F350111

General Info

Members Datasets Scaffolds Average Seq Length
237 133 237 208

Family's Representative Sequence

Representative Sequence 3300028556|Ga0265337_1003945|Ga0265337_10039454
Length 207
Sequence MKIAIKNIEGKKSGELEVKFPLIEDGKGTQAVHDVVVAYRAAQRSGTACTKNVGEVSGSNKKPWRQKGTGRARAGSHQSPLWVGGGVVFGPKPRDFSKKVSKSTRALALRKALSERLKAGDVVVVDDLKLSSPKTKDFVGLMSTLELTGTTLIVAAADKNLTLASRNVPDVALATSDSLNTYDILRPDKLLFTKGAFEKVEARLTKE

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
55 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
56 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
57 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
58 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
59 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
60 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
61 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
64 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
65 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
66 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
76 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
77 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
78 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
79 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
80 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
81 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
90 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
94 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
95 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
96 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
97 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
98 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
105 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
106 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
107 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
108 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
116 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
121 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.47
Metatranscriptomes 2.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.11
Rhizosphere 97.05
Stem 0
Stem Tuber 0
Unclassified 0.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_10022309 3300004799 Bacteria 1358
2 Ga0058861_11907353 3300004800 Bacteria 1940
3 Ga0058862_12724094 3300004803 Bacteria 913
4 Ga0070683_100114843 3300005329 Bacteria 2541
5 Ga0070690_100027728 3300005330 Bacteria 3503
6 Ga0070690_100081266 3300005330 Bacteria 2120
7 Ga0070690_100423285 3300005330 Unclassified 982
8 Ga0070666_10052352 3300005335 Bacteria 2751
9 Ga0070689_100039175 3300005340 Bacteria 3628
10 Ga0070689_100113198 3300005340 Bacteria 2160
11 Ga0070689_100172649 3300005340 Bacteria 1752
12 Ga0070687_100177738 3300005343 Bacteria 1272
13 Ga0070714_100013066 3300005435 Bacteria 6646
14 Ga0070711_100314444 3300005439 Eukaryota 1249
15 Ga0070663_100451974 3300005455 Bacteria 1059
16 Ga0070681_10466376 3300005458 Bacteria 1175
17 Ga0070685_10685091 3300005466 Bacteria 746
18 Ga0070686_100011524 3300005544 Bacteria 5016
19 Ga0068855_100023610 3300005563 Bacteria 7366
20 Ga0068855_100164847 3300005563 Bacteria 2513
21 Ga0068856_100139830 3300005614 Bacteria 2428
22 Ga0068856_100421019 3300005614 Bacteria 1355
23 Ga0068856_100577338 3300005614 Bacteria 1145
24 Ga0068859_100003547 3300005617 Bacteria 15891
25 Ga0068859_100334331 3300005617 Bacteria 1609
26 Ga0068864_100149170 3300005618 Bacteria 2117
27 Ga0068863_100094323 3300005841 Bacteria 2840
28 Ga0068863_100859491 3300005841 Bacteria 906
29 Ga0070716_100435438 3300006173 Bacteria 952
30 Ga0097621_100599889 3300006237 Bacteria 1006
