F350111
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 237 | 133 | 237 | 208 |
Family's Representative Sequence
| Representative Sequence | 3300028556|Ga0265337_1003945|Ga0265337_10039454 |
| Length | 207 |
| Sequence | MKIAIKNIEGKKSGELEVKFPLIEDGKGTQAVHDVVVAYRAAQRSGTACTKNVGEVSGSNKKPWRQKGTGRARAGSHQSPLWVGGGVVFGPKPRDFSKKVSKSTRALALRKALSERLKAGDVVVVDDLKLSSPKTKDFVGLMSTLELTGTTLIVAAADKNLTLASRNVPDVALATSDSLNTYDILRPDKLLFTKGAFEKVEARLTKE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 16 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 17 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 18 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 19 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 20 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 23 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 33 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 55 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 56 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 57 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 58 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 59 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 60 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 61 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 62 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 63 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 64 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 65 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 66 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 67 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 68 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 69 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 70 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 71 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 72 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 73 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 74 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 75 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 76 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 77 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 78 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 79 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 80 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 81 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 82 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 83 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 84 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 85 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 86 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 87 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 88 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 89 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 90 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 91 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 92 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 93 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 123 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 124 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 125 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 126 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 129 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.47 |
| Metatranscriptomes | 2.53 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.11 |
| Rhizosphere | 97.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058863_10022309 | 3300004799 | Bacteria | 1358 |
| 2 | Ga0058861_11907353 | 3300004800 | Bacteria | 1940 |
| 3 | Ga0058862_12724094 | 3300004803 | Bacteria | 913 |
| 4 | Ga0070683_100114843 | 3300005329 | Bacteria | 2541 |
| 5 | Ga0070690_100027728 | 3300005330 | Bacteria | 3503 |
| 6 | Ga0070690_100081266 | 3300005330 | Bacteria | 2120 |
| 7 | Ga0070690_100423285 | 3300005330 | Unclassified | 982 |
| 8 | Ga0070666_10052352 | 3300005335 | Bacteria | 2751 |
| 9 | Ga0070689_100039175 | 3300005340 | Bacteria | 3628 |
| 10 | Ga0070689_100113198 | 3300005340 | Bacteria | 2160 |
| 11 | Ga0070689_100172649 | 3300005340 | Bacteria | 1752 |
| 12 | Ga0070687_100177738 | 3300005343 | Bacteria | 1272 |
| 13 | Ga0070714_100013066 | 3300005435 | Bacteria | 6646 |
| 14 | Ga0070711_100314444 | 3300005439 | Eukaryota | 1249 |
| 15 | Ga0070663_100451974 | 3300005455 | Bacteria | 1059 |
| 16 | Ga0070681_10466376 | 3300005458 | Bacteria | 1175 |
| 17 | Ga0070685_10685091 | 3300005466 | Bacteria | 746 |
