F350183

General Info

Members Datasets Scaffolds Average Seq Length
237 181 474 274

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0533104|Ga0373937_0533104_53_1036
Length 327
Sequence LRNVCAARAPLDLNQRSVREQKQVDFFHTSQAQECAAGWQSRRTIGGNSEYDPRMPIVDAWIQHPTPSFLANPIFESLRRWMGMAEVPNEIPADFTLGALDAGGITHALVSAWWGPNGPLITNDEVASFVRIRPTKLLGVASVSIARPMAGVRELPRAVKQLGMRALRILPWLWNLPPNDRRFYPLYAECIELGIPFCLQVGHTGPMCPSEPGRPIPYLDEVALEFPELVVVAGHIGYPWTDEMIALATKYPNVYIDTSAYKPKRYPASLVDFMKGHGKKKVLFGSNFPMISPSDCLGQLAELKLDEETQRLFLAGNAMRVFQIGST

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
83 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
84 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
88 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
89 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
90 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
91 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
92 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
93 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
94 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
109 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
110 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
111 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
130 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
155 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
167 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
170 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
171 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
172 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
173 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
175 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
176 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
177 2791355199
178 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
179 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
180 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
181 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.46
Metatranscriptomes 0
Isolates 2.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.28
Nodule 1.27
Rhizoplane 5.91
Rhizosphere 78.06
Stem 0
Stem Tuber 0.42
Unclassified 2.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0533104 3300036401 Unclassified 1115
2 rootH1_10081840 3300003316 Bacteria 1481
3 rootL2_10087235 3300003322 Bacteria 2917
4 rootH1_10092221 3300003323 Bacteria 1106
5 JGI25160J50197_1002156 3300003354 Bacteria 9321
6 Ga0055530_10000018 3300003791 Bacteria 140936
7 Ga0055531_10000111 3300003794 Bacteria 89361
8 Ga0065165_1000806 3300005262 Bacteria 41749
9 Ga0065715_10288998 3300005293 Bacteria 1067
10 Ga0070683_100001569 3300005329 Bacteria 17662
11 Ga0070690_100139627 3300005330 Bacteria 1644
12 Ga0070667_100071522 3300005367 Bacteria 2954
13 Ga0070713_100075210 3300005436 Bacteria 2864
14 Ga0070705_100000003 3300005440 Bacteria 134946
15 Ga0070705_100265294 3300005440 Bacteria 1213
