F350188

General Info

Members Datasets Scaffolds Average Seq Length
237 158 474 277

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0000001|Ga0373925_0000001_51045_51998
Length 317
Sequence MTWAKMDPDHVPPEIDTTRPSVARVYDAILGGKDNFAVDRAVAAAAVKTMGDDGNGARLNRAALGRAVRYMVSQGVTQFLDLGSGLPTVQNTHQIAQTINPAARVVYVDNDPSVYLHGQALLADDASTTVILADITTPDQLLAMKEVNGFLDFGKPVGLIMNAVIHHVLDEEDPYGIVDRYKRALAPGSYLQLTHFCDESPEVRANVAVLKRSLGRGQVRSREEITRFFDGLDLVQPGVVFLPFWQPDTLPNAAEPGSMLMLCGVARKALRGQSPVPASTFMTGACLDLYDENGLPTGHPLRFAPSAVLHQHIFPTT

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
84 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
85 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
86 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
87 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
88 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
89 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
90 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
91 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
92 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
93 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
94 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
96 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
102 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
103 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
106 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
107 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
143 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
144 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
147 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
148 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
149 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
150 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
153 2773857933 Frankia sp. BMG5.30 Isolate Nodule
154 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
155 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
156 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
157 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
158 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.41
Metatranscriptomes 4.22
Isolates 3.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.11
Nodule 0.42
Rhizoplane 2.11
Rhizosphere 78.9
Stem 0
Stem Tuber 0
Unclassified 0.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0000001 3300037068 Bacteria 402692
2 JGI25406J46586_10004478 3300003203 Bacteria 6505
3 rootH1_10072317 3300003316 Bacteria 1338
4 Ga0070658_10234792 3300005327 Bacteria 1553
5 Ga0070683_100050228 3300005329 Bacteria 3859
6 Ga0070683_100176753 3300005329 Bacteria 2027
7 Ga0070682_100076526 3300005337 Bacteria 2154
8 Ga0070682_100153368 3300005337 Bacteria 1583
9 Ga0070660_100135509 3300005339 Bacteria 1973
10 Ga0070692_10169775 3300005345 Bacteria 1256
11 Ga0070709_10032545 3300005434 Bacteria 3145
12 Ga0070714_100004585 3300005435 Bacteria 10422
13 Ga0070714_100004738 3300005435 Bacteria 10295
14 Ga0070714_100174012 3300005435 Bacteria 1955
15 Ga0070714_100248062 3300005435 Bacteria 1645
16 Ga0070714_100381583 3300005435 Bacteria 1329
17 Ga0070714_100573652 3300005435 Bacteria 1082
18 Ga0070713_100142179 3300005436 Bacteria 2126
19 Ga0070713_100225495 3300005436 Bacteria 1701
20 Ga0070713_100292450 3300005436 Bacteria 1497
21 Ga0070713_100492381 3300005436 Bacteria 1156
22 Ga0070708_100028103 3300005445 Bacteria 4836
23 Ga0070663_100001724 3300005455 Bacteria 12129
24 Ga0070663_100038879 3300005455 Bacteria 3322
25 Ga0070663_100123607 3300005455 Bacteria 1957
26 Ga0070663_100328641 3300005455 Bacteria 1232
27 Ga0070678_100216669 3300005456 Bacteria 1589
28 Ga0070706_100117545 3300005467 Bacteria 2477
29 Ga0070706_100315654 3300005467 Bacteria 1458