31 Ga0075433_10363631 3300006852 Unclassified 1278
32 Ga0097620_100003547 3300006931 Bacteria 15891
33 Ga0097620_100334348 3300006931 Bacteria 1609
34 Ga0097620_100737772 3300006931 Bacteria 1074
35 Ga0105240_10002027 3300009093 Bacteria 33415
36 Ga0105240_10122487 3300009093 Bacteria 3129
37 Ga0105240_10342691 3300009093 Bacteria 1697
38 Ga0105240_10362696 3300009093 Bacteria 1641
39 Ga0105242_10361773 3300009176 Unclassified 1343
40 Ga0105242_10467421 3300009176 Bacteria 1192
41 Ga0105242_10834476 3300009176 Bacteria 915
42 Ga0105238_10002594 3300009551 Bacteria 18015
43 Ga0105238_10152407 3300009551 Bacteria 2287
44 Ga0157373_10385085 3300013100 Bacteria 1003
45 Ga0157370_10139213 3300013104 Bacteria 2261
46 Ga0157374_10605774 3300013296 Bacteria 1105
47 Ga0157375_10000037 3300013308 Bacteria 176523
48 Ga0157375_10083439 3300013308 Bacteria 3241
49 Ga0163163_10013561 3300014325 Bacteria 7465
50 Ga0206354_10002870 3300020081 Bacteria 1015
51 Ga0207680_10195918 3300025903 Bacteria 1374
52 Ga0207654_10343390 3300025911 Bacteria 1026
53 Ga0207695_10007847 3300025913 Bacteria 13492
54 Ga0207695_10179846 3300025913 Bacteria 2036
55 Ga0207695_10224098 3300025913 Bacteria 1787
56 Ga0207695_10504293 3300025913 Bacteria 1092
57 Ga0207693_10438350 3300025915 Bacteria 1021
58 Ga0207660_10190947 3300025917 Bacteria 1595
59 Ga0207662_10312257 3300025918 Bacteria 1047
60 Ga0207657_10431906 3300025919 Bacteria 1034
61 Ga0207652_10228429 3300025921 Bacteria 1677
62 Ga0207652_10559213 3300025921 Unclassified 1028
63 Ga0207694_10008352 3300025924 Bacteria 7826
64 Ga0207694_10010531 3300025924 Bacteria 6975
65 Ga0207694_10099102 3300025924 Bacteria 2308
66 Ga0207664_10013296 3300025929 Bacteria 5903
67 Ga0207690_10155633 3300025932 Bacteria 1699
68 Ga0207686_10291331 3300025934 Bacteria 1209
69 Ga0207670_10039940 3300025936 Bacteria 3077
70 Ga0207665_10205979 3300025939 Bacteria 1435
71 Ga0207661_10088974 3300025944 Bacteria 2568
72 Ga0207667_10020158 3300025949 Bacteria 7423
73 Ga0207667_10033875 3300025949 Bacteria 5488
74 Ga0207667_10089541 3300025949 Bacteria 3180
75 Ga0207703_10341293 3300026035 Bacteria 1377
76 Ga0207678_10497598 3300026067 Bacteria 1062
77 Ga0207702_10609001 3300026078 Bacteria 1072
78 Ga0207641_10493674 3300026088 Unclassified 1188
79 Ga0207641_10855901 3300026088 Unclassified 901
80 Ga0207674_11240060 3300026116 Bacteria 715
81 Ga0265337_1001944 3300028556 Bacteria 9819
82 Ga0265337_1003945 3300028556 Bacteria 6282
83 Ga0265337_1018834 3300028556 Bacteria 2185
84 Ga0265337_1033539 3300028556 Bacteria 1514
85 Ga0265337_1059450 3300028556 Bacteria 1061
86 Ga0265337_1061247 3300028556 Bacteria 1043
87 Ga0265326_10072030 3300028558 Bacteria 977
88 Ga0265326_10074918 3300028558 Bacteria 957
89 Ga0265319_1000019 3300028563 Bacteria 154537
90 Ga0265319_1005191 3300028563 Bacteria 6293
91 Ga0265319_1032095 3300028563 Bacteria 1824
92 Ga0265334_10010655 3300028573 Bacteria 3881
93 Ga0265334_10045702 3300028573 Bacteria 1695
94 Ga0265334_10140279 3300028573 Bacteria 856
95 Ga0265318_10015457 3300028577 Bacteria 3174
96 Ga0265323_10000705 3300028653 Bacteria 18171
97 Ga0265323_10008337 3300028653 Bacteria 4279
98 Ga0265323_10023435 3300028653 Bacteria 2353
99 Ga0265322_10018664 3300028654 Bacteria 1993
100 Ga0265322_10085846 3300028654 Bacteria 894
101 Ga0265336_10010845 3300028666 Bacteria 3110
102 Ga0265336_10046426 3300028666 Bacteria 1320
103 Ga0265336_10068824 3300028666 Bacteria 1058
104 Ga0265338_10000831 3300028800 Bacteria 52074
105 Ga0265338_10000987 3300028800 Bacteria 47972
106 Ga0265338_10001116 3300028800 Bacteria 44580
107 Ga0265338_10002943 3300028800 Bacteria 24701
108 Ga0265338_10008151 3300028800 Bacteria 12785