16 Ga0070708_100043338 3300005445 Bacteria 3954
17 Ga0070708_100049894 3300005445 Bacteria 3704
18 Ga0070708_100248789 3300005445 Bacteria 1670
19 Ga0070708_100454642 3300005445 Bacteria 1208
20 Ga0070678_100448366 3300005456 Bacteria 1130
21 Ga0070681_10141173 3300005458 Bacteria 2338
22 Ga0070706_100000820 3300005467 Bacteria 34294
23 Ga0070706_100324962 3300005467 Bacteria 1434
24 Ga0070707_100007319 3300005468 Bacteria 10249
25 Ga0070707_100132564 3300005468 Bacteria 2424
26 Ga0070698_100029912 3300005471 Bacteria 5652
27 Ga0070698_100059928 3300005471 Bacteria 3842
28 Ga0070699_100000018 3300005518 Bacteria 190128
29 Ga0070699_100150702 3300005518 Bacteria 2057
30 Ga0070699_100310233 3300005518 Bacteria 1416
31 Ga0070684_100016263 3300005535 Bacteria 6077
32 Ga0070697_100120957 3300005536 Bacteria 2190
33 Ga0070697_100280445 3300005536 Bacteria 1430
34 Ga0070697_100364294 3300005536 Bacteria 1250
35 Ga0070697_100424231 3300005536 Bacteria 1156
36 Ga0068853_100292399 3300005539 Bacteria 1504
37 Ga0070695_100081492 3300005545 Bacteria 2141
38 Ga0070696_100000011 3300005546 Bacteria 82210
39 Ga0070696_100002098 3300005546 Bacteria 13103
40 Ga0070693_100182847 3300005547 Bacteria 1351
41 Ga0068857_100386584 3300005577 Bacteria 1300
42 Ga0070702_100057140 3300005615 Bacteria 2256
43 Ga0068852_100248808 3300005616 Bacteria 1702
44 Ga0068863_100368811 3300005841 Bacteria 1401
45 Ga0081455_10000203 3300005937 Bacteria 75878
46 Ga0081540_1003356 3300005983 Bacteria 12690
47 Ga0070717_10005206 3300006028 Bacteria 9475
48 Ga0070717_10324770 3300006028 Bacteria 1372
49 Ga0075365_10046054 3300006038 Bacteria 2863
50 Ga0070715_10059145 3300006163 Bacteria 1675
51 Ga0075369_10171736 3300006186 Bacteria 996
52 Ga0075370_10162443 3300006353 Bacteria 1311
53 Ga0068871_100082509 3300006358 Bacteria 2666
54 Ga0075430_100002213 3300006846 Bacteria 16120
55 Ga0075431_100703459 3300006847 Bacteria 988
56 Ga0075429_100142858 3300006880 Bacteria 2095
57 Ga0068865_100108590 3300006881 Bacteria 2042
58 Ga0075436_100390947 3300006914 Bacteria 1007
59 Ga0105245_10618083 3300009098 Bacteria 1111
60 Ga0114129_10010114 3300009147 Bacteria 13448
61 Ga0114129_10590349 3300009147 Bacteria 1440
62 Ga0105248_10199653 3300009177 Bacteria 2253
63 Ga0105237_10204050 3300009545 Bacteria 1977
64 Ga0105249_10364830 3300009553 Bacteria 1467
65 Ga0105239_10088441 3300010375 Bacteria 3416
66 Ga0105239_10183334 3300010375 Bacteria 2342
67 Ga0105246_10102351 3300011119 Bacteria 2088
68 Ga0163162_10237996 3300013306 Bacteria 1951
69 Ga0163162_10250018 3300013306 Bacteria 1905
70 Ga0163162_10576074 3300013306 Bacteria 1253
71 Ga0157375_10672819 3300013308 Unclassified 1190
72 Ga0157379_10316093 3300014968 Bacteria 1425
73 Ga0157376_10140538 3300014969 Bacteria 2165
74 Ga0209676_1002279 3300025292 Bacteria 14034
75 Ga0209050_1000017 3300025298 Bacteria 728928
76 Ga0207426_1000379 3300025302 Bacteria 76587