| 18 | Ga0070686_100011524 | 3300005544 | Bacteria | 5016 |
| 19 | Ga0068855_100023610 | 3300005563 | Bacteria | 7366 |
| 20 | Ga0068855_100164847 | 3300005563 | Bacteria | 2513 |
| 21 | Ga0068856_100139830 | 3300005614 | Bacteria | 2428 |
| 22 | Ga0068856_100421019 | 3300005614 | Bacteria | 1355 |
| 23 | Ga0068856_100577338 | 3300005614 | Bacteria | 1145 |
| 24 | Ga0068859_100003547 | 3300005617 | Bacteria | 15891 |
| 25 | Ga0068859_100334331 | 3300005617 | Bacteria | 1609 |
| 26 | Ga0068864_100149170 | 3300005618 | Bacteria | 2117 |
| 27 | Ga0068863_100094323 | 3300005841 | Bacteria | 2840 |
| 28 | Ga0068863_100859491 | 3300005841 | Bacteria | 906 |
| 29 | Ga0070716_100435438 | 3300006173 | Bacteria | 952 |
| 30 | Ga0097621_100599889 | 3300006237 | Bacteria | 1006 |
| 31 | Ga0075433_10363631 | 3300006852 | Unclassified | 1278 |
| 32 | Ga0097620_100003547 | 3300006931 | Bacteria | 15891 |
| 33 | Ga0097620_100334348 | 3300006931 | Bacteria | 1609 |
| 34 | Ga0097620_100737772 | 3300006931 | Bacteria | 1074 |
| 35 | Ga0105240_10002027 | 3300009093 | Bacteria | 33415 |
| 36 | Ga0105240_10122487 | 3300009093 | Bacteria | 3129 |
| 37 | Ga0105240_10342691 | 3300009093 | Bacteria | 1697 |
| 38 | Ga0105240_10362696 | 3300009093 | Bacteria | 1641 |
| 39 | Ga0105242_10361773 | 3300009176 | Unclassified | 1343 |
| 40 | Ga0105242_10467421 | 3300009176 | Bacteria | 1192 |
| 41 | Ga0105242_10834476 | 3300009176 | Bacteria | 915 |
| 42 | Ga0105238_10002594 | 3300009551 | Bacteria | 18015 |
| 43 | Ga0105238_10152407 | 3300009551 | Bacteria | 2287 |
| 44 | Ga0157373_10385085 | 3300013100 | Bacteria | 1003 |
| 45 | Ga0157370_10139213 | 3300013104 | Bacteria | 2261 |
| 46 | Ga0157374_10605774 | 3300013296 | Bacteria | 1105 |
| 47 | Ga0157375_10000037 | 3300013308 | Bacteria | 176523 |
| 48 | Ga0157375_10083439 | 3300013308 | Bacteria | 3241 |
| 49 | Ga0163163_10013561 | 3300014325 | Bacteria | 7465 |
| 50 | Ga0206354_10002870 | 3300020081 | Bacteria | 1015 |
| 51 | Ga0207680_10195918 | 3300025903 | Bacteria | 1374 |
| 52 | Ga0207654_10343390 | 3300025911 | Bacteria | 1026 |
| 53 | Ga0207695_10007847 | 3300025913 | Bacteria | 13492 |
| 54 | Ga0207695_10179846 | 3300025913 | Bacteria | 2036 |
| 55 | Ga0207695_10224098 | 3300025913 | Bacteria | 1787 |
| 56 | Ga0207695_10504293 | 3300025913 | Bacteria | 1092 |
| 57 | Ga0207693_10438350 | 3300025915 | Bacteria | 1021 |
| 58 | Ga0207660_10190947 | 3300025917 | Bacteria | 1595 |
| 59 | Ga0207662_10312257 | 3300025918 | Bacteria | 1047 |
| 60 | Ga0207657_10431906 | 3300025919 | Bacteria | 1034 |
| 61 | Ga0207652_10228429 | 3300025921 | Bacteria | 1677 |
| 62 | Ga0207652_10559213 | 3300025921 | Unclassified | 1028 |
| 63 | Ga0207694_10008352 | 3300025924 | Bacteria | 7826 |
| 64 | Ga0207694_10010531 | 3300025924 | Bacteria | 6975 |
| 65 | Ga0207694_10099102 | 3300025924 | Bacteria | 2308 |
| 66 | Ga0207664_10013296 | 3300025929 | Bacteria | 5903 |
| 67 | Ga0207690_10155633 | 3300025932 | Bacteria | 1699 |
| 68 | Ga0207686_10291331 | 3300025934 | Bacteria | 1209 |
| 69 | Ga0207670_10039940 | 3300025936 | Bacteria | 3077 |
| 70 | Ga0207665_10205979 | 3300025939 | Bacteria | 1435 |
| 71 | Ga0207661_10088974 | 3300025944 | Bacteria | 2568 |
| 72 | Ga0207667_10020158 | 3300025949 | Bacteria | 7423 |
| 73 | Ga0207667_10033875 | 3300025949 | Bacteria | 5488 |
| 74 | Ga0207667_10089541 | 3300025949 | Bacteria | 3180 |
| 75 | Ga0207703_10341293 | 3300026035 | Bacteria | 1377 |
| 76 | Ga0207678_10497598 | 3300026067 | Bacteria | 1062 |
| 77 | Ga0207702_10609001 | 3300026078 | Bacteria | 1072 |
| 78 | Ga0207641_10493674 | 3300026088 | Unclassified | 1188 |
| 79 | Ga0207641_10855901 | 3300026088 | Unclassified | 901 |
| 80 | Ga0207674_11240060 | 3300026116 | Bacteria | 715 |
| 81 | Ga0265337_1001944 | 3300028556 | Bacteria | 9819 |
| 82 | Ga0265337_1003945 | 3300028556 | Bacteria | 6282 |
| 83 | Ga0265337_1018834 | 3300028556 | Bacteria | 2185 |
| 84 | Ga0265337_1033539 | 3300028556 | Bacteria | 1514 |
| 85 | Ga0265337_1059450 | 3300028556 | Bacteria | 1061 |
| 86 | Ga0265337_1061247 | 3300028556 | Bacteria | 1043 |
| 87 | Ga0265326_10072030 | 3300028558 | Bacteria | 977 |
| 88 | Ga0265326_10074918 | 3300028558 | Bacteria | 957 |
| 89 | Ga0265319_1000019 | 3300028563 | Bacteria | 154537 |
| 90 | Ga0265319_1005191 | 3300028563 | Bacteria | 6293 |
| 91 | Ga0265319_1032095 | 3300028563 | Bacteria | 1824 |
| 92 | Ga0265334_10010655 | 3300028573 | Bacteria | 3881 |
| 93 | Ga0265334_10045702 | 3300028573 | Bacteria | 1695 |
| 94 | Ga0265334_10140279 | 3300028573 | Bacteria | 856 |