109 Ga0265338_10008216 3300028800 Bacteria 12711
110 Ga0265338_10025901 3300028800 Bacteria 5931
111 Ga0265338_10033436 3300028800 Bacteria 4990
112 Ga0265338_10037374 3300028800 Bacteria 4622
113 Ga0265338_10060858 3300028800 Bacteria 3312
114 Ga0265338_10072654 3300028800 Bacteria 2936
115 Ga0265338_10086023 3300028800 Bacteria 2618
116 Ga0265338_10092010 3300028800 Bacteria 2503
117 Ga0265338_10127489 3300028800 Bacteria 2016
118 Ga0265338_10147046 3300028800 Bacteria 1837
119 Ga0265338_10191869 3300028800 Unclassified 1548
120 Ga0265338_10214507 3300028800 Unclassified 1442
121 Ga0265338_10231025 3300028800 Bacteria 1376
122 Ga0265338_10280982 3300028800 Bacteria 1216
123 Ga0265338_10370896 3300028800 Bacteria 1025
124 Ga0265338_10590729 3300028800 Unclassified 774
125 Ga0265324_10000595 3300029957 Bacteria 24811
126 Ga0265324_10023173 3300029957 Bacteria 2213
127 Ga0265324_10064420 3300029957 Eukaryota 1251
128 Ga0265324_10129316 3300029957 Bacteria 857
129 Ga0265330_10089129 3300031235 Bacteria 1325
130 Ga0265320_10008500 3300031240 Bacteria 6281
131 Ga0265320_10021223 3300031240 Bacteria 3499
132 Ga0265320_10043314 3300031240 Bacteria 2226
133 Ga0265325_10024697 3300031241 Bacteria 3267
134 Ga0265325_10030693 3300031241 Unclassified 2880
135 Ga0265340_10001439 3300031247 Bacteria 13655
136 Ga0265340_10004740 3300031247 Bacteria 7561
137 Ga0265340_10050991 3300031247 Bacteria 2005
138 Ga0265340_10153636 3300031247 Unclassified 1048
139 Ga0265339_10212869 3300031249 Bacteria 949
140 Ga0265339_10286007 3300031249 Bacteria 789
141 Ga0265331_10233599 3300031250 Bacteria 826
142 Ga0265327_10002276 3300031251 Bacteria 20633
143 Ga0265316_10006174 3300031344 Bacteria 11492
144 Ga0265316_10013826 3300031344 Bacteria 7147
145 Ga0265316_10088655 3300031344 Bacteria 2362
146 Ga0265313_10000967 3300031595 Bacteria 28455
147 Ga0265314_10009739 3300031711 Bacteria 8079
148 Ga0265342_10073216 3300031712 Bacteria 1993
149 Ga0265342_10138736 3300031712 Bacteria 1357
150 Ga0265342_10188500 3300031712 Bacteria 1126
151 Ga0373945_0085809 3300035116 Bacteria 1212
152 Ga0373953_0203450 3300035117 Bacteria 856
153 Ga0373954_0005809 3300035118 Bacteria 5358
154 Ga0373954_0015764 3300035118 Bacteria 3380
155 Ga0373956_0002468 3300035119 Bacteria 7527
156 Ga0373943_0105544 3300035170 Bacteria 1479
157 Ga0373946_0098370 3300035171 Unclassified 1308
158 Ga0373955_0165219 3300035172 Bacteria 1308
159 Ga0373931_0026189 3300035691 Bacteria 2966
160 Ga0373931_0185715 3300035691 Bacteria 1234
161 Ga0373931_0267549 3300035691 Unclassified 1045
162 Ga0373935_0057695 3300035692 Bacteria 2477
163 Ga0373927_0003068 3300035695 Bacteria 12108
164 Ga0373927_0003238 3300035695 Bacteria 11717
165 Ga0373947_0006206 3300035725 Bacteria 6951
166 Ga0373937_0050399 3300036401 Bacteria 3813
167 Ga0373937_0508417 3300036401 Bacteria 1145
168 Ga0310109_021624 3300036534 Bacteria 866
169 Ga0373925_0004609 3300037068 Bacteria 10409
170 Ga0373925_0007979 3300037068 Bacteria 7707
171 Ga0451805_009148 3300041461 Bacteria 1008
172 Ga0451847_0252879 3300041503 Bacteria 710
173 Ga0466957_0170933 3300044842 Bacteria 1416
174 Ga0451576_0027354 3300045051 Bacteria 6126
175 Ga0451576_0390716 3300045051 Unclassified 1458
176 Ga0451576_0663470 3300045051 Bacteria 1096
177 Ga0451576_1015126 3300045051 Bacteria 869
178 Ga0451576_1129329 3300045051 Bacteria 820
179 Ga0495629_0131060 3300046459 Bacteria 1746
180 Ga0495641_0097718 3300046461 Unclassified 1310
181 Ga0495582_0040413 3300046473 Unclassified 2569
182 Ga0495639_0091448 3300046475 Bacteria 1428
183 Ga0495639_0097662 3300046475 Bacteria 1384
184 Ga0495662_0044220 3300046476 Unclassified 2150
185 Ga0495662_0106370 3300046476 Bacteria 1374