77 Ga0209257_1000104 3300025304 Bacteria 245648
78 Ga0207696_1042185 3300025711 Bacteria 1330
79 Ga0207653_10000296 3300025885 Bacteria 28845
80 Ga0207685_10051227 3300025905 Unclassified 1594
81 Ga0207684_10001910 3300025910 Bacteria 21642
82 Ga0207684_10236833 3300025910 Bacteria 1575
83 Ga0207684_10265398 3300025910 Bacteria 1481
84 Ga0207684_10269019 3300025910 Bacteria 1470
85 Ga0207671_10163019 3300025914 Bacteria 1727
86 Ga0207693_10115073 3300025915 Bacteria 2111
87 Ga0207646_10023483 3300025922 Bacteria 5664
88 Ga0207646_10039116 3300025922 Bacteria 4268
89 Ga0207646_10061868 3300025922 Bacteria 3342
90 Ga0207646_10076723 3300025922 Bacteria 2987
91 Ga0207646_10209833 3300025922 Bacteria 1759
92 Ga0207687_10539022 3300025927 Bacteria 978
93 Ga0207700_10002045 3300025928 Bacteria 11544
94 Ga0207664_10202860 3300025929 Bacteria 1713
95 Ga0207686_10168840 3300025934 Bacteria 1541
96 Ga0207709_10237945 3300025935 Bacteria 1323
97 Ga0207711_10146628 3300025941 Bacteria 2127
98 Ga0207661_10039687 3300025944 Bacteria 3697
99 Ga0207679_10008554 3300025945 Bacteria 6521
100 Ga0207668_10047455 3300025972 Bacteria 2940
101 Ga0207668_10084798 3300025972 Bacteria 2309
102 Ga0207703_10671827 3300026035 Bacteria 984
103 Ga0207639_10236944 3300026041 Bacteria 1585
104 Ga0207674_10517365 3300026116 Bacteria 1153
105 Ga0207683_10152387 3300026121 Bacteria 2086
106 Ga0209813_10063800 3300027866 Bacteria 1182
107 Ga0268265_10029287 3300028380 Bacteria 3950
108 Ga0268265_10066535 3300028380 Bacteria 2786
109 Ga0307515_10000032 3300028794 Bacteria 358317
110 Ga0307509_10017179 3300031507 Bacteria 8336
111 Ga0307509_10269343 3300031507 Bacteria 1472
112 Ga0307508_10015809 3300031616 Bacteria 6877
113 Ga0307416_100104561 3300032002 Bacteria 2476
114 Ga0307415_100079250 3300032126 Bacteria 2339
115 Ga0307510_10050498 3300033180 Bacteria 4411
116 Ga0373952_0056919 3300035092 Bacteria 946
117 Ga0373956_0005518 3300035119 Bacteria 5065
118 Ga0373957_0045681 3300035120 Bacteria 1660
119 Ga0373957_0105196 3300035120 Bacteria 1133
120 Ga0373946_0090713 3300035171 Bacteria 1354
121 Ga0373955_0052263 3300035172 Bacteria 2228
122 Ga0316574_0002478 3300035398 Bacteria 9275
123 Ga0316574_0005772 3300035398 Bacteria 6637
124 Ga0316574_0087089 3300035398 Bacteria 1988
125 Ga0316574_0294734 3300035398 Bacteria 1032
126 Ga0373924_0048943 3300035410 Bacteria 1747
127 Ga0373931_0001430 3300035691 Bacteria 10240
128 Ga0373935_0004760 3300035692 Bacteria 7982
129 Ga0373927_0167931 3300035695 Bacteria 1438
130 Ga0373947_0083228 3300035725 Bacteria 1984
131 Ga0373947_0193204 3300035725 Bacteria 1329
132 Ga0373937_0484742 3300036401 Bacteria 1174
133 Ga0316584_0109403 3300036712 Bacteria 2068
134 Ga0395900_0360677 3300037418 Unclassified 1425
135 Ga0400483_112433 3300039062 Bacteria 6422
136 Ga0436361_1047115 3300039447 Bacteria 2536
137 Ga0453683_0224692 3300044673 Bacteria 1194
138 Ga0466958_0022735 3300045836 Bacteria 3676