| 95 | Ga0265318_10015457 | 3300028577 | Bacteria | 3174 |
| 96 | Ga0265323_10000705 | 3300028653 | Bacteria | 18171 |
| 97 | Ga0265323_10008337 | 3300028653 | Bacteria | 4279 |
| 98 | Ga0265323_10023435 | 3300028653 | Bacteria | 2353 |
| 99 | Ga0265322_10018664 | 3300028654 | Bacteria | 1993 |
| 100 | Ga0265322_10085846 | 3300028654 | Bacteria | 894 |
| 101 | Ga0265336_10010845 | 3300028666 | Bacteria | 3110 |
| 102 | Ga0265336_10046426 | 3300028666 | Bacteria | 1320 |
| 103 | Ga0265336_10068824 | 3300028666 | Bacteria | 1058 |
| 104 | Ga0265338_10000831 | 3300028800 | Bacteria | 52074 |
| 105 | Ga0265338_10000987 | 3300028800 | Bacteria | 47972 |
| 106 | Ga0265338_10001116 | 3300028800 | Bacteria | 44580 |
| 107 | Ga0265338_10002943 | 3300028800 | Bacteria | 24701 |
| 108 | Ga0265338_10008151 | 3300028800 | Bacteria | 12785 |
| 109 | Ga0265338_10008216 | 3300028800 | Bacteria | 12711 |
| 110 | Ga0265338_10025901 | 3300028800 | Bacteria | 5931 |
| 111 | Ga0265338_10033436 | 3300028800 | Bacteria | 4990 |
| 112 | Ga0265338_10037374 | 3300028800 | Bacteria | 4622 |
| 113 | Ga0265338_10060858 | 3300028800 | Bacteria | 3312 |
| 114 | Ga0265338_10072654 | 3300028800 | Bacteria | 2936 |
| 115 | Ga0265338_10086023 | 3300028800 | Bacteria | 2618 |
| 116 | Ga0265338_10092010 | 3300028800 | Bacteria | 2503 |
| 117 | Ga0265338_10127489 | 3300028800 | Bacteria | 2016 |
| 118 | Ga0265338_10147046 | 3300028800 | Bacteria | 1837 |
| 119 | Ga0265338_10191869 | 3300028800 | Unclassified | 1548 |
| 120 | Ga0265338_10214507 | 3300028800 | Unclassified | 1442 |
| 121 | Ga0265338_10231025 | 3300028800 | Bacteria | 1376 |
| 122 | Ga0265338_10280982 | 3300028800 | Bacteria | 1216 |
| 123 | Ga0265338_10370896 | 3300028800 | Bacteria | 1025 |
| 124 | Ga0265338_10590729 | 3300028800 | Unclassified | 774 |
| 125 | Ga0265324_10000595 | 3300029957 | Bacteria | 24811 |
| 126 | Ga0265324_10023173 | 3300029957 | Bacteria | 2213 |
| 127 | Ga0265324_10064420 | 3300029957 | Eukaryota | 1251 |
| 128 | Ga0265324_10129316 | 3300029957 | Bacteria | 857 |
| 129 | Ga0265330_10089129 | 3300031235 | Bacteria | 1325 |
| 130 | Ga0265320_10008500 | 3300031240 | Bacteria | 6281 |
| 131 | Ga0265320_10021223 | 3300031240 | Bacteria | 3499 |
| 132 | Ga0265320_10043314 | 3300031240 | Bacteria | 2226 |
| 133 | Ga0265325_10024697 | 3300031241 | Bacteria | 3267 |
| 134 | Ga0265325_10030693 | 3300031241 | Unclassified | 2880 |
| 135 | Ga0265340_10001439 | 3300031247 | Bacteria | 13655 |
| 136 | Ga0265340_10004740 | 3300031247 | Bacteria | 7561 |
| 137 | Ga0265340_10050991 | 3300031247 | Bacteria | 2005 |
| 138 | Ga0265340_10153636 | 3300031247 | Unclassified | 1048 |
| 139 | Ga0265339_10212869 | 3300031249 | Bacteria | 949 |
| 140 | Ga0265339_10286007 | 3300031249 | Bacteria | 789 |
| 141 | Ga0265331_10233599 | 3300031250 | Bacteria | 826 |
| 142 | Ga0265327_10002276 | 3300031251 | Bacteria | 20633 |
| 143 | Ga0265316_10006174 | 3300031344 | Bacteria | 11492 |
| 144 | Ga0265316_10013826 | 3300031344 | Bacteria | 7147 |
| 145 | Ga0265316_10088655 | 3300031344 | Bacteria | 2362 |
| 146 | Ga0265313_10000967 | 3300031595 | Bacteria | 28455 |
| 147 | Ga0265314_10009739 | 3300031711 | Bacteria | 8079 |
| 148 | Ga0265342_10073216 | 3300031712 | Bacteria | 1993 |
| 149 | Ga0265342_10138736 | 3300031712 | Bacteria | 1357 |
| 150 | Ga0265342_10188500 | 3300031712 | Bacteria | 1126 |
| 151 | Ga0373945_0085809 | 3300035116 | Bacteria | 1212 |
| 152 | Ga0373953_0203450 | 3300035117 | Bacteria | 856 |
| 153 | Ga0373954_0005809 | 3300035118 | Bacteria | 5358 |
| 154 | Ga0373954_0015764 | 3300035118 | Bacteria | 3380 |
| 155 | Ga0373956_0002468 | 3300035119 | Bacteria | 7527 |
| 156 | Ga0373943_0105544 | 3300035170 | Bacteria | 1479 |
| 157 | Ga0373946_0098370 | 3300035171 | Unclassified | 1308 |
| 158 | Ga0373955_0165219 | 3300035172 | Bacteria | 1308 |
| 159 | Ga0373931_0026189 | 3300035691 | Bacteria | 2966 |
| 160 | Ga0373931_0185715 | 3300035691 | Bacteria | 1234 |
| 161 | Ga0373931_0267549 | 3300035691 | Unclassified | 1045 |
| 162 | Ga0373935_0057695 | 3300035692 | Bacteria | 2477 |
| 163 | Ga0373927_0003068 | 3300035695 | Bacteria | 12108 |
| 164 | Ga0373927_0003238 | 3300035695 | Bacteria | 11717 |
| 165 | Ga0373947_0006206 | 3300035725 | Bacteria | 6951 |
| 166 | Ga0373937_0050399 | 3300036401 | Bacteria | 3813 |
| 167 | Ga0373937_0508417 | 3300036401 | Bacteria | 1145 |
| 168 | Ga0310109_021624 | 3300036534 | Bacteria | 866 |
| 169 | Ga0373925_0004609 | 3300037068 | Bacteria | 10409 |