30 Ga0070707_100092383 3300005468 Bacteria 2930
31 Ga0070698_100008408 3300005471 Bacteria 11155
32 Ga0070698_100027462 3300005471 Bacteria 5919
33 Ga0070679_100078654 3300005530 Bacteria 3286
34 Ga0070679_100092173 3300005530 Bacteria 3018
35 Ga0070679_100249494 3300005530 Bacteria 1731
36 Ga0070684_100008282 3300005535 Bacteria 8122
37 Ga0070665_100027362 3300005548 Bacteria 5744
38 Ga0068855_100008783 3300005563 Bacteria 12213
39 Ga0068857_100143105 3300005577 Bacteria 2162
40 Ga0068854_100001139 3300005578 Bacteria 15971
41 Ga0068856_100220927 3300005614 Bacteria 1910
42 Ga0068852_100011825 3300005616 Bacteria 6594
43 Ga0068864_100218268 3300005618 Bacteria 1759
44 Ga0068863_100005772 3300005841 Bacteria 12135
45 Ga0068858_100130456 3300005842 Bacteria 2356
46 Ga0068860_100071057 3300005843 Bacteria 3308
47 Ga0081539_10000562 3300005985 Bacteria 76587
48 Ga0081539_10034338 3300005985 Bacteria 3069
49 Ga0070717_10070285 3300006028 Bacteria 2917
50 Ga0070717_10171618 3300006028 Bacteria 1886
51 Ga0070715_10007413 3300006163 Bacteria 3776
52 Ga0070716_100011416 3300006173 Bacteria 4471
53 Ga0070712_100058070 3300006175 Bacteria 2721
54 Ga0075431_100238787 3300006847 Bacteria 1849
55 Ga0105240_10032932 3300009093 Bacteria 6702
56 Ga0105247_10176532 3300009101 Bacteria 1423
57 Ga0105241_10009089 3300009174 Bacteria 7312
58 Ga0105241_10361480 3300009174 Bacteria 1263
59 Ga0105237_10014834 3300009545 Bacteria 8132
60 Ga0105237_10591196 3300009545 Bacteria 1117
61 Ga0105238_10010265 3300009551 Bacteria 9393
62 Ga0105239_10110801 3300010375 Bacteria 3042
63 Ga0157370_10019153 3300013104 Bacteria 6880
64 Ga0157370_10062107 3300013104 Bacteria 3544
65 Ga0157369_10006964 3300013105 Bacteria 13039
66 Ga0157369_10014010 3300013105 Bacteria 9058
67 Ga0157369_10069176 3300013105 Bacteria 3793
68 Ga0157369_10081810 3300013105 Bacteria 3455
69 Ga0157369_10465256 3300013105 Bacteria 1309
70 Ga0157369_10526538 3300013105 Bacteria 1222
71 Ga0163163_10096749 3300014325 Bacteria 2973
72 Ga0157376_10313063 3300014969 Bacteria 1490
73 Ga0197907_10260890 3300020069 Bacteria 2365
74 Ga0206356_11189115 3300020070 Bacteria 1364
75 Ga0206351_10069670 3300020077 Bacteria 1013
76 Ga0206352_10159098 3300020078 Bacteria 1324
77 Ga0206354_10254905 3300020081 Bacteria 1688
78 Ga0206353_11790265 3300020082 Bacteria 2286
79 Ga0213875_10000422 3300021388 Bacteria 37067
80 Ga0213875_10001450 3300021388 Bacteria 15365
81 Ga0213875_10096362 3300021388 Bacteria 1380
82 Ga0224712_10004950 3300022467 Bacteria 3657
83 Ga0224712_10005728 3300022467 Bacteria 3491
84 Ga0207647_10004605 3300025904 Bacteria 10215
85 Ga0207699_10018096 3300025906 Bacteria 3727
86 Ga0207699_10193297 3300025906 Bacteria 1374
87 Ga0207705_10497331 3300025909 Bacteria 947
88 Ga0207684_10383329 3300025910 Bacteria 1209
89 Ga0207654_10005717 3300025911 Bacteria 6282
90 Ga0207707_10254796 3300025912 Bacteria 1524
91 Ga0207695_10001346 3300025913 Bacteria 41625
92 Ga0207671_10000269 3300025914 Bacteria 77455
93 Ga0207693_10182769 3300025915 Bacteria 1650
94 Ga0207693_10236116 3300025915 Bacteria 1435
95 Ga0207660_10117251 3300025917 Bacteria 2012
96 Ga0207657_10092307 3300025919 Bacteria 2524
97 Ga0207652_10060862 3300025921 Bacteria 3259
98 Ga0207652_10272486 3300025921 Bacteria 1527
99 Ga0207646_10047853 3300025922 Bacteria 3834
100 Ga0207694_10009230 3300025924 Bacteria 7442
101 Ga0207700_10121391 3300025928 Bacteria 2120
102 Ga0207700_10208165 3300025928 Bacteria 1652
103 Ga0207700_10281507 3300025928 Bacteria 1431
104 Ga0207664_10019722 3300025929 Bacteria 4989
105 Ga0207664_10027740 3300025929 Bacteria 4297
106 Ga0207664_10028315 3300025929 Bacteria 4257
107 Ga0207664_10060933 3300025929 Bacteria 3009
108 Ga0207664_10149846 3300025929 Bacteria 1981
109 Ga0207664_10208027 3300025929 Bacteria 1692