139 Ga0466958_0155373 3300045836 Unclassified 1444
140 Ga0495592_0037823 3300046454 Bacteria 3631
141 Ga0495629_0042142 3300046459 Bacteria 3208
142 Ga0495651_0017258 3300046462 Bacteria 5591
143 Ga0495582_0055894 3300046473 Bacteria 2175
144 Ga0495639_0211324 3300046475 Bacteria 952
145 Ga0495662_0010886 3300046476 Bacteria 4449
146 Ga0495594_0069897 3300046499 Bacteria 1951
147 Ga0495608_0053537 3300046511 Bacteria 2670
148 Ga0495608_0219414 3300046511 Bacteria 1193
149 Ga0495618_0069956 3300046514 Bacteria 2231
150 Ga0495628_0053210 3300046516 Bacteria 3195
151 Ga0495630_0021324 3300046517 Bacteria 4783
152 Ga0495652_0100335 3300046529 Bacteria 2348
153 Ga0495652_0189730 3300046529 Bacteria 1569
154 Ga0495665_0165445 3300046531 Bacteria 1152
155 Ga0495640_0015672 3300046533 Bacteria 5693
156 Ga0495586_0186164 3300046535 Bacteria 1175
157 Ga0495587_0021976 3300046536 Bacteria 3932
158 Ga0495587_0077215 3300046536 Bacteria 1934
159 Ga0495645_0005484 3300046543 Bacteria 8714
160 Ga0495667_0029123 3300046559 Bacteria 3716
161 Ga0495667_0044010 3300046559 Bacteria 2956
162 Ga0495667_0237284 3300046559 Bacteria 1162
163 Ga0495634_0019687 3300046642 Bacteria 4792
164 Ga0495611_0035591 3300046648 Bacteria 2206
165 Ga0495625_0270059 3300046660 Bacteria 1098
166 Ga0495657_0102134 3300046675 Bacteria 1825
167 Ga0495623_0056576 3300046679 Bacteria 2468
168 Ga0495623_0212573 3300046679 Bacteria 1106
169 Ga0495646_0106733 3300046680 Bacteria 1598
170 Ga0495646_0167427 3300046680 Bacteria 1213
171 Ga0495647_0139999 3300046681 Bacteria 1031
172 Ga0495624_0019579 3300046690 Bacteria 4514
173 Ga0495600_0025256 3300046809 Bacteria 3828
174 Ga0495581_0089858 3300047315 Bacteria 1781
175 Ga0495604_0041244 3300047317 Bacteria 3620
176 Ga0495604_0466849 3300047317 Bacteria 823
177 Ga0495680_0098037 3300047322 Bacteria 2187
178 Ga0495675_0097484 3300047444 Bacteria 1842
179 Ga0495675_0157931 3300047444 Bacteria 1398
180 Ga0495684_0084484 3300047471 Bacteria 2407
181 Ga0495593_0021702 3300047673 Bacteria 3583
182 Ga0495602_0028339 3300048088 Bacteria 5362
183 Ga0495602_0029922 3300048088 Bacteria 5175
184 Ga0495602_0090568 3300048088 Bacteria 2540
185 Ga0495614_0021902 3300048089 Bacteria 2759
186 Ga0496102_0051090 3300048905 Bacteria 3766
187 Ga0496103_0054661 3300048906 Bacteria 2475
188 Ga0496104_0185619 3300048907 Bacteria 1990
189 Ga0496105_0104531 3300048908 Bacteria 2338
190 Ga0496107_0026308 3300048910 Bacteria 4123
191 Ga0496107_0114971 3300048910 Bacteria 1980
192 Ga0496109_0060206 3300048912 Bacteria 3469
193 Ga0496110_0170504 3300048913 Bacteria 1974
194 Ga0496111_0139693 3300048914 Bacteria 1795
195 Ga0496112_0052231 3300048915 Bacteria 4011
196 Ga0496113_0014063 3300048916 Bacteria 5447
197 Ga0496114_0114940 3300048917 Bacteria 2308
198 Ga0496115_0123622 3300048918 Bacteria 2130
199 Ga0496115_0278585 3300048918 Bacteria 1373
200 Ga0501034_0190885 3300049571 Bacteria 2011
201 Ga0501047_0128321 3300049581 Bacteria 2416
