 1022
147 Ga0373944_0231971 3300035089 Bacteria 677
148 Ga0373923_0102606 3300035111 Bacteria 1263
149 Ga0373953_0086860 3300035117 Bacteria 1306
150 Ga0373953_0204685 3300035117 Unclassified 854
151 Ga0373954_0072626 3300035118 Bacteria 1636
152 Ga0373956_0139332 3300035119 Bacteria 1138
153 Ga0373956_0601892 3300035119 Unclassified 525
154 Ga0373957_0035409 3300035120 Bacteria 1855
155 Ga0373943_0349702 3300035170 Bacteria 847
156 Ga0373946_0183341 3300035171 Bacteria 995
157 Ga0373946_0317306 3300035171 Bacteria 774
158 Ga0373955_0014251 3300035172 Bacteria 3863
159 Ga0373955_0083541 3300035172 Bacteria 1809
160 Ga0373942_0048991 3300035207 Bacteria 1179
161 Ga0373924_0479126 3300035410 Unclassified 559
162 Ga0373935_0086711 3300035692 Bacteria 2043
163 Ga0373935_0149670 3300035692 Bacteria 1583
164 Ga0373935_0354363 3300035692 Bacteria 1047
165 Ga0373927_0120340 3300035695 Bacteria 1713
166 Ga0373933_0055480 3300035724 Bacteria 2377
167 Ga0373933_0866978 3300035724 Unclassified 594
168 Ga0373947_0042576 3300035725 Bacteria 2711
169 Ga0373947_0321157 3300035725 Bacteria 1035
170 Ga0373937_0079386 3300036401 Bacteria 3033
171 Ga0373937_0125690 3300036401 Bacteria 2392
172 Ga0373937_0275510 3300036401 Bacteria 1588
173 Ga0373937_0433990 3300036401 Unclassified 1247
174 Ga0373937_0721859 3300036401 Bacteria 943
175 Ga0373937_0743238 3300036401 Unclassified 928
176 Ga0373937_0973615 3300036401 Bacteria 797
177 Ga0373937_1128135 3300036401 Unclassified 733
178 Ga0373925_0043517 3300037068 Bacteria 3333
179 Ga0373925_0330596 3300037068 Bacteria 1235
180 Ga0436364_0108139 3300037853 Unclassified 1059
181 Ga0436364_0280787 3300037853 Bacteria 4554
182 Ga0436365_0295934 3300039437 Bacteria 3899
183 Ga0436360_1262099 3300039438 Unclassified 600
184 Ga0436361_0161927 3300039447 Unclassified 688
185 Ga0436361_0262116 3300039447 Bacteria 1224
186 Ga0436363_0752588 3300039450 Bacteria 2014
187 Ga0436362_0426796 3300039453 Plasmid 3955
188 Ga0436362_1023178 3300039453 Unclassified 531
189 Ga0451577_0745131 3300042876 Unclassified 886
190 Ga0466966_0035627 3300044684 Bacteria 3214
191 Ga0453684_0214322 3300044712 Bacteria 2236
192 Ga0453684_0787828 3300044712 Unclassified 1026
193 Ga0466957_0332120 3300044842 Bacteria 1028
194 Ga0466959_0249209 3300045049 Bacteria 1225
195 Ga0466959_0549145 3300045049 Bacteria 779
196 Ga0451576_1881987 3300045051 Unclassified 618
197 Ga0466958_0623848 3300045836 Bacteria 701
198 Ga0495651_0176139 3300046462 Bacteria 1518
199 Ga0495651_0688913 3300046462 Unclassified 638
200 Ga0495580_0014214 3300046472 Bacteria 6044
201 Ga0495580_0019372 3300046472 Bacteria 5056
202 Ga0495580_0914066 3300046472 Unclassified 563
203 Ga0495582_0427062 3300046473 Bacteria 765
204 Ga0495639_0452253 3300046475 Unclassified 652
205 Ga0495583_0401799 3300046506 Unclassified 538
206 Ga0495608_0321012 3300046511 Bacteria 957
207 Ga0495618_0904261 3300046514 Bacteria 509
208 Ga0495628_1152376 3300046516 Bacteria 528
209 Ga0495665_0135704 3300046531 Bacteria 1287
210 Ga0495645_0186306 3300046543 Bacteria 1418
211 Ga0495667_0296840 3300046559 Bacteria 1024
212 Ga0495634_0164334 3300046642 Bacteria 1398
213 Ga0495635_0292535 3300046663 Bacteria 1093
214 Ga0495657_0803160 3300046675 Unclassified 538