110 Ga0207665_10002783 3300025939 Bacteria 11721
111 Ga0207661_10334421 3300025944 Bacteria 1364
112 Ga0207667_10446202 3300025949 Bacteria 1315
113 Ga0207640_10004080 3300025981 Bacteria 7893
114 Ga0207703_10542343 3300026035 Bacteria 1096
115 Ga0207639_10045931 3300026041 Bacteria 3293
116 Ga0207678_10011071 3300026067 Bacteria 7926
117 Ga0207678_10025373 3300026067 Bacteria 5174
118 Ga0207678_10047796 3300026067 Bacteria 3700
119 Ga0207678_10115299 3300026067 Bacteria 2292
120 Ga0207702_10071126 3300026078 Bacteria 2995
121 Ga0207702_10246316 3300026078 Bacteria 1676
122 Ga0207676_10114243 3300026095 Bacteria 2265
123 Ga0207674_10031358 3300026116 Bacteria 5585
124 Ga0207674_10037666 3300026116 Bacteria 5027
125 Ga0207674_10368726 3300026116 Bacteria 1388
126 Ga0268266_10033441 3300028379 Bacteria 4371
127 Ga0268266_10053464 3300028379 Bacteria 3470
128 Ga0268266_10474258 3300028379 Bacteria 1192
129 Ga0307515_10000027 3300028794 Bacteria 371624
130 Ga0307515_10008427 3300028794 Bacteria 20101
131 Ga0307515_10021670 3300028794 Bacteria 11375
132 Ga0265338_10010338 3300028800 Bacteria 10960
133 Ga0265338_10018500 3300028800 Bacteria 7456
134 Ga0307513_10022686 3300031456 Bacteria 7365
135 Ga0307513_10096037 3300031456 Bacteria 3003
136 Ga0307509_10139447 3300031507 Bacteria 2364
137 Ga0307508_10085240 3300031616 Bacteria 2742
138 Ga0307508_10143359 3300031616 Bacteria 1993
139 Ga0307508_10193352 3300031616 Bacteria 1636
140 Ga0316579_10007702 3300031691 Bacteria 4459
141 Ga0316579_10016138 3300031691 Bacteria 3256
142 Ga0307516_10000811 3300031730 Bacteria 42822
143 Ga0307516_10000875 3300031730 Bacteria 41380
144 Ga0307516_10012021 3300031730 Bacteria 9359
145 Ga0307516_10018038 3300031730 Bacteria 7342
146 Ga0307516_10038302 3300031730 Bacteria 4785
147 Ga0307516_10182620 3300031730 Bacteria 1830
148 Ga0307507_10015427 3300033179 Bacteria 8987
149 Ga0307507_10031823 3300033179 Bacteria 5526
150 Ga0316214_1000625 3300033545 Bacteria 3705
151 Ga0316214_1003618 3300033545 Bacteria 1957
152 Ga0373948_0045525 3300034817 Bacteria 930
153 Ga0373934_0135196 3300035086 Bacteria 1007
154 Ga0373944_0003344 3300035089 Bacteria 4132
155 Ga0373951_0000039 3300035091 Bacteria 51245
156 Ga0373923_0046005 3300035111 Bacteria 1814
157 Ga0373957_0163584 3300035120 Bacteria 917
158 Ga0373962_0001712 3300035242 Bacteria 5211
159 Ga0373937_0029623 3300036401 Bacteria 4958
160 Ga0372808_009458 3300036459 Bacteria 1362
161 Ga0372808_009592 3300036459 Bacteria 1354
162 Ga0395898_0105208 3300037466 Bacteria 2706
163 Ga0436364_0034450 3300037853 Bacteria 166663
164 Ga0436364_0330534 3300037853 Bacteria 2916
165 Ga0436364_0742769 3300037853 Bacteria 4424
166 Ga0400485_14323 3300038735 Bacteria 58881
167 Ga0400488_16401 3300038741 Unclassified 1671
168 Ga0400486_06112 3300038742 Bacteria 40039
169 Ga0436365_1886314 3300039437 Bacteria 3111
170 Ga0451791_0610425 3300041451 Bacteria 1852
171 Ga0451853_2464758 3300041512 Bacteria 3425
172 Ga0466969_0037146 3300044656 Bacteria 2458
173 Ga0466961_0012884 3300044693 Bacteria 5350
174 Ga0466963_0159436 3300044694 Bacteria 1570
175 Ga0466970_0163242 3300044765 Bacteria 1232
176 Ga0466957_0357189 3300044842 Bacteria 992
177 Ga0466959_0103491 3300045049 Bacteria 2037
178 Ga0466958_0229844 3300045836 Bacteria 1184
179 Ga0466967_0165661 3300045976 Bacteria 2077
180 Ga0466967_0305280 3300045976 Bacteria 1532
181 Ga0466967_0404466 3300045976 Bacteria 1329
182 Ga0466967_0525172 3300045976 Bacteria 1163
183 Ga0495592_0023041 3300046454 Bacteria 4737
184 Ga0495651_0007549 3300046462 Bacteria 8318
185 Ga0495664_0195688 3300046477 Bacteria 1225
186 Ga0495608_0087319 3300046511 Bacteria 2020
187 Ga0495628_0047065 3300046516 Bacteria 3424
188 Ga0495628_0048024 3300046516 Bacteria 3384
189 Ga0495632_0047688 3300046519 Bacteria 2124