202 nmdc:mga0yw44_142491_c1 3300050492 Bacteria 1558
203 nmdc:mga0yw44_328592_c1 3300050492 Bacteria 1027
204 nmdc:mga04h51_44975_c1 3300050495 Bacteria 1458
205 nmdc:mga07m45_146541_c1 3300050496 Bacteria 1368
206 nmdc:mga07m45_179136_c1 3300050496 Bacteria 1232
207 nmdc:mga05p37_334484_c1 3300050507 Bacteria 1788
208 nmdc:mga05p37_340168_c1 3300050507 Bacteria 1770
209 nmdc:mga09592_167178_c1 3300050508 Bacteria 1901
210 nmdc:mga0qj67_52558_c1 3300050509 Bacteria 3225
211 nmdc:mga0qj67_606311_c1 3300050509 Unclassified 875
212 nmdc:mga08y16_52747_c1 3300050511 Bacteria 4254
213 nmdc:mga0n895_249519_c1 3300050512 Bacteria 1801
214 nmdc:mga0n895_595193_c1 3300050512 Bacteria 1109
215 nmdc:mga0rr50_300887_c1 3300050513 Bacteria 1342
216 nmdc:mga08x19_116992_c1 3300050514 Bacteria 1783
217 nmdc:mga08x19_260467_c1 3300050514 Bacteria 1199
218 nmdc:mga0a205_343120_c1 3300050515 Bacteria 1362
219 Ga0495601_0089229 3300053077 Bacteria 1982
220 Ga0495601_0096630 3300053077 Bacteria 1905
221 Ga0495612_0060454 3300053078 Bacteria 1568
222 Ga0495595_0095070 3300053084 Bacteria 1433
223 Ga0495619_0015318 3300053085 Unclassified 4850
224 Ga0495619_0024628 3300053085 Bacteria 3861
225 Ga0500643_038100 3300053087 Bacteria 1427
226 Ga0500583_0029289 3300053092 Bacteria 2398
227 Ga0500642_0061815 3300053130 Bacteria 1684
228 Ga0500588_0012414 3300053146 Bacteria 2112
229 Ga0500637_0118596 3300053178 Bacteria 1535
230 Ga0530510_0282990 3300061734 Archaea 1239
231 2524535422 2524023228 Bacteria 10118060
232 2723848043 2721755755 Bacteria 8322773
233 2793080987
234 2899374466 2899370129 Bacteria 6781179
235 8006935150 8006933436 Bacteria 10410654
236 8006975118 8006973647 Bacteria 10679141
237 8006984764 8006984368 Bacteria 9651211
238 Ga0373937_0533104
239 rootH1_10081840
240 rootL2_10087235
241 rootH1_10092221
242 JGI25160J50197_1002156
243 Ga0055530_10000018
244 Ga0055531_10000111
245 Ga0065165_1000806
246 Ga0065715_10288998
247 Ga0070683_100001569
248 Ga0070690_100139627
249 Ga0070667_100071522
250 Ga0070713_100075210
251 Ga0070705_100000003
252 Ga0070705_100265294
253 Ga0070708_100043338
254 Ga0070708_100049894
255 Ga0070708_100248789
256 Ga0070708_100454642
257 Ga0070678_100448366
258 Ga0070681_10141173
259 Ga0070706_100000820
260 Ga0070706_100324962
261 Ga0070707_100007319
262 Ga0070707_100132564
263 Ga0070698_100029912
264 Ga0070698_100059928
265 Ga0070699_100000018
266 Ga0070699_100150702
267 Ga0070699_100310233
268 Ga0070684_100016263
269 Ga0070697_100120957
270 Ga0070697_100280445
271 Ga0070697_100364294
272 Ga0070697_100424231
273 Ga0068853_100292399
274 Ga0070695_100081492
275 Ga0070696_100000011
276 Ga0070696_100002098
277 Ga0070693_100182847
278 Ga0068857_100386584
279 Ga0070702_100057140
280 Ga0068852_100248808
281 Ga0068863_100368811
282 Ga0081455_10000203
283 Ga0081540_1003356
284 Ga0070717_10005206
285 Ga0070717_10324770
286 Ga0075365_10046054
287 Ga0070715_10059145