| 170 | Ga0373925_0007979 | 3300037068 | Bacteria | 7707 |
| 171 | Ga0451805_009148 | 3300041461 | Bacteria | 1008 |
| 172 | Ga0451847_0252879 | 3300041503 | Bacteria | 710 |
| 173 | Ga0466957_0170933 | 3300044842 | Bacteria | 1416 |
| 174 | Ga0451576_0027354 | 3300045051 | Bacteria | 6126 |
| 175 | Ga0451576_0390716 | 3300045051 | Unclassified | 1458 |
| 176 | Ga0451576_0663470 | 3300045051 | Bacteria | 1096 |
| 177 | Ga0451576_1015126 | 3300045051 | Bacteria | 869 |
| 178 | Ga0451576_1129329 | 3300045051 | Bacteria | 820 |
| 179 | Ga0495629_0131060 | 3300046459 | Bacteria | 1746 |
| 180 | Ga0495641_0097718 | 3300046461 | Unclassified | 1310 |
| 181 | Ga0495582_0040413 | 3300046473 | Unclassified | 2569 |
| 182 | Ga0495639_0091448 | 3300046475 | Bacteria | 1428 |
| 183 | Ga0495639_0097662 | 3300046475 | Bacteria | 1384 |
| 184 | Ga0495662_0044220 | 3300046476 | Unclassified | 2150 |
| 185 | Ga0495662_0106370 | 3300046476 | Bacteria | 1374 |
| 186 | Ga0495664_0134314 | 3300046477 | Bacteria | 1499 |
| 187 | Ga0495608_0123405 | 3300046511 | Bacteria | 1660 |
| 188 | Ga0495618_0001918 | 3300046514 | Bacteria | 13659 |
| 189 | Ga0495618_0338599 | 3300046514 | Bacteria | 929 |
| 190 | Ga0495630_0000065 | 3300046517 | Bacteria | 85152 |
| 191 | Ga0495630_0113287 | 3300046517 | Bacteria | 2055 |
| 192 | Ga0495666_0007428 | 3300046526 | Bacteria | 5494 |
| 193 | Ga0495666_0054477 | 3300046526 | Bacteria | 1918 |
| 194 | Ga0495652_0153743 | 3300046529 | Bacteria | 1794 |
| 195 | Ga0495640_0097921 | 3300046533 | Bacteria | 1928 |
| 196 | Ga0495586_0000012 | 3300046535 | Bacteria | 138093 |
| 197 | Ga0495586_0001803 | 3300046535 | Bacteria | 11704 |
| 198 | Ga0495586_0010221 | 3300046535 | Bacteria | 4990 |
| 199 | Ga0495586_0419864 | 3300046535 | Unclassified | 770 |
| 200 | Ga0495587_0086211 | 3300046536 | Bacteria | 1817 |
| 201 | Ga0495587_0315842 | 3300046536 | Unclassified | 873 |
| 202 | Ga0495645_0178243 | 3300046543 | Bacteria | 1458 |
| 203 | Ga0495645_0217045 | 3300046543 | Bacteria | 1288 |
| 204 | Ga0495622_0024445 | 3300046557 | Bacteria | 2821 |
| 205 | Ga0495667_0030872 | 3300046559 | Bacteria | 3599 |
| 206 | Ga0495634_0011847 | 3300046642 | Bacteria | 6339 |
| 207 | Ga0495634_0045078 | 3300046642 | Unclassified | 2983 |
| 208 | Ga0495635_0088808 | 3300046663 | Bacteria | 2115 |
| 209 | Ga0495646_0243898 | 3300046680 | Bacteria | 965 |
| 210 | Ga0495658_0157094 | 3300046683 | Bacteria | 1400 |
| 211 | Ga0495613_0005543 | 3300046689 | Bacteria | 9477 |
| 212 | Ga0495624_0039202 | 3300046690 | Bacteria | 3038 |
| 213 | Ga0495581_0136253 | 3300047315 | Unclassified | 1431 |
| 214 | Ga0495581_0358488 | 3300047315 | Bacteria | 851 |
| 215 | Ga0495674_0000385 | 3300047319 | Bacteria | 39496 |
| 216 | Ga0495674_0053330 | 3300047319 | Bacteria | 3555 |
| 217 | Ga0495674_0099624 | 3300047319 | Bacteria | 2474 |
| 218 | Ga0495676_0028212 | 3300047321 | Unclassified | 4799 |
| 219 | Ga0495676_0130793 | 3300047321 | Bacteria | 1812 |
| 220 | Ga0495680_0002262 | 3300047322 | Bacteria | 19840 |
| 221 | Ga0495680_0155252 | 3300047322 | Unclassified | 1666 |
| 222 | Ga0495684_0080365 | 3300047471 | Bacteria | 2475 |
| 223 | Ga0495684_0092186 | 3300047471 | Bacteria | 2295 |
| 224 | Ga0495614_0106640 | 3300048089 | Unclassified | 1228 |
| 225 | Ga0496107_0010537 | 3300048910 | Bacteria | 6425 |
| 226 | Ga0496111_0426133 | 3300048914 | Bacteria | 980 |
| 227 | Ga0496112_0389557 | 3300048915 | Bacteria | 1334 |
| 228 | Ga0496115_0097881 | 3300048918 | Bacteria | 2402 |
| 229 | Ga0495682_0029959 | 3300049460 | Bacteria | 2015 |
| 230 | Ga0501032_0276833 | 3300049569 | Bacteria | 1087 |
| 231 | Ga0501033_0041982 | 3300049570 | Bacteria | 3411 |
| 232 | Ga0501039_0160331 | 3300049575 | Bacteria | 1768 |
| 233 | Ga0501043_0136634 | 3300049579 | Bacteria | 1920 |
| 234 | Ga0501043_0402600 | 3300049579 | Bacteria | 1034 |
| 235 | Ga0501047_0099947 | 3300049581 | Bacteria | 2780 |
| 236 | nmdc:mga08y16_116291_c1 | 3300050511 | Bacteria | 2784 |
| 237 | nmdc:mga0a205_825209_c1 | 3300050515 | Unclassified | 775 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045051 | Ga0451576_1129329 | Ga0451576_1129329_277_798 | 173 |
| 2 | 3300028800 | Ga0265338_10072654 | Ga0265338_100726543 | 192 |
| 3 | 3300005614 | Ga0068856_100139830 | Ga0068856_1001398302 | 202 |
| 4 | 3300028563 | Ga0265319_1032095 | Ga0265319_10320953 | 206 |
| 5 | 3300005330 | Ga0070690_100423285 | Ga0070690_1004232851 | 207 |
| 6 | 3300005340 | Ga0070689_100039175 | Ga0070689_1000391755 | 207 |
| 7 | 3300006173 | Ga0070716_100435438 | Ga0070716_1004354382 | 207 |