186 Ga0495664_0134314 3300046477 Bacteria 1499
187 Ga0495608_0123405 3300046511 Bacteria 1660
188 Ga0495618_0001918 3300046514 Bacteria 13659
189 Ga0495618_0338599 3300046514 Bacteria 929
190 Ga0495630_0000065 3300046517 Bacteria 85152
191 Ga0495630_0113287 3300046517 Bacteria 2055
192 Ga0495666_0007428 3300046526 Bacteria 5494
193 Ga0495666_0054477 3300046526 Bacteria 1918
194 Ga0495652_0153743 3300046529 Bacteria 1794
195 Ga0495640_0097921 3300046533 Bacteria 1928
196 Ga0495586_0000012 3300046535 Bacteria 138093
197 Ga0495586_0001803 3300046535 Bacteria 11704
198 Ga0495586_0010221 3300046535 Bacteria 4990
199 Ga0495586_0419864 3300046535 Unclassified 770
200 Ga0495587_0086211 3300046536 Bacteria 1817
201 Ga0495587_0315842 3300046536 Unclassified 873
202 Ga0495645_0178243 3300046543 Bacteria 1458
203 Ga0495645_0217045 3300046543 Bacteria 1288
204 Ga0495622_0024445 3300046557 Bacteria 2821
205 Ga0495667_0030872 3300046559 Bacteria 3599
206 Ga0495634_0011847 3300046642 Bacteria 6339
207 Ga0495634_0045078 3300046642 Unclassified 2983
208 Ga0495635_0088808 3300046663 Bacteria 2115
209 Ga0495646_0243898 3300046680 Bacteria 965
210 Ga0495658_0157094 3300046683 Bacteria 1400
211 Ga0495613_0005543 3300046689 Bacteria 9477
212 Ga0495624_0039202 3300046690 Bacteria 3038
213 Ga0495581_0136253 3300047315 Unclassified 1431
214 Ga0495581_0358488 3300047315 Bacteria 851
215 Ga0495674_0000385 3300047319 Bacteria 39496
216 Ga0495674_0053330 3300047319 Bacteria 3555
217 Ga0495674_0099624 3300047319 Bacteria 2474
218 Ga0495676_0028212 3300047321 Unclassified 4799
219 Ga0495676_0130793 3300047321 Bacteria 1812
220 Ga0495680_0002262 3300047322 Bacteria 19840
221 Ga0495680_0155252 3300047322 Unclassified 1666
222 Ga0495684_0080365 3300047471 Bacteria 2475
223 Ga0495684_0092186 3300047471 Bacteria 2295
224 Ga0495614_0106640 3300048089 Unclassified 1228
225 Ga0496107_0010537 3300048910 Bacteria 6425
226 Ga0496111_0426133 3300048914 Bacteria 980
227 Ga0496112_0389557 3300048915 Bacteria 1334
228 Ga0496115_0097881 3300048918 Bacteria 2402
229 Ga0495682_0029959 3300049460 Bacteria 2015
230 Ga0501032_0276833 3300049569 Bacteria 1087
231 Ga0501033_0041982 3300049570 Bacteria 3411
232 Ga0501039_0160331 3300049575 Bacteria 1768
233 Ga0501043_0136634 3300049579 Bacteria 1920
234 Ga0501043_0402600 3300049579 Bacteria 1034
235 Ga0501047_0099947 3300049581 Bacteria 2780
236 nmdc:mga08y16_116291_c1 3300050511 Bacteria 2784
237 nmdc:mga0a205_825209_c1 3300050515 Unclassified 775

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_1129329 Ga0451576_1129329_277_798 173
2 3300028800 Ga0265338_10072654 Ga0265338_100726543 192
3 3300005614 Ga0068856_100139830 Ga0068856_1001398302 202
4 3300028563 Ga0265319_1032095 Ga0265319_10320953 206
5 3300005330 Ga0070690_100423285 Ga0070690_1004232851 207
6 3300005340 Ga0070689_100039175 Ga0070689_1000391755 207
7 3300006173 Ga0070716_100435438 Ga0070716_1004354382 207
8 3300006852 Ga0075433_10363631 Ga0075433_103636312 207
9 3300009551 Ga0105238_10152407 Ga0105238_101524072 207
10 3300025924 Ga0207694_10099102 Ga0207694_100991023 207
11 3300025936 Ga0207670_10039940 Ga0207670_100399403 207
12 3300025939 Ga0207665_10205979 Ga0207665_102059792 207
13 3300028556 Ga0265337_1003945 Ga0265337_10039454 207
14 3300028556 Ga0265337_1059450 Ga0265337_10594502 207
15 3300028558 Ga0265326_10074918 Ga0265326_100749182 207
16 3300028654 Ga0265322_10018664 Ga0265322_100186642 207
17 3300028666 Ga0265336_10010845 Ga0265336_100108453 207
18 3300028800 Ga0265338_10000831 Ga0265338_1000083150 207
19 3300028800 Ga0265338_10000987 Ga0265338_1000098731 207
20 3300028800 Ga0265338_10008151 Ga0265338_100081518 207