288 Ga0075369_10171736
289 Ga0075370_10162443
290 Ga0068871_100082509
291 Ga0075430_100002213
292 Ga0075431_100703459
293 Ga0075429_100142858
294 Ga0068865_100108590
295 Ga0075436_100390947
296 Ga0105245_10618083
297 Ga0114129_10010114
298 Ga0114129_10590349
299 Ga0105248_10199653
300 Ga0105237_10204050
301 Ga0105249_10364830
302 Ga0105239_10088441
303 Ga0105239_10183334
304 Ga0105246_10102351
305 Ga0163162_10237996
306 Ga0163162_10250018
307 Ga0163162_10576074
308 Ga0157375_10672819
309 Ga0157379_10316093
310 Ga0157376_10140538
311 Ga0209676_1002279
312 Ga0209050_1000017
313 Ga0207426_1000379
314 Ga0209257_1000104
315 Ga0207696_1042185
316 Ga0207653_10000296
317 Ga0207685_10051227
318 Ga0207684_10001910
319 Ga0207684_10236833
320 Ga0207684_10265398
321 Ga0207684_10269019
322 Ga0207671_10163019
323 Ga0207693_10115073
324 Ga0207646_10023483
325 Ga0207646_10039116
326 Ga0207646_10061868
327 Ga0207646_10076723
328 Ga0207646_10209833
329 Ga0207687_10539022
330 Ga0207700_10002045
331 Ga0207664_10202860
332 Ga0207686_10168840
333 Ga0207709_10237945
334 Ga0207711_10146628
335 Ga0207661_10039687
336 Ga0207679_10008554
337 Ga0207668_10047455
338 Ga0207668_10084798
339 Ga0207703_10671827
340 Ga0207639_10236944
341 Ga0207674_10517365
342 Ga0207683_10152387
343 Ga0209813_10063800
344 Ga0268265_10029287
345 Ga0268265_10066535
346 Ga0307515_10000032
347 Ga0307509_10017179
348 Ga0307509_10269343
349 Ga0307508_10015809
350 Ga0307416_100104561
351 Ga0307415_100079250
352 Ga0307510_10050498
353 Ga0373952_0056919
354 Ga0373956_0005518
355 Ga0373957_0045681
356 Ga0373957_0105196
357 Ga0373946_0090713
358 Ga0373955_0052263
359 Ga0316574_0002478
360 Ga0316574_0005772
361 Ga0316574_0087089
362 Ga0316574_0294734
363 Ga0373924_0048943
364 Ga0373931_0001430
365 Ga0373935_0004760
366 Ga0373927_0167931
367 Ga0373947_0083228
368 Ga0373947_0193204
369 Ga0373937_0484742
370 Ga0316584_0109403
371 Ga0395900_0360677
372 Ga0400483_112433
373 Ga0436361_1047115
374 Ga0453683_0224692
375 Ga0466958_0022735
376 Ga0466958_0155373
377 Ga0495592_0037823
378 Ga0495629_0042142
379 Ga0495651_0017258
380 Ga0495582_0055894
381 Ga0495639_0211324
382 Ga0495662_0010886
383 Ga0495594_0069897
384 Ga0495608_0053537
385 Ga0495608_0219414
386 Ga0495618_0069956
387 Ga0495628_0053210
388 Ga0495630_0021324
389 Ga0495652_0100335
390 Ga0495652_0189730
391 Ga0495665_0165445
392 Ga0495640_0015672
393 Ga0495586_0186164
394 Ga0495587_0021976
395 Ga0495587_0077215
396 Ga0495645_0005484
397 Ga0495667_0029123
398 Ga0495667_0044010
399 Ga0495667_0237284
400 Ga0495634_0019687
401 Ga0495611_0035591
402 Ga0495625_0270059
403 Ga0495657_0102134
404 Ga0495623_0056576
405 Ga0495623_0212573
406 Ga0495646_0106733
407 Ga0495646_0167427
408 Ga0495647_0139999
409 Ga0495624_0019579
410 Ga0495600_0025256
411 Ga0495581_0089858
412 Ga0495604_0041244
413 Ga0495604_0466849
414 Ga0495680_0098037
415 Ga0495675_0097484
416 Ga0495675_0157931
417 Ga0495684_0084484