| 8 | 3300006852 | Ga0075433_10363631 | Ga0075433_103636312 | 207 |
| 9 | 3300009551 | Ga0105238_10152407 | Ga0105238_101524072 | 207 |
| 10 | 3300025924 | Ga0207694_10099102 | Ga0207694_100991023 | 207 |
| 11 | 3300025936 | Ga0207670_10039940 | Ga0207670_100399403 | 207 |
| 12 | 3300025939 | Ga0207665_10205979 | Ga0207665_102059792 | 207 |
| 13 | 3300028556 | Ga0265337_1003945 | Ga0265337_10039454 | 207 |
| 14 | 3300028556 | Ga0265337_1059450 | Ga0265337_10594502 | 207 |
| 15 | 3300028558 | Ga0265326_10074918 | Ga0265326_100749182 | 207 |
| 16 | 3300028654 | Ga0265322_10018664 | Ga0265322_100186642 | 207 |
| 17 | 3300028666 | Ga0265336_10010845 | Ga0265336_100108453 | 207 |
| 18 | 3300028800 | Ga0265338_10000831 | Ga0265338_1000083150 | 207 |
| 19 | 3300028800 | Ga0265338_10000987 | Ga0265338_1000098731 | 207 |
| 20 | 3300028800 | Ga0265338_10008151 | Ga0265338_100081518 | 207 |
| 21 | 3300028800 | Ga0265338_10025901 | Ga0265338_100259017 | 207 |
| 22 | 3300028800 | Ga0265338_10147046 | Ga0265338_101470462 | 207 |
| 23 | 3300028800 | Ga0265338_10214507 | Ga0265338_102145073 | 207 |
| 24 | 3300028800 | Ga0265338_10590729 | Ga0265338_105907292 | 207 |
| 25 | 3300029957 | Ga0265324_10064420 | Ga0265324_100644202 | 207 |
| 26 | 3300031240 | Ga0265320_10043314 | Ga0265320_100433142 | 207 |
| 27 | 3300031249 | Ga0265339_10212869 | Ga0265339_102128692 | 207 |
| 28 | 3300031344 | Ga0265316_10088655 | Ga0265316_100886552 | 207 |
| 29 | 3300031712 | Ga0265342_10138736 | Ga0265342_101387362 | 207 |
| 30 | 3300035171 | Ga0373946_0098370 | Ga0373946_0098370_95_718 | 207 |
| 31 | 3300036534 | Ga0310109_021624 | Ga0310109_021624_65_688 | 207 |
| 32 | 3300041461 | Ga0451805_009148 | Ga0451805_009148_242_868 | 207 |
| 33 | 3300045051 | Ga0451576_0390716 | Ga0451576_0390716_150_773 | 207 |
| 34 | 3300046461 | Ga0495641_0097718 | Ga0495641_0097718_77_700 | 207 |
| 35 | 3300046473 | Ga0495582_0040413 | Ga0495582_0040413_99_722 | 207 |
| 36 | 3300046476 | Ga0495662_0044220 | Ga0495662_0044220_512_1135 | 207 |
| 37 | 3300046517 | Ga0495630_0000065 | Ga0495630_0000065_15354_15977 | 207 |
| 38 | 3300046526 | Ga0495666_0007428 | Ga0495666_0007428_2265_2888 | 207 |
| 39 | 3300046529 | Ga0495652_0153743 | Ga0495652_0153743_125_748 | 207 |
| 40 | 3300046535 | Ga0495586_0000012 | Ga0495586_0000012_119459_120082 | 207 |
| 41 | 3300046642 | Ga0495634_0045078 | Ga0495634_0045078_495_1118 | 207 |
| 42 | 3300047315 | Ga0495581_0136253 | Ga0495581_0136253_532_1155 | 207 |
| 43 | 3300047319 | Ga0495674_0000385 | Ga0495674_0000385_12029_12652 | 207 |
| 44 | 3300047321 | Ga0495676_0028212 | Ga0495676_0028212_247_870 | 207 |
| 45 | 3300048089 | Ga0495614_0106640 | Ga0495614_0106640_123_746 | 207 |
| 46 | 3300048910 | Ga0496107_0010537 | Ga0496107_0010537_4568_5191 | 207 |
| 47 | 3300050515 | nmdc:mga0a205_825209_c1 | nmdc:mga0a205_825209_c1_49_672 | 207 |
| 48 | 3300005330 | Ga0070690_100027728 | Ga0070690_1000277281 | 208 |
| 49 | 3300005330 | Ga0070690_100081266 | Ga0070690_1000812663 | 208 |
| 50 | 3300005335 | Ga0070666_10052352 | Ga0070666_100523522 | 208 |
| 51 | 3300005340 | Ga0070689_100113198 | Ga0070689_1001131984 | 208 |
| 52 | 3300005343 | Ga0070687_100177738 | Ga0070687_1001777382 | 208 |
| 53 | 3300005435 | Ga0070714_100013066 | Ga0070714_1000130664 | 208 |
| 54 | 3300005439 | Ga0070711_100314444 | Ga0070711_1003144442 | 208 |
| 55 | 3300005466 | Ga0070685_10685091 | Ga0070685_106850911 | 208 |
| 56 | 3300005544 | Ga0070686_100011524 | Ga0070686_1000115246 | 208 |
| 57 | 3300005563 | Ga0068855_100023610 | Ga0068855_1000236105 | 208 |
| 58 | 3300005563 | Ga0068855_100164847 | Ga0068855_1001648473 | 208 |
| 59 | 3300005614 | Ga0068856_100421019 | Ga0068856_1004210192 | 208 |
| 60 | 3300005614 | Ga0068856_100577338 | Ga0068856_1005773382 | 208 |
| 61 | 3300005617 | Ga0068859_100003547 | Ga0068859_1000035479 | 208 |
| 62 | 3300005617 | Ga0068859_100334331 | Ga0068859_1003343313 | 208 |
| 63 | 3300005618 | Ga0068864_100149170 | Ga0068864_1001491702 | 208 |
| 64 | 3300005841 | Ga0068863_100094323 | Ga0068863_1000943234 | 208 |
| 65 | 3300005841 | Ga0068863_100859491 | Ga0068863_1008594911 | 208 |
| 66 | 3300006237 | Ga0097621_100599889 | Ga0097621_1005998892 | 208 |
| 67 | 3300006931 | Ga0097620_100003547 | Ga0097620_1000035479 | 208 |
| 68 | 3300006931 | Ga0097620_100334348 | Ga0097620_1003343482 | 208 |
| 69 | 3300006931 | Ga0097620_100737772 | Ga0097620_1007377722 | 208 |
| 70 | 3300009093 | Ga0105240_10002027 | Ga0105240_1000202717 | 208 |