21 3300028800 Ga0265338_10025901 Ga0265338_100259017 207
22 3300028800 Ga0265338_10147046 Ga0265338_101470462 207
23 3300028800 Ga0265338_10214507 Ga0265338_102145073 207
24 3300028800 Ga0265338_10590729 Ga0265338_105907292 207
25 3300029957 Ga0265324_10064420 Ga0265324_100644202 207
26 3300031240 Ga0265320_10043314 Ga0265320_100433142 207
27 3300031249 Ga0265339_10212869 Ga0265339_102128692 207
28 3300031344 Ga0265316_10088655 Ga0265316_100886552 207
29 3300031712 Ga0265342_10138736 Ga0265342_101387362 207
30 3300035171 Ga0373946_0098370 Ga0373946_0098370_95_718 207
31 3300036534 Ga0310109_021624 Ga0310109_021624_65_688 207
32 3300041461 Ga0451805_009148 Ga0451805_009148_242_868 207
33 3300045051 Ga0451576_0390716 Ga0451576_0390716_150_773 207
34 3300046461 Ga0495641_0097718 Ga0495641_0097718_77_700 207
35 3300046473 Ga0495582_0040413 Ga0495582_0040413_99_722 207
36 3300046476 Ga0495662_0044220 Ga0495662_0044220_512_1135 207
37 3300046517 Ga0495630_0000065 Ga0495630_0000065_15354_15977 207
38 3300046526 Ga0495666_0007428 Ga0495666_0007428_2265_2888 207
39 3300046529 Ga0495652_0153743 Ga0495652_0153743_125_748 207
40 3300046535 Ga0495586_0000012 Ga0495586_0000012_119459_120082 207
41 3300046642 Ga0495634_0045078 Ga0495634_0045078_495_1118 207
42 3300047315 Ga0495581_0136253 Ga0495581_0136253_532_1155 207
43 3300047319 Ga0495674_0000385 Ga0495674_0000385_12029_12652 207
44 3300047321 Ga0495676_0028212 Ga0495676_0028212_247_870 207
45 3300048089 Ga0495614_0106640 Ga0495614_0106640_123_746 207
46 3300048910 Ga0496107_0010537 Ga0496107_0010537_4568_5191 207
47 3300050515 nmdc:mga0a205_825209_c1 nmdc:mga0a205_825209_c1_49_672 207
48 3300005330 Ga0070690_100027728 Ga0070690_1000277281 208
49 3300005330 Ga0070690_100081266 Ga0070690_1000812663 208
50 3300005335 Ga0070666_10052352 Ga0070666_100523522 208
51 3300005340 Ga0070689_100113198 Ga0070689_1001131984 208
52 3300005343 Ga0070687_100177738 Ga0070687_1001777382 208
53 3300005435 Ga0070714_100013066 Ga0070714_1000130664 208
54 3300005439 Ga0070711_100314444 Ga0070711_1003144442 208
55 3300005466 Ga0070685_10685091 Ga0070685_106850911 208
56 3300005544 Ga0070686_100011524 Ga0070686_1000115246 208
57 3300005563 Ga0068855_100023610 Ga0068855_1000236105 208
58 3300005563 Ga0068855_100164847 Ga0068855_1001648473 208
59 3300005614 Ga0068856_100421019 Ga0068856_1004210192 208
60 3300005614 Ga0068856_100577338 Ga0068856_1005773382 208
61 3300005617 Ga0068859_100003547 Ga0068859_1000035479 208
62 3300005617 Ga0068859_100334331 Ga0068859_1003343313 208
63 3300005618 Ga0068864_100149170 Ga0068864_1001491702 208
64 3300005841 Ga0068863_100094323 Ga0068863_1000943234 208
65 3300005841 Ga0068863_100859491 Ga0068863_1008594911 208
66 3300006237 Ga0097621_100599889 Ga0097621_1005998892 208
67 3300006931 Ga0097620_100003547 Ga0097620_1000035479 208
68 3300006931 Ga0097620_100334348 Ga0097620_1003343482 208
69 3300006931 Ga0097620_100737772 Ga0097620_1007377722 208
70 3300009093 Ga0105240_10002027 Ga0105240_1000202717 208
71 3300009093 Ga0105240_10362696 Ga0105240_103626962 208
72 3300009176 Ga0105242_10361773 Ga0105242_103617731 208
73 3300009176 Ga0105242_10467421 Ga0105242_104674212 208
74 3300009176 Ga0105242_10834476 Ga0105242_108344761 208
75 3300009551 Ga0105238_10002594 Ga0105238_1000259411 208
76 3300013296 Ga0157374_10605774 Ga0157374_106057742 208
77 3300013308 Ga0157375_10000037 Ga0157375_10000037130 208
78 3300013308 Ga0157375_10083439 Ga0157375_100834392 208
79 3300014325 Ga0163163_10013561 Ga0163163_100135619 208
80 3300020081 Ga0206354_10002870 Ga0206354_100028702 208
81 3300025903 Ga0207680_10195918 Ga0207680_101959181 208
82 3300025913 Ga0207695_10007847 Ga0207695_100078477 208