418 Ga0495593_0021702
419 Ga0495602_0028339
420 Ga0495602_0029922
421 Ga0495602_0090568
422 Ga0495614_0021902
423 Ga0496102_0051090
424 Ga0496103_0054661
425 Ga0496104_0185619
426 Ga0496105_0104531
427 Ga0496107_0026308
428 Ga0496107_0114971
429 Ga0496109_0060206
430 Ga0496110_0170504
431 Ga0496111_0139693
432 Ga0496112_0052231
433 Ga0496113_0014063
434 Ga0496114_0114940
435 Ga0496115_0123622
436 Ga0496115_0278585
437 Ga0501034_0190885
438 Ga0501047_0128321
439 nmdc:mga0yw44_142491_c1
440 nmdc:mga0yw44_328592_c1
441 nmdc:mga04h51_44975_c1
442 nmdc:mga07m45_146541_c1
443 nmdc:mga07m45_179136_c1
444 nmdc:mga05p37_334484_c1
445 nmdc:mga05p37_340168_c1
446 nmdc:mga09592_167178_c1
447 nmdc:mga0qj67_52558_c1
448 nmdc:mga0qj67_606311_c1
449 nmdc:mga08y16_52747_c1
450 nmdc:mga0n895_249519_c1
451 nmdc:mga0n895_595193_c1
452 nmdc:mga0rr50_300887_c1
453 nmdc:mga08x19_116992_c1
454 nmdc:mga08x19_260467_c1
455 nmdc:mga0a205_343120_c1
456 Ga0495601_0089229
457 Ga0495601_0096630
458 Ga0495612_0060454
459 Ga0495595_0095070
460 Ga0495619_0015318
461 Ga0495619_0024628
462 Ga0500643_038100
463 Ga0500583_0029289
464 Ga0500642_0061815
465 Ga0500588_0012414
466 Ga0500637_0118596
467 Ga0530510_0282990
468 2524535422
469 2723848043
470 2793080987
471 2899374466
472 8006935150
473 8006975118
474 8006984764

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

58

324

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3irs-assembly1.cif.gz_B crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica 0.8465 1 268
3irs-assembly1.cif.gz_B crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica 0.8406 1 268
4inf-assembly1.cif.gz_B crystal structure of amidohydrolase saro_0799 (target efi-505250) from novosphingobium aromaticivorans dsm 12444 with bound calcium 0.7525 3 269
7wkl-assembly1.cif.gz_B crystal structure of dihydroxybenzoate decarboxylase mutant f296y from aspergillus oryzae in complex with catechol 0.7479 2 269
3s4t-assembly1.cif.gz_A crystal structure of putative amidohydrolase-2 (efi-target 500288)from polaromonas sp. js666 0.7465 1 269
ID Description Score Start End Superfamily
af_I6Y3Q7_2_272_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9536 4 269 3.20.20.140
af_I6Y3Q7_2_272_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9397 4 269 3.20.20.140
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8693 20 269 3.20.20.140
3k4wC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8353 1 268 3.20.20.140
3k4wC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8295 1 268 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A1F3A682-F1-model_v4 Amidohydrolase 0.9772 43 269 GO:0016787
GO:0016831
AF-A0A3M2FY40-F1-model_v4 Amidohydrolase 0.9743 61 268 GO:0016787
GO:0016831
AF-A0A2N5YID9-F1-model_v4 deleted 0.9727 45 269
AF-A0A6I1Z0V0-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9706 1 269 GO:0016787
GO:0016831
AF-A0A7V2SAZ8-F1-model_v4 Amidohydrolase 0.9705 50 269 GO:0016787
GO:0016831

Map