| 71 | 3300009093 | Ga0105240_10362696 | Ga0105240_103626962 | 208 |
| 72 | 3300009176 | Ga0105242_10361773 | Ga0105242_103617731 | 208 |
| 73 | 3300009176 | Ga0105242_10467421 | Ga0105242_104674212 | 208 |
| 74 | 3300009176 | Ga0105242_10834476 | Ga0105242_108344761 | 208 |
| 75 | 3300009551 | Ga0105238_10002594 | Ga0105238_1000259411 | 208 |
| 76 | 3300013296 | Ga0157374_10605774 | Ga0157374_106057742 | 208 |
| 77 | 3300013308 | Ga0157375_10000037 | Ga0157375_10000037130 | 208 |
| 78 | 3300013308 | Ga0157375_10083439 | Ga0157375_100834392 | 208 |
| 79 | 3300014325 | Ga0163163_10013561 | Ga0163163_100135619 | 208 |
| 80 | 3300020081 | Ga0206354_10002870 | Ga0206354_100028702 | 208 |
| 81 | 3300025903 | Ga0207680_10195918 | Ga0207680_101959181 | 208 |
| 82 | 3300025913 | Ga0207695_10007847 | Ga0207695_100078477 | 208 |
| 83 | 3300025913 | Ga0207695_10224098 | Ga0207695_102240982 | 208 |
| 84 | 3300025915 | Ga0207693_10438350 | Ga0207693_104383502 | 208 |
| 85 | 3300025918 | Ga0207662_10312257 | Ga0207662_103122572 | 208 |
| 86 | 3300025921 | Ga0207652_10559213 | Ga0207652_105592132 | 208 |
| 87 | 3300025924 | Ga0207694_10010531 | Ga0207694_100105317 | 208 |
| 88 | 3300025929 | Ga0207664_10013296 | Ga0207664_100132963 | 208 |
| 89 | 3300025934 | Ga0207686_10291331 | Ga0207686_102913313 | 208 |
| 90 | 3300025949 | Ga0207667_10020158 | Ga0207667_100201585 | 208 |
| 91 | 3300025949 | Ga0207667_10033875 | Ga0207667_100338757 | 208 |
| 92 | 3300026035 | Ga0207703_10341293 | Ga0207703_103412932 | 208 |
| 93 | 3300026088 | Ga0207641_10493674 | Ga0207641_104936742 | 208 |
| 94 | 3300026088 | Ga0207641_10855901 | Ga0207641_108559012 | 208 |
| 95 | 3300028556 | Ga0265337_1001944 | Ga0265337_100194410 | 208 |
| 96 | 3300028556 | Ga0265337_1018834 | Ga0265337_10188344 | 208 |
| 97 | 3300028556 | Ga0265337_1033539 | Ga0265337_10335392 | 208 |
| 98 | 3300028556 | Ga0265337_1061247 | Ga0265337_10612472 | 208 |
| 99 | 3300028558 | Ga0265326_10072030 | Ga0265326_100720302 | 208 |
| 100 | 3300028563 | Ga0265319_1000019 | Ga0265319_1000019139 | 208 |
| 101 | 3300028563 | Ga0265319_1005191 | Ga0265319_10051913 | 208 |
| 102 | 3300028573 | Ga0265334_10010655 | Ga0265334_100106552 | 208 |
| 103 | 3300028573 | Ga0265334_10045702 | Ga0265334_100457022 | 208 |
| 104 | 3300028573 | Ga0265334_10140279 | Ga0265334_101402792 | 208 |
| 105 | 3300028577 | Ga0265318_10015457 | Ga0265318_100154575 | 208 |
| 106 | 3300028653 | Ga0265323_10000705 | Ga0265323_100007055 | 208 |
| 107 | 3300028653 | Ga0265323_10008337 | Ga0265323_100083373 | 208 |
| 108 | 3300028653 | Ga0265323_10023435 | Ga0265323_100234353 | 208 |
| 109 | 3300028654 | Ga0265322_10085846 | Ga0265322_100858462 | 208 |
| 110 | 3300028666 | Ga0265336_10046426 | Ga0265336_100464262 | 208 |
| 111 | 3300028666 | Ga0265336_10068824 | Ga0265336_100688242 | 208 |
| 112 | 3300028800 | Ga0265338_10001116 | Ga0265338_100011164 | 208 |
| 113 | 3300028800 | Ga0265338_10008216 | Ga0265338_100082166 | 208 |
| 114 | 3300028800 | Ga0265338_10033436 | Ga0265338_100334362 | 208 |
| 115 | 3300028800 | Ga0265338_10037374 | Ga0265338_100373746 | 208 |
| 116 | 3300028800 | Ga0265338_10060858 | Ga0265338_100608584 | 208 |
| 117 | 3300028800 | Ga0265338_10086023 | Ga0265338_100860232 | 208 |
| 118 | 3300028800 | Ga0265338_10092010 | Ga0265338_100920102 | 208 |
| 119 | 3300028800 | Ga0265338_10127489 | Ga0265338_101274893 | 208 |
| 120 | 3300028800 | Ga0265338_10191869 | Ga0265338_101918692 | 208 |
| 121 | 3300028800 | Ga0265338_10231025 | Ga0265338_102310252 | 208 |
| 122 | 3300028800 | Ga0265338_10280982 | Ga0265338_102809822 | 208 |
| 123 | 3300028800 | Ga0265338_10370896 | Ga0265338_103708962 | 208 |
| 124 | 3300029957 | Ga0265324_10000595 | Ga0265324_1000059513 | 208 |
| 125 | 3300029957 | Ga0265324_10023173 | Ga0265324_100231734 | 208 |
| 126 | 3300029957 | Ga0265324_10129316 | Ga0265324_101293162 | 208 |
| 127 | 3300031235 | Ga0265330_10089129 | Ga0265330_100891292 | 208 |
| 128 | 3300031240 | Ga0265320_10008500 | Ga0265320_100085003 | 208 |
| 129 | 3300031240 | Ga0265320_10021223 | Ga0265320_100212234 | 208 |
| 130 | 3300031241 | Ga0265325_10024697 | Ga0265325_100246974 | 208 |
| 131 | 3300031241 | Ga0265325_10030693 | Ga0265325_100306932 | 208 |
| 132 | 3300031247 | Ga0265340_10001439 | Ga0265340_1000143912 | 208 |
| 133 | 3300031247 | Ga0265340_10004740 | Ga0265340_100047403 | 208 |
| 134 | 3300031247 | Ga0265340_10050991 | Ga0265340_100509912 | 208 |
| 135 | 3300031247 | Ga0265340_10153636 | Ga0265340_101536362 | 208 |
| 136 | 3300031249 | Ga0265339_10286007 | Ga0265339_102860072 | 208 |