190 Ga0495652_0004169 3300046529 Bacteria 13929
191 Ga0495652_0217030 3300046529 Bacteria 1439
192 Ga0495665_0178623 3300046531 Bacteria 1104
193 Ga0495640_0196588 3300046533 Bacteria 1280
194 Ga0495587_0066250 3300046536 Bacteria 2107
195 Ga0495645_0007500 3300046543 Bacteria 7593
196 Ga0495645_0038174 3300046543 Bacteria 3503
197 Ga0495667_0028282 3300046559 Bacteria 3774
198 Ga0495599_0020574 3300046678 Bacteria 4110
199 Ga0495646_0028143 3300046680 Bacteria 3521
200 Ga0495613_0054166 3300046689 Bacteria 2950
201 Ga0495600_0004398 3300046809 Bacteria 8428
202 Ga0495604_0050267 3300047317 Bacteria 3237
203 Ga0495674_0332253 3300047319 Bacteria 1236
204 Ga0495680_0043216 3300047322 Bacteria 3569
205 Ga0496112_0004178 3300048915 Bacteria 12161
206 Ga0496112_0011017 3300048915 Bacteria 8240
207 Ga0496112_0782968 3300048915 Bacteria 879
208 Ga0496115_0062940 3300048918 Bacteria 2993
209 Ga0496126_0009200 3300048929 Bacteria 10537
210 Ga0496126_0055647 3300048929 Bacteria 3578
211 Ga0496126_0100695 3300048929 Bacteria 2528
212 Ga0501036_0002490 3300049572 Bacteria 14443
213 Ga0501039_0024463 3300049575 Bacteria 4639
214 Ga0501042_0003022 3300049578 Bacteria 10461
215 Ga0501043_0008874 3300049579 Bacteria 7911
216 Ga0501048_0005060 3300049582 Bacteria 10047
217 nmdc:mga0qj67_493177_c1 3300050509 Bacteria 985
218 Ga0495601_0007160 3300053077 Bacteria 6543
219 Ga0495601_0083842 3300053077 Bacteria 2047
220 Ga0495601_0099708 3300053077 Bacteria 1875
221 Ga0495612_0041648 3300053078 Bacteria 1873
222 Ga0495619_0153186 3300053085 Bacteria 1590
223 Ga0495619_0208786 3300053085 Bacteria 1352
224 Ga0500651_0189964 3300053093 Bacteria 1216
225 Ga0500650_0061858 3300053098 Bacteria 1749
226 Ga0500652_013087 3300053131 Bacteria 2929
227 Ga0500579_016372 3300053143 Bacteria 4787
228 Ga0500600_0093047 3300053149 Bacteria 1605
229 Ga0501084_0479859 3300054114 Bacteria 1051
230 2768645468 2767802112 Bacteria 6465194
231 2774904286 2773857933 Bacteria 5818019
232 2776373609 2775506925 Bacteria 7237746
233 2863074097 2863067949 Bacteria 8541735
234 2899366221 2899359706 Bacteria 10940472
235 2919713964 2919713450 Bacteria 7431245
236 8003318576 8003314358 Bacteria 10575343
237 8003318577 8003314358 Bacteria 10575343
238 Ga0373925_0000001
239 JGI25406J46586_10004478
240 rootH1_10072317
241 Ga0070658_10234792
242 Ga0070683_100050228
243 Ga0070683_100176753
244 Ga0070682_100076526
245 Ga0070682_100153368
246 Ga0070660_100135509
247 Ga0070692_10169775
248 Ga0070709_10032545
249 Ga0070714_100004585
250 Ga0070714_100004738
251 Ga0070714_100174012
252 Ga0070714_100248062
253 Ga0070714_100381583
254 Ga0070714_100573652
255 Ga0070713_100142179
256 Ga0070713_100225495
257 Ga0070713_100292450
258 Ga0070713_100492381
259 Ga0070708_100028103
260 Ga0070663_100001724
261 Ga0070663_100038879
262 Ga0070663_100123607
263 Ga0070663_100328641
264 Ga0070678_100216669
265 Ga0070706_100117545
266 Ga0070706_100315654
267 Ga0070707_100092383
268 Ga0070698_100008408
269 Ga0070698_100027462
270 Ga0070679_100078654
271 Ga0070679_100092173
272 Ga0070679_100249494
273 Ga0070684_100008282
274 Ga0070665_100027362
275 Ga0068855_100008783
276 Ga0068857_100143105
277 Ga0068854_100001139
278 Ga0068856_100220927
279 Ga0068852_100011825
280 Ga0068864_100218268
281 Ga0068863_100005772
282 Ga0068858_100130456
283 Ga0068860_100071057
284 Ga0081539_10000562
285 Ga0081539_10034338
286 Ga0070717_10070285
287 Ga0070717_10171618
288 Ga0070715_10007413
289 Ga0070716_100011416
290 Ga0070712_100058070
291 Ga0075431_100238787
292 Ga0105240_10032932
293 Ga0105247_10176532
294 Ga0105241_10009089
295 Ga0105241_10361480
296 Ga0105237_10014834
297 Ga0105237_10591196
298 Ga0105238_10010265
299 Ga0105239_10110801
300 Ga0157370_10019153
301 Ga0157370_10062107
302 Ga0157369_10006964
303 Ga0157369_10014010