83 3300025913 Ga0207695_10224098 Ga0207695_102240982 208
84 3300025915 Ga0207693_10438350 Ga0207693_104383502 208
85 3300025918 Ga0207662_10312257 Ga0207662_103122572 208
86 3300025921 Ga0207652_10559213 Ga0207652_105592132 208
87 3300025924 Ga0207694_10010531 Ga0207694_100105317 208
88 3300025929 Ga0207664_10013296 Ga0207664_100132963 208
89 3300025934 Ga0207686_10291331 Ga0207686_102913313 208
90 3300025949 Ga0207667_10020158 Ga0207667_100201585 208
91 3300025949 Ga0207667_10033875 Ga0207667_100338757 208
92 3300026035 Ga0207703_10341293 Ga0207703_103412932 208
93 3300026088 Ga0207641_10493674 Ga0207641_104936742 208
94 3300026088 Ga0207641_10855901 Ga0207641_108559012 208
95 3300028556 Ga0265337_1001944 Ga0265337_100194410 208
96 3300028556 Ga0265337_1018834 Ga0265337_10188344 208
97 3300028556 Ga0265337_1033539 Ga0265337_10335392 208
98 3300028556 Ga0265337_1061247 Ga0265337_10612472 208
99 3300028558 Ga0265326_10072030 Ga0265326_100720302 208
100 3300028563 Ga0265319_1000019 Ga0265319_1000019139 208
101 3300028563 Ga0265319_1005191 Ga0265319_10051913 208
102 3300028573 Ga0265334_10010655 Ga0265334_100106552 208
103 3300028573 Ga0265334_10045702 Ga0265334_100457022 208
104 3300028573 Ga0265334_10140279 Ga0265334_101402792 208
105 3300028577 Ga0265318_10015457 Ga0265318_100154575 208
106 3300028653 Ga0265323_10000705 Ga0265323_100007055 208
107 3300028653 Ga0265323_10008337 Ga0265323_100083373 208
108 3300028653 Ga0265323_10023435 Ga0265323_100234353 208
109 3300028654 Ga0265322_10085846 Ga0265322_100858462 208
110 3300028666 Ga0265336_10046426 Ga0265336_100464262 208
111 3300028666 Ga0265336_10068824 Ga0265336_100688242 208
112 3300028800 Ga0265338_10001116 Ga0265338_100011164 208
113 3300028800 Ga0265338_10008216 Ga0265338_100082166 208
114 3300028800 Ga0265338_10033436 Ga0265338_100334362 208
115 3300028800 Ga0265338_10037374 Ga0265338_100373746 208
116 3300028800 Ga0265338_10060858 Ga0265338_100608584 208
117 3300028800 Ga0265338_10086023 Ga0265338_100860232 208
118 3300028800 Ga0265338_10092010 Ga0265338_100920102 208
119 3300028800 Ga0265338_10127489 Ga0265338_101274893 208
120 3300028800 Ga0265338_10191869 Ga0265338_101918692 208
121 3300028800 Ga0265338_10231025 Ga0265338_102310252 208
122 3300028800 Ga0265338_10280982 Ga0265338_102809822 208
123 3300028800 Ga0265338_10370896 Ga0265338_103708962 208
124 3300029957 Ga0265324_10000595 Ga0265324_1000059513 208
125 3300029957 Ga0265324_10023173 Ga0265324_100231734 208
126 3300029957 Ga0265324_10129316 Ga0265324_101293162 208
127 3300031235 Ga0265330_10089129 Ga0265330_100891292 208
128 3300031240 Ga0265320_10008500 Ga0265320_100085003 208
129 3300031240 Ga0265320_10021223 Ga0265320_100212234 208
130 3300031241 Ga0265325_10024697 Ga0265325_100246974 208
131 3300031241 Ga0265325_10030693 Ga0265325_100306932 208
132 3300031247 Ga0265340_10001439 Ga0265340_1000143912 208
133 3300031247 Ga0265340_10004740 Ga0265340_100047403 208
134 3300031247 Ga0265340_10050991 Ga0265340_100509912 208
135 3300031247 Ga0265340_10153636 Ga0265340_101536362 208
136 3300031249 Ga0265339_10286007 Ga0265339_102860072 208
137 3300031250 Ga0265331_10233599 Ga0265331_102335991 208
138 3300031251 Ga0265327_10002276 Ga0265327_100022769 208
139 3300031344 Ga0265316_10006174 Ga0265316_1000617418 208
140 3300031344 Ga0265316_10013826 Ga0265316_100138265 208
141 3300031595 Ga0265313_10000967 Ga0265313_1000096723 208
142 3300031711 Ga0265314_10009739 Ga0265314_100097396 208
143 3300031712 Ga0265342_10073216 Ga0265342_100732162 208
144 3300031712 Ga0265342_10188500 Ga0265342_101885002 208
145 3300035116 Ga0373945_0085809 Ga0373945_0085809_248_874 208
146 3300035117 Ga0373953_0203450 Ga0373953_0203450_204_830 208