| 137 | 3300031250 | Ga0265331_10233599 | Ga0265331_102335991 | 208 |
| 138 | 3300031251 | Ga0265327_10002276 | Ga0265327_100022769 | 208 |
| 139 | 3300031344 | Ga0265316_10006174 | Ga0265316_1000617418 | 208 |
| 140 | 3300031344 | Ga0265316_10013826 | Ga0265316_100138265 | 208 |
| 141 | 3300031595 | Ga0265313_10000967 | Ga0265313_1000096723 | 208 |
| 142 | 3300031711 | Ga0265314_10009739 | Ga0265314_100097396 | 208 |
| 143 | 3300031712 | Ga0265342_10073216 | Ga0265342_100732162 | 208 |
| 144 | 3300031712 | Ga0265342_10188500 | Ga0265342_101885002 | 208 |
| 145 | 3300035116 | Ga0373945_0085809 | Ga0373945_0085809_248_874 | 208 |
| 146 | 3300035117 | Ga0373953_0203450 | Ga0373953_0203450_204_830 | 208 |
| 147 | 3300035118 | Ga0373954_0005809 | Ga0373954_0005809_3574_4200 | 208 |
| 148 | 3300035118 | Ga0373954_0015764 | Ga0373954_0015764_1160_1786 | 208 |
| 149 | 3300035119 | Ga0373956_0002468 | Ga0373956_0002468_1491_2117 | 208 |
| 150 | 3300035170 | Ga0373943_0105544 | Ga0373943_0105544_781_1407 | 208 |
| 151 | 3300035172 | Ga0373955_0165219 | Ga0373955_0165219_165_791 | 208 |
| 152 | 3300035691 | Ga0373931_0026189 | Ga0373931_0026189_2138_2764 | 208 |
| 153 | 3300035691 | Ga0373931_0185715 | Ga0373931_0185715_442_1068 | 208 |
| 154 | 3300035691 | Ga0373931_0267549 | Ga0373931_0267549_73_699 | 208 |
| 155 | 3300035692 | Ga0373935_0057695 | Ga0373935_0057695_1020_1646 | 208 |
| 156 | 3300035695 | Ga0373927_0003068 | Ga0373927_0003068_8324_8950 | 208 |
| 157 | 3300035695 | Ga0373927_0003238 | Ga0373927_0003238_7077_7703 | 208 |
| 158 | 3300035725 | Ga0373947_0006206 | Ga0373947_0006206_1435_2061 | 208 |
| 159 | 3300036401 | Ga0373937_0050399 | Ga0373937_0050399_606_1232 | 208 |
| 160 | 3300036401 | Ga0373937_0508417 | Ga0373937_0508417_363_989 | 208 |
| 161 | 3300037068 | Ga0373925_0004609 | Ga0373925_0004609_4217_4843 | 208 |
| 162 | 3300037068 | Ga0373925_0007979 | Ga0373925_0007979_827_1453 | 208 |
| 163 | 3300041503 | Ga0451847_0252879 | Ga0451847_0252879_47_673 | 208 |
| 164 | 3300045051 | Ga0451576_0027354 | Ga0451576_0027354_5037_5663 | 208 |
| 165 | 3300045051 | Ga0451576_0663470 | Ga0451576_0663470_341_967 | 208 |
| 166 | 3300045051 | Ga0451576_1015126 | Ga0451576_1015126_50_676 | 208 |
| 167 | 3300046459 | Ga0495629_0131060 | Ga0495629_0131060_19_645 | 208 |
| 168 | 3300046475 | Ga0495639_0091448 | Ga0495639_0091448_611_1237 | 208 |
| 169 | 3300046475 | Ga0495639_0097662 | Ga0495639_0097662_66_692 | 208 |
| 170 | 3300046476 | Ga0495662_0106370 | Ga0495662_0106370_536_1162 | 208 |
| 171 | 3300046477 | Ga0495664_0134314 | Ga0495664_0134314_143_769 | 208 |
| 172 | 3300046511 | Ga0495608_0123405 | Ga0495608_0123405_676_1302 | 208 |
| 173 | 3300046514 | Ga0495618_0001918 | Ga0495618_0001918_1208_1834 | 208 |
| 174 | 3300046514 | Ga0495618_0338599 | Ga0495618_0338599_56_682 | 208 |
| 175 | 3300046517 | Ga0495630_0113287 | Ga0495630_0113287_810_1436 | 208 |
| 176 | 3300046526 | Ga0495666_0054477 | Ga0495666_0054477_957_1583 | 208 |
| 177 | 3300046533 | Ga0495640_0097921 | Ga0495640_0097921_576_1202 | 208 |
| 178 | 3300046535 | Ga0495586_0001803 | Ga0495586_0001803_4946_5572 | 208 |
| 179 | 3300046535 | Ga0495586_0010221 | Ga0495586_0010221_2055_2681 | 208 |
| 180 | 3300046535 | Ga0495586_0419864 | Ga0495586_0419864_126_752 | 208 |
| 181 | 3300046536 | Ga0495587_0086211 | Ga0495587_0086211_703_1329 | 208 |
| 182 | 3300046536 | Ga0495587_0315842 | Ga0495587_0315842_175_801 | 208 |
| 183 | 3300046543 | Ga0495645_0178243 | Ga0495645_0178243_702_1328 | 208 |
| 184 | 3300046543 | Ga0495645_0217045 | Ga0495645_0217045_253_879 | 208 |
| 185 | 3300046557 | Ga0495622_0024445 | Ga0495622_0024445_1427_2053 | 208 |
| 186 | 3300046559 | Ga0495667_0030872 | Ga0495667_0030872_2509_3135 | 208 |
| 187 | 3300046642 | Ga0495634_0011847 | Ga0495634_0011847_2009_2635 | 208 |
| 188 | 3300046663 | Ga0495635_0088808 | Ga0495635_0088808_76_702 | 208 |
| 189 | 3300046680 | Ga0495646_0243898 | Ga0495646_0243898_102_728 | 208 |
| 190 | 3300046683 | Ga0495658_0157094 | Ga0495658_0157094_692_1318 | 208 |
| 191 | 3300046689 | Ga0495613_0005543 | Ga0495613_0005543_3342_3968 | 208 |
| 192 | 3300046690 | Ga0495624_0039202 | Ga0495624_0039202_1771_2397 | 208 |
| 193 | 3300047315 | Ga0495581_0358488 | Ga0495581_0358488_110_736 | 208 |
| 194 | 3300047319 | Ga0495674_0053330 | Ga0495674_0053330_764_1390 | 208 |
| 195 | 3300047319 | Ga0495674_0099624 | Ga0495674_0099624_1420_2046 | 208 |
| 196 | 3300047321 | Ga0495676_0130793 | Ga0495676_0130793_431_1057 | 208 |