304 Ga0157369_10069176
305 Ga0157369_10081810
306 Ga0157369_10465256
307 Ga0157369_10526538
308 Ga0163163_10096749
309 Ga0157376_10313063
310 Ga0197907_10260890
311 Ga0206356_11189115
312 Ga0206351_10069670
313 Ga0206352_10159098
314 Ga0206354_10254905
315 Ga0206353_11790265
316 Ga0213875_10000422
317 Ga0213875_10001450
318 Ga0213875_10096362
319 Ga0224712_10004950
320 Ga0224712_10005728
321 Ga0207647_10004605
322 Ga0207699_10018096
323 Ga0207699_10193297
324 Ga0207705_10497331
325 Ga0207684_10383329
326 Ga0207654_10005717
327 Ga0207707_10254796
328 Ga0207695_10001346
329 Ga0207671_10000269
330 Ga0207693_10182769
331 Ga0207693_10236116
332 Ga0207660_10117251
333 Ga0207657_10092307
334 Ga0207652_10060862
335 Ga0207652_10272486
336 Ga0207646_10047853
337 Ga0207694_10009230
338 Ga0207700_10121391
339 Ga0207700_10208165
340 Ga0207700_10281507
341 Ga0207664_10019722
342 Ga0207664_10027740
343 Ga0207664_10028315
344 Ga0207664_10060933
345 Ga0207664_10149846
346 Ga0207664_10208027
347 Ga0207665_10002783
348 Ga0207661_10334421
349 Ga0207667_10446202
350 Ga0207640_10004080
351 Ga0207703_10542343
352 Ga0207639_10045931
353 Ga0207678_10011071
354 Ga0207678_10025373
355 Ga0207678_10047796
356 Ga0207678_10115299
357 Ga0207702_10071126
358 Ga0207702_10246316
359 Ga0207676_10114243
360 Ga0207674_10031358
361 Ga0207674_10037666
362 Ga0207674_10368726
363 Ga0268266_10033441
364 Ga0268266_10053464
365 Ga0268266_10474258
366 Ga0307515_10000027
367 Ga0307515_10008427
368 Ga0307515_10021670
369 Ga0265338_10010338
370 Ga0265338_10018500
371 Ga0307513_10022686
372 Ga0307513_10096037
373 Ga0307509_10139447
374 Ga0307508_10085240
375 Ga0307508_10143359
376 Ga0307508_10193352
377 Ga0316579_10007702
378 Ga0316579_10016138
379 Ga0307516_10000811
380 Ga0307516_10000875
381 Ga0307516_10012021
382 Ga0307516_10018038
383 Ga0307516_10038302
384 Ga0307516_10182620
385 Ga0307507_10015427
386 Ga0307507_10031823
387 Ga0316214_1000625
388 Ga0316214_1003618
389 Ga0373948_0045525
390 Ga0373934_0135196
391 Ga0373944_0003344
392 Ga0373951_0000039
393 Ga0373923_0046005
394 Ga0373957_0163584
395 Ga0373962_0001712
396 Ga0373937_0029623
397 Ga0372808_009458
398 Ga0372808_009592
399 Ga0395898_0105208
400 Ga0436364_0034450
401 Ga0436364_0330534
402 Ga0436364_0742769
403 Ga0400485_14323
404 Ga0400488_16401
405 Ga0400486_06112
406 Ga0436365_1886314
407 Ga0451791_0610425
408 Ga0451853_2464758
409 Ga0466969_0037146
410 Ga0466961_0012884
411 Ga0466963_0159436
412 Ga0466970_0163242
413 Ga0466957_0357189
414 Ga0466959_0103491
415 Ga0466958_0229844
416 Ga0466967_0165661
417 Ga0466967_0305280
418 Ga0466967_0404466
419 Ga0466967_0525172
420 Ga0495592_0023041
421 Ga0495651_0007549
422 Ga0495664_0195688
423 Ga0495608_0087319
424 Ga0495628_0047065
425 Ga0495628_0048024
426 Ga0495632_0047688
427 Ga0495652_0004169
428 Ga0495652_0217030
429 Ga0495665_0178623
430 Ga0495640_0196588
431 Ga0495587_0066250
432 Ga0495645_0007500
433 Ga0495645_0038174
434 Ga0495667_0028282
435 Ga0495599_0020574
436 Ga0495646_0028143
437 Ga0495613_0054166
438 Ga0495600_0004398
439 Ga0495604_0050267
440 Ga0495674_0332253
441 Ga0495680_0043216
442 Ga0496112_0004178
443 Ga0496112_0011017
444 Ga0496112_0782968
445 Ga0496115_0062940
446 Ga0496126_0009200
447 Ga0496126_0055647
448 Ga0496126_0100695
449 Ga0501036_0002490
450 Ga0501039_0024463
451 Ga0501042_0003022
452 Ga0501043_0008874
453 Ga0501048_0005060
454 nmdc:mga0qj67_493177_c1
455 Ga0495601_0007160
456 Ga0495601_0083842
457 Ga0495601_0099708
458 Ga0495612_0041648
459 Ga0495619_0153186
460 Ga0495619_0208786
461 Ga0500651_0189964
462 Ga0500650_0061858
463 Ga0500652_013087
464 Ga0500579_016372
465 Ga0500600_0093047
466 Ga0501084_0479859
467 2768645468
468 2774904286
469 2776373609
470 2863074097
471 2899366221
472 2919713964
473 8003318576
474 8003318577