147 3300035118 Ga0373954_0005809 Ga0373954_0005809_3574_4200 208
148 3300035118 Ga0373954_0015764 Ga0373954_0015764_1160_1786 208
149 3300035119 Ga0373956_0002468 Ga0373956_0002468_1491_2117 208
150 3300035170 Ga0373943_0105544 Ga0373943_0105544_781_1407 208
151 3300035172 Ga0373955_0165219 Ga0373955_0165219_165_791 208
152 3300035691 Ga0373931_0026189 Ga0373931_0026189_2138_2764 208
153 3300035691 Ga0373931_0185715 Ga0373931_0185715_442_1068 208
154 3300035691 Ga0373931_0267549 Ga0373931_0267549_73_699 208
155 3300035692 Ga0373935_0057695 Ga0373935_0057695_1020_1646 208
156 3300035695 Ga0373927_0003068 Ga0373927_0003068_8324_8950 208
157 3300035695 Ga0373927_0003238 Ga0373927_0003238_7077_7703 208
158 3300035725 Ga0373947_0006206 Ga0373947_0006206_1435_2061 208
159 3300036401 Ga0373937_0050399 Ga0373937_0050399_606_1232 208
160 3300036401 Ga0373937_0508417 Ga0373937_0508417_363_989 208
161 3300037068 Ga0373925_0004609 Ga0373925_0004609_4217_4843 208
162 3300037068 Ga0373925_0007979 Ga0373925_0007979_827_1453 208
163 3300041503 Ga0451847_0252879 Ga0451847_0252879_47_673 208
164 3300045051 Ga0451576_0027354 Ga0451576_0027354_5037_5663 208
165 3300045051 Ga0451576_0663470 Ga0451576_0663470_341_967 208
166 3300045051 Ga0451576_1015126 Ga0451576_1015126_50_676 208
167 3300046459 Ga0495629_0131060 Ga0495629_0131060_19_645 208
168 3300046475 Ga0495639_0091448 Ga0495639_0091448_611_1237 208
169 3300046475 Ga0495639_0097662 Ga0495639_0097662_66_692 208
170 3300046476 Ga0495662_0106370 Ga0495662_0106370_536_1162 208
171 3300046477 Ga0495664_0134314 Ga0495664_0134314_143_769 208
172 3300046511 Ga0495608_0123405 Ga0495608_0123405_676_1302 208
173 3300046514 Ga0495618_0001918 Ga0495618_0001918_1208_1834 208
174 3300046514 Ga0495618_0338599 Ga0495618_0338599_56_682 208
175 3300046517 Ga0495630_0113287 Ga0495630_0113287_810_1436 208
176 3300046526 Ga0495666_0054477 Ga0495666_0054477_957_1583 208
177 3300046533 Ga0495640_0097921 Ga0495640_0097921_576_1202 208
178 3300046535 Ga0495586_0001803 Ga0495586_0001803_4946_5572 208
179 3300046535 Ga0495586_0010221 Ga0495586_0010221_2055_2681 208
180 3300046535 Ga0495586_0419864 Ga0495586_0419864_126_752 208
181 3300046536 Ga0495587_0086211 Ga0495587_0086211_703_1329 208
182 3300046536 Ga0495587_0315842 Ga0495587_0315842_175_801 208
183 3300046543 Ga0495645_0178243 Ga0495645_0178243_702_1328 208
184 3300046543 Ga0495645_0217045 Ga0495645_0217045_253_879 208
185 3300046557 Ga0495622_0024445 Ga0495622_0024445_1427_2053 208
186 3300046559 Ga0495667_0030872 Ga0495667_0030872_2509_3135 208
187 3300046642 Ga0495634_0011847 Ga0495634_0011847_2009_2635 208
188 3300046663 Ga0495635_0088808 Ga0495635_0088808_76_702 208
189 3300046680 Ga0495646_0243898 Ga0495646_0243898_102_728 208
190 3300046683 Ga0495658_0157094 Ga0495658_0157094_692_1318 208
191 3300046689 Ga0495613_0005543 Ga0495613_0005543_3342_3968 208
192 3300046690 Ga0495624_0039202 Ga0495624_0039202_1771_2397 208
193 3300047315 Ga0495581_0358488 Ga0495581_0358488_110_736 208
194 3300047319 Ga0495674_0053330 Ga0495674_0053330_764_1390 208
195 3300047319 Ga0495674_0099624 Ga0495674_0099624_1420_2046 208
196 3300047321 Ga0495676_0130793 Ga0495676_0130793_431_1057 208
197 3300047322 Ga0495680_0002262 Ga0495680_0002262_16671_17297 208
198 3300047322 Ga0495680_0155252 Ga0495680_0155252_642_1268 208
199 3300047471 Ga0495684_0080365 Ga0495684_0080365_772_1398 208
200 3300047471 Ga0495684_0092186 Ga0495684_0092186_117_743 208
201 3300048914 Ga0496111_0426133 Ga0496111_0426133_237_863 208
202 3300048915 Ga0496112_0389557 Ga0496112_0389557_85_711 208
203 3300048918 Ga0496115_0097881 Ga0496115_0097881_1639_2265 208
204 3300049575 Ga0501039_0160331 Ga0501039_0160331_688_1320 208