215 Ga0495599_0450844 3300046678 Bacteria 762
216 Ga0495599_0616229 3300046678 Unclassified 631
217 Ga0495599_0705602 3300046678 Bacteria 581
218 Ga0495658_0355758 3300046683 Bacteria 931
219 Ga0495613_0332413 3300046689 Bacteria 1047
220 Ga0495613_0734590 3300046689 Bacteria 648
221 Ga0495613_0747891 3300046689 Bacteria 641
222 Ga0495674_0262280 3300047319 Bacteria 1419
223 Ga0495674_0267147 3300047319 Bacteria 1404
224 Ga0495675_0359551 3300047444 Unclassified 855
225 Ga0495684_0497831 3300047471 Bacteria 838
226 Ga0495684_0868597 3300047471 Bacteria 584
227 Ga0495601_0076811 3300053077 Bacteria 2139
228 Ga0495612_0513744 3300053078 Unclassified 550
229 Ga0495595_0085902 3300053084 Bacteria 1505
230 Ga0495619_0197167 3300053085 Bacteria 1394
231 Ga0495619_0236458 3300053085 Bacteria 1266
232 Ga0500559_0081987 3300053136 Bacteria 1467
233 Ga0500616_0333331 3300053153 Unclassified 621
234 Ga0501084_1377551 3300054114 Bacteria 591
235 Ga0501082_1383212 3300060353 Unclassified 615
236 Ga0501082_1521300 3300060353 Unclassified 584
237 2523106594 2522572158 Bacteria 6514390
238 Ga0466961_0207600
239 Ga0070658_10418290
240 Ga0070683_102134545
241 Ga0068869_100574966
242 Ga0070689_101169853
243 Ga0070671_100516022
244 Ga0070673_102277844
245 Ga0070667_100371375
246 Ga0070708_100746142
247 Ga0070681_10029901
248 Ga0070681_10209182
249 Ga0070681_10480019
250 Ga0068867_100808898
251 Ga0070706_100482204
252 Ga0070707_100004656
253 Ga0070707_101148424
254 Ga0070698_100147762
255 Ga0070699_101314152
256 Ga0070679_100000958
257 Ga0070679_100076509
258 Ga0070679_100252197
259 Ga0070679_101056174
260 Ga0070684_100448704
261 Ga0070684_100803686
262 Ga0070697_100444567
263 Ga0070686_100946216
264 Ga0070693_101437113
265 Ga0068855_100006076
266 Ga0068855_100287881
267 Ga0068855_100519366
268 Ga0068855_102541469
269 Ga0070664_100165925
270 Ga0068857_100906319
271 Ga0068856_100039175
272 Ga0068852_100994789
273 Ga0068859_100690014
274 Ga0068864_100053365
275 Ga0068864_101219087
276 Ga0068864_101613182
277 Ga0068866_10799659
278 Ga0068863_100022339
279 Ga0068863_100723165
280 Ga0068863_102009567
281 Ga0068858_100232520
282 Ga0068858_100862137
283 Ga0068860_100138083
284 Ga0070717_10035109
285 Ga0070717_10586414
286 Ga0075436_100892936
287 Ga0097620_100690065
288 Ga0105240_10012392
289 Ga0105240_12185745
290 Ga0105245_10226681
291 Ga0105245_10300104
292 Ga0105245_10409379
293 Ga0105247_10573866
294 Ga0105241_10006723
295 Ga0105241_11511083
296 Ga0105242_10162673
297 Ga0105242_10191984
298 Ga0105242_10791048
299 Ga0105248_10149393
300 Ga0105248_10259888
301 Ga0105248_10478044
302 Ga0105248_11714103
303 Ga0105248_12087220
304 Ga0105248_13112831
305 Ga0105237_10020965
306 Ga0105238_10005860
307 Ga0105249_10003515
308 Ga0099796_10558291
309 Ga0105239_10017817
310 Ga0157373_11235886
311 Ga0157370_10012678
312 Ga0157370_10363652
313 Ga0157370_10514718
314 Ga0157370_10876255
315 Ga0157369_12484341
316 Ga0157378_10037455
317 Ga0157378_10091760
318 Ga0157378_10795752
319 Ga0157375_10006348
320 Ga0157375_11758280
321 Ga0157375_12168113
322 Ga0163163_10056367
323 Ga0163163_10435021
324 Ga0157376_10200947
325 Ga0157376_10272796
326 Ga0157376_10418830
327 Ga0157376_11506800
328 Ga0213876_10161228
329 Ga0228598_1017994