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04672

Methyltransf_19

S-adenosyl methyltransferase

8

269

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3go4-assembly1.cif.gz_A crystal structure of a duf574 family protein (sav_2177) from streptomyces avermitilis ma-4680 at 1.80 a resolution 0.9418 23 279
2qe6-assembly1.cif.gz_A crystal structure of a putative methyltransferase (tfu_2867) from thermobifida fusca yx at 1.95 a resolution 0.9403 16 278
2qe6-assembly1.cif.gz_A crystal structure of a putative methyltransferase (tfu_2867) from thermobifida fusca yx at 1.95 a resolution 0.9266 16 278
3go4-assembly1.cif.gz_A crystal structure of a duf574 family protein (sav_2177) from streptomyces avermitilis ma-4680 at 1.80 a resolution 0.9209 23 279
3ujd-assembly1.cif.gz_A phosphoethanolamine methyltransferase mutant (y19f) from plasmodium falciparum in complex with phosphocholine 0.7554 73 247
ID Description Score Start End Superfamily
2qe6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9319 13 278 3.40.50.150
2qe6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9214 13 278 3.40.50.150
3go4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8888 23 279 3.40.50.150
3go4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8789 23 279 3.40.50.150
1tw2B03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7493 67 278 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6N9Y581-F1-model_v4 deleted 0.9844 67 159
AF-A0A6N9XY79-F1-model_v4 deleted 0.9839 67 158
AF-A0A7Y5XI41-F1-model_v4 deleted 0.9679 12 279
AF-A0A5S4G149-F1-model_v4 SAM-dependent methyltransferase 0.9652 58 253
AF-A0A6L9Q6L1-F1-model_v4 SAM-dependent methyltransferase 0.9633 16 179 GO:0008168
GO:0032259

Map