205 3300049579 Ga0501043_0136634 Ga0501043_0136634_902_1534 208
206 3300049581 Ga0501047_0099947 Ga0501047_0099947_277_909 208
207 3300004799 Ga0058863_10022309 Ga0058863_100223092 209
208 3300004800 Ga0058861_11907353 Ga0058861_119073532 209
209 3300004803 Ga0058862_12724094 Ga0058862_127240942 209
210 3300005329 Ga0070683_100114843 Ga0070683_1001148432 209
211 3300005340 Ga0070689_100172649 Ga0070689_1001726491 209
212 3300005455 Ga0070663_100451974 Ga0070663_1004519741 209
213 3300005458 Ga0070681_10466376 Ga0070681_104663762 209
214 3300009093 Ga0105240_10122487 Ga0105240_101224875 209
215 3300009093 Ga0105240_10342691 Ga0105240_103426912 209
216 3300013100 Ga0157373_10385085 Ga0157373_103850852 209
217 3300013104 Ga0157370_10139213 Ga0157370_101392133 209
218 3300025911 Ga0207654_10343390 Ga0207654_103433901 209
219 3300025913 Ga0207695_10179846 Ga0207695_101798463 209
220 3300025913 Ga0207695_10504293 Ga0207695_105042932 209
221 3300025917 Ga0207660_10190947 Ga0207660_101909472 209
222 3300025919 Ga0207657_10431906 Ga0207657_104319062 209
223 3300025921 Ga0207652_10228429 Ga0207652_102284292 209
224 3300025924 Ga0207694_10008352 Ga0207694_100083523 209
225 3300025932 Ga0207690_10155633 Ga0207690_101556332 209
226 3300025944 Ga0207661_10088974 Ga0207661_100889742 209
227 3300025949 Ga0207667_10089541 Ga0207667_100895413 209
228 3300026067 Ga0207678_10497598 Ga0207678_104975982 209
229 3300026078 Ga0207702_10609001 Ga0207702_106090012 209
230 3300026116 Ga0207674_11240060 Ga0207674_112400601 209
231 3300028800 Ga0265338_10002943 Ga0265338_1000294310 209
232 3300044842 Ga0466957_0170933 Ga0466957_0170933_27_656 209
233 3300049460 Ga0495682_0029959 Ga0495682_0029959_242_871 209
234 3300049569 Ga0501032_0276833 Ga0501032_0276833_229_858 209
235 3300049570 Ga0501033_0041982 Ga0501033_0041982_1981_2610 209
236 3300049579 Ga0501043_0402600 Ga0501043_0402600_39_668 209
237 3300050511 nmdc:mga08y16_116291_c1 nmdc:mga08y16_116291_c1_2083_2715 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00573

Ribosomal_L4

Ribosomal protein L4/L1 family

21

203

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c9b-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9121 1 205
8c97-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9056 1 205
8c9b-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9006 1 205
8c97-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.894 1 205
7ode-assembly1.cif.gz_M e. coli 50s ribosome licl core particle 0.8515 1 205
ID Description Score Start End Superfamily
1dmgA00 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7858 1 205 3.40.1370.10
1dmgA00 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7771 1 205 3.40.1370.10
af_Q2FW07_2_206_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7511 1 204 3.40.1370.10
af_Q2FW07_2_206_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.744 1 204 3.40.1370.10
af_P60723_1_201_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7373 1 205 3.40.1370.10
ID Description Score Start End GO Terms
AF-A0A7Y8S3F3-F1-model_v4 deleted 0.9842 99 205
AF-A0A380DTQ1-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9791 100 205 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A536U9H5-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9789 100 205 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A645JEY8-F1-model_v4 50S ribosomal protein L4 0.9774 112 204 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A645G5W3-F1-model_v4 50S ribosomal protein L4 0.9755 106 205 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Feature Viewer

pLDDT pTM Quality
75.5 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map