330 Ga0207692_10004896
331 Ga0207684_10062216
332 Ga0207654_10007066
333 Ga0207707_10005022
334 Ga0207707_11551262
335 Ga0207695_10053416
336 Ga0207695_10377576
337 Ga0207671_10520202
338 Ga0207660_10028342
339 Ga0207652_10002262
340 Ga0207652_10050191
341 Ga0207652_10243854
342 Ga0207646_10414411
343 Ga0207646_11375998
344 Ga0207694_10623987
345 Ga0207687_11751080
346 Ga0207644_10176685
347 Ga0207686_10218454
348 Ga0207670_11061835
349 Ga0207665_10627010
350 Ga0207711_10451020
351 Ga0207661_10147102
352 Ga0207679_10836882
353 Ga0207667_10015873
354 Ga0207667_10135026
355 Ga0207667_10434783
356 Ga0207712_10097964
357 Ga0207658_10762034
358 Ga0207703_10512550
359 Ga0207703_10621500
360 Ga0207702_10937572
361 Ga0207641_10030682
362 Ga0207676_10035136
363 Ga0207676_11504738
364 Ga0207674_10013684
365 Ga0207698_11093456
366 Ga0268264_10439719
367 Ga0265319_1146373
368 Ga0265338_10167971
369 Ga0265762_1099540
370 Ga0265325_10010208
371 Ga0265325_10029890
372 Ga0265325_10210575
373 Ga0265325_10430299
374 Ga0265339_10282121
375 Ga0265316_10002151
376 Ga0265316_10312328
377 Ga0265316_10598107
378 Ga0265316_11179092
379 Ga0265313_10139349
380 Ga0265313_10140560
381 Ga0265313_10423657
382 Ga0265314_10076650
383 Ga0265342_10220629
384 Ga0373944_0231971
385 Ga0373923_0102606
386 Ga0373953_0086860
387 Ga0373953_0204685
388 Ga0373954_0072626
389 Ga0373956_0139332
390 Ga0373956_0601892
391 Ga0373957_0035409
392 Ga0373943_0349702
393 Ga0373946_0183341
394 Ga0373946_0317306
395 Ga0373955_0014251
396 Ga0373955_0083541
397 Ga0373942_0048991
398 Ga0373924_0479126
399 Ga0373935_0086711
400 Ga0373935_0149670
401 Ga0373935_0354363
402 Ga0373927_0120340
403 Ga0373933_0055480
404 Ga0373933_0866978
405 Ga0373947_0042576
406 Ga0373947_0321157
407 Ga0373937_0079386
408 Ga0373937_0125690
409 Ga0373937_0275510
410 Ga0373937_0433990
411 Ga0373937_0721859
412 Ga0373937_0743238
413 Ga0373937_0973615
414 Ga0373937_1128135
415 Ga0373925_0043517
416 Ga0373925_0330596
417 Ga0436364_0108139
418 Ga0436364_0280787
419 Ga0436365_0295934
420 Ga0436360_1262099
421 Ga0436361_0161927
422 Ga0436361_0262116
423 Ga0436363_0752588
424 Ga0436362_0426796
425 Ga0436362_1023178
426 Ga0451577_0745131
427 Ga0466966_0035627
428 Ga0453684_0214322
429 Ga0453684_0787828
430 Ga0466957_0332120
431 Ga0466959_0249209
432 Ga0466959_0549145
433 Ga0451576_1881987
434 Ga0466958_0623848
435 Ga0495651_0176139
436 Ga0495651_0688913
437 Ga0495580_0014214
438 Ga0495580_0019372
439 Ga0495580_0914066
440 Ga0495582_0427062
441 Ga0495639_0452253
442 Ga0495583_0401799
443 Ga0495608_0321012
444 Ga0495618_0904261
445 Ga0495628_1152376
446 Ga0495665_0135704
447 Ga0495645_0186306
448 Ga0495667_0296840
449 Ga0495634_0164334
450 Ga0495635_0292535
451 Ga0495657_0803160
452 Ga0495599_0450844
453 Ga0495599_0616229
454 Ga0495599_0705602
455 Ga0495658_0355758
456 Ga0495613_0332413
457 Ga0495613_0734590
458 Ga0495613_0747891
459 Ga0495674_0262280
460 Ga0495674_0267147
461 Ga0495675_0359551
462 Ga0495684_0497831
463 Ga0495684_0868597
464 Ga0495601_0076811
465 Ga0495612_0513744
466 Ga0495595_0085902
467 Ga0495619_0197167
468 Ga0495619_0236458
469 Ga0500559_0081987
470 Ga0500616_0333331
471 Ga0501084_1377551
472 Ga0501082_1383212
473 Ga0501082_1521300
474 2523106594

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02452

PemK_toxin

PemK-like, MazF-like toxin of type II toxin-antitoxin system

2

107

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d2n-assembly1.cif.gz_D crystal structure of maze-mazf (form-iii) from deinococcus radiodurans 0.8181 16 102
7d2p-assembly1.cif.gz_D crystal structure of maze-mazf (form-ii) from deinococcus radiodurans 0.8173 16 102
7d2p-assembly1.cif.gz_C crystal structure of maze-mazf (form-ii) from deinococcus radiodurans 0.8146 16 102
7d2q-assembly1.cif.gz_E crystal structure of maze-mazf (form-i) from deinococcus radiodurans 0.8096 14 102
7bye-assembly1.cif.gz_C toxin-antitoxin complex from klebsiella pneumoniae 0.8012 16 103
ID Description Score Start End Superfamily
af_P9WII5_1_103_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.7693 10 102 2.30.30.110
1m1fB00 Mainly Beta;Roll;SH3 type barrels.; 0.7618 2 103 2.30.30.110
af_P95272_7_108_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.7553 10 102 2.30.30.110
af_P33647_7_115_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.7296 2 101 2.30.30.110
5cqyB00 Mainly Beta;Roll;SH3 type barrels.; 0.7214 15 101 2.30.30.110
ID Description Score Start End GO Terms
AF-A0A7Y8UTW0-F1-model_v4 Type II toxin-antitoxin system PemK/MazF family toxin 0.9886 52 103 GO:0003677
AF-A0A836ZRU9-F1-model_v4 Pemk protein 0.9805 46 103 GO:0003677
AF-A0A7Y8UTW0-F1-model_v4 Type II toxin-antitoxin system PemK/MazF family toxin 0.9703 52 103 GO:0003677
AF-A0A4R4K328-F1-model_v4 Toxin ChpB 0.9577 34 103 GO:0003677
AF-A0A258L9B8-F1-model_v4 Growth inhibitor PemK 0.9575 32 103 GO:0003677

Map