| 197 | 3300047322 | Ga0495680_0002262 | Ga0495680_0002262_16671_17297 | 208 |
| 198 | 3300047322 | Ga0495680_0155252 | Ga0495680_0155252_642_1268 | 208 |
| 199 | 3300047471 | Ga0495684_0080365 | Ga0495684_0080365_772_1398 | 208 |
| 200 | 3300047471 | Ga0495684_0092186 | Ga0495684_0092186_117_743 | 208 |
| 201 | 3300048914 | Ga0496111_0426133 | Ga0496111_0426133_237_863 | 208 |
| 202 | 3300048915 | Ga0496112_0389557 | Ga0496112_0389557_85_711 | 208 |
| 203 | 3300048918 | Ga0496115_0097881 | Ga0496115_0097881_1639_2265 | 208 |
| 204 | 3300049575 | Ga0501039_0160331 | Ga0501039_0160331_688_1320 | 208 |
| 205 | 3300049579 | Ga0501043_0136634 | Ga0501043_0136634_902_1534 | 208 |
| 206 | 3300049581 | Ga0501047_0099947 | Ga0501047_0099947_277_909 | 208 |
| 207 | 3300004799 | Ga0058863_10022309 | Ga0058863_100223092 | 209 |
| 208 | 3300004800 | Ga0058861_11907353 | Ga0058861_119073532 | 209 |
| 209 | 3300004803 | Ga0058862_12724094 | Ga0058862_127240942 | 209 |
| 210 | 3300005329 | Ga0070683_100114843 | Ga0070683_1001148432 | 209 |
| 211 | 3300005340 | Ga0070689_100172649 | Ga0070689_1001726491 | 209 |
| 212 | 3300005455 | Ga0070663_100451974 | Ga0070663_1004519741 | 209 |
| 213 | 3300005458 | Ga0070681_10466376 | Ga0070681_104663762 | 209 |
| 214 | 3300009093 | Ga0105240_10122487 | Ga0105240_101224875 | 209 |
| 215 | 3300009093 | Ga0105240_10342691 | Ga0105240_103426912 | 209 |
| 216 | 3300013100 | Ga0157373_10385085 | Ga0157373_103850852 | 209 |
| 217 | 3300013104 | Ga0157370_10139213 | Ga0157370_101392133 | 209 |
| 218 | 3300025911 | Ga0207654_10343390 | Ga0207654_103433901 | 209 |
| 219 | 3300025913 | Ga0207695_10179846 | Ga0207695_101798463 | 209 |
| 220 | 3300025913 | Ga0207695_10504293 | Ga0207695_105042932 | 209 |
| 221 | 3300025917 | Ga0207660_10190947 | Ga0207660_101909472 | 209 |
| 222 | 3300025919 | Ga0207657_10431906 | Ga0207657_104319062 | 209 |
| 223 | 3300025921 | Ga0207652_10228429 | Ga0207652_102284292 | 209 |
| 224 | 3300025924 | Ga0207694_10008352 | Ga0207694_100083523 | 209 |
| 225 | 3300025932 | Ga0207690_10155633 | Ga0207690_101556332 | 209 |
| 226 | 3300025944 | Ga0207661_10088974 | Ga0207661_100889742 | 209 |
| 227 | 3300025949 | Ga0207667_10089541 | Ga0207667_100895413 | 209 |
| 228 | 3300026067 | Ga0207678_10497598 | Ga0207678_104975982 | 209 |
| 229 | 3300026078 | Ga0207702_10609001 | Ga0207702_106090012 | 209 |
| 230 | 3300026116 | Ga0207674_11240060 | Ga0207674_112400601 | 209 |
| 231 | 3300028800 | Ga0265338_10002943 | Ga0265338_1000294310 | 209 |
| 232 | 3300044842 | Ga0466957_0170933 | Ga0466957_0170933_27_656 | 209 |
| 233 | 3300049460 | Ga0495682_0029959 | Ga0495682_0029959_242_871 | 209 |
| 234 | 3300049569 | Ga0501032_0276833 | Ga0501032_0276833_229_858 | 209 |
| 235 | 3300049570 | Ga0501033_0041982 | Ga0501033_0041982_1981_2610 | 209 |
| 236 | 3300049579 | Ga0501043_0402600 | Ga0501043_0402600_39_668 | 209 |
| 237 | 3300050511 | nmdc:mga08y16_116291_c1 | nmdc:mga08y16_116291_c1_2083_2715 | 209 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c9b-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.9121 | 1 | 205 |
| 8c97-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.9056 | 1 | 205 |
| 8c9b-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.9006 | 1 | 205 |
| 8c97-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.894 | 1 | 205 |
| 7ode-assembly1.cif.gz_M | e. coli 50s ribosome licl core particle | 0.8515 | 1 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1dmgA00 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7858 | 1 | 205 | 3.40.1370.10 |
| 1dmgA00 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7771 | 1 | 205 | 3.40.1370.10 |
| af_Q2FW07_2_206_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7511 | 1 | 204 | 3.40.1370.10 |
| af_Q2FW07_2_206_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.744 | 1 | 204 | 3.40.1370.10 |
| af_P60723_1_201_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7373 | 1 | 205 | 3.40.1370.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y8S3F3-F1-model_v4 | deleted | 0.9842 | 99 | 205 |
|
| AF-A0A380DTQ1-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9791 | 100 | 205 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A536U9H5-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9789 | 100 | 205 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A645JEY8-F1-model_v4 | 50S ribosomal protein L4 | 0.9774 | 112 | 204 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A645G5W3-F1-model_v4 | 50S ribosomal protein L4 | 0.9755 | 106 | 205 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar