F349903

General Info

Members Datasets Scaffolds Average Seq Length
237 146 474 166

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100085799|Ga0075428_1000857993
Length 177
Sequence MTVTAVRKDPQALSMTLEAEFDASPERVWQLWADPRQLERWWGPPTYPATVTKHELRPGGRVEYHMTGPEGDQPHAYWEVQEVEPPRSLVVRDNFANADGSPNADLPGNEFRVTIEGIGGGRSRMSIVSLFPSTEAMEQVLAMGMEEGLTQAVGQIDAILAADAIAEPSAPRELTDR

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
81 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
82 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
83 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
84 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
85 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
86 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
87 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
88 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
89 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
90 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
91 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
92 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
93 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
97 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
98 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
99 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
105 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
118 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
140 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
143 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
144 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.95
Rhizosphere 94.94
Stem 0
Stem Tuber 0
Unclassified 5.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100085799 3300006844 Bacteria 3434
2 Ga0070683_100383761 3300005329 Bacteria 1339
3 Ga0068868_100288522 3300005338 Bacteria 1391
4 Ga0070687_100897779 3300005343 Bacteria 635
5 Ga0070668_100003859 3300005347 Bacteria 11064
6 Ga0070668_100644807 3300005347 Bacteria 930
7 Ga0070667_100005195 3300005367 Bacteria 10881
8 Ga0070705_100007188 3300005440 Bacteria 5478
9 Ga0070694_100068926 3300005444 Bacteria 2432
10 Ga0070708_100931985 3300005445 Bacteria 815
11 Ga0070706_100151245 3300005467 Bacteria 2167
12 Ga0070706_100168707 3300005467 Bacteria 2044
13 Ga0070706_100346990 3300005467 Bacteria 1384
14 Ga0070706_100919456 3300005467 Bacteria 808
15 Ga0070706_101154057 3300005467 Unclassified 712
16 Ga0070707_100078494 3300005468 Bacteria 3185
17 Ga0070707_100236585 3300005468 Bacteria 1778
18 Ga0070707_100407519 3300005468 Bacteria 1320
19 Ga0070698_100022155 3300005471 Bacteria 6651
20 Ga0070698_100023506 3300005471 Bacteria 6442
21 Ga0070698_100087390 3300005471 Bacteria 3103
22 Ga0070698_100507607 3300005471 Bacteria 1144
23 Ga0070699_100096823 3300005518 Bacteria 2585
24 Ga0070699_100944905 3300005518 Bacteria 790
25 Ga0070684_100671714 3300005535 Bacteria 965
26 Ga0068853_100115728 3300005539 Bacteria 2387
27 Ga0070695_100231451 3300005545 Bacteria 1336
28 Ga0070696_100110876 3300005546 Bacteria 1976
29 Ga0070693_100062946 3300005547 Bacteria 2160
30 Ga0070665_100103516 3300005548 Bacteria 2850
31 Ga0070704_100019473 3300005549 Bacteria 4360
32 Ga0068854_100029565 3300005578 Bacteria 3794
33 Ga0070702_100279266 3300005615 Bacteria 1146
34 Ga0068870_11098084 3300005840 Bacteria 572
35 Ga0068858_100296855 3300005842 Bacteria 1541
36 Ga0068860_100241637 3300005843 Bacteria 1757
37 Ga0068860_100490102 3300005843 Bacteria 1226
38 Ga0068862_100001142 3300005844 Bacteria 25132
39 Ga0068862_100115890 3300005844 Bacteria 2356
40 Ga0081455_10001196 3300005937 Bacteria 32499
41 Ga0081455_10007088 3300005937 Bacteria 11891
42 Ga0081455_10041925 3300005937 Bacteria 4021
43 Ga0081455_10113174 3300005937 Bacteria 2153
44 Ga0081538_10070028 3300005981 Bacteria 1939
45 Ga0070717_10726207 3300006028 Bacteria 903
46 Ga0075432_10019815 3300006058 Bacteria 2299
47 Ga0070716_100163798 3300006173 Bacteria 1444
48 Ga0075428_100011386 3300006844 Bacteria 9894
49 Ga0075428_100088583 3300006844 Bacteria 3376
50 Ga0075428_102089459 3300006844 Bacteria 586
51 Ga0075428_102213840 3300006844 Bacteria 567
52 Ga0075430_100012641 3300006846 Bacteria 7189
53 Ga0075431_100004762 3300006847 Bacteria 13344
54 Ga0075431_100079182 3300006847 Bacteria 3392
55 Ga0075431_100213091 3300006847 Bacteria 1973
56 Ga0075433_10001397 3300006852 Bacteria 17807
57 Ga0075433_11072519 3300006852 Bacteria 701
58 Ga0075434_100002269 3300006871 Bacteria 16813
59 Ga0075434_100680436 3300006871 Bacteria 1046
60 Ga0075429_100243848 3300006880 Bacteria 1574
61 Ga0075436_100079721 3300006914 Bacteria 2268
62 Ga0075436_100126871 3300006914 Bacteria 1788
63 Ga0075435_100003645 3300007076 Bacteria 10486
64 Ga0075435_100264780 3300007076 Bacteria 1465
65 Ga0075435_100565910 3300007076 Bacteria 985
66 Ga0111539_10011280 3300009094 Bacteria 11225
67 Ga0105245_10109469 3300009098 Bacteria 2567
68 Ga0105247_10458766 3300009101 Bacteria 920
69 Ga0114129_10001737 3300009147 Bacteria 29660
70 Ga0114129_10112467 3300009147 Bacteria 3755
71 Ga0114129_10200789 3300009147 Bacteria 2701
72 Ga0114129_10244639 3300009147 Bacteria 2410
73 Ga0105243_10496262 3300009148 Bacteria 1156
74 Ga0105248_10000860 3300009177 Bacteria 34163
75 Ga0105249_10004678 3300009553 Bacteria 11819
76 Ga0105249_10467767 3300009553 Bacteria 1302
77 Ga0105239_10524184 3300010375 Bacteria 1348
78 Ga0105239_10677361 3300010375 Bacteria 1179
79 Ga0157369_10553276 3300013105 Bacteria 1189
80 Ga0163162_11634645 3300013306 Bacteria 735
81 Ga0163163_10235451 3300014325 Bacteria 1880
82 Ga0157380_10214770 3300014326 Bacteria 1717
83 Ga0157379_10000430 3300014968 Bacteria 33909
84 Ga0157379_10042780 3300014968 Bacteria 4045
85 Ga0163161_10141882 3300017792 Bacteria 1819
86 Ga0213876_10208062 3300021384 Bacteria 1040
87 Ga0207710_10247836 3300025900 Bacteria 890
88 Ga0207684_10047999 3300025910 Bacteria 3621
89 Ga0207684_11067625 3300025910 Bacteria 673
90 Ga0207662_10350371 3300025918 Bacteria 991
91 Ga0207646_10009081 3300025922 Bacteria 9871
92 Ga0207646_10220501 3300025922 Bacteria 1713
93 Ga0207646_10518471 3300025922 Bacteria 1073
94 Ga0207687_10583346 3300025927 Bacteria 941
95 Ga0207665_10050616 3300025939 Bacteria 2794
96 Ga0207711_10000675 3300025941 Bacteria 33918
97 Ga0207661_10262900 3300025944 Bacteria 1538
98 Ga0207712_10002254 3300025961 Bacteria 12529
99 Ga0207668_10002800 3300025972 Bacteria 10192
100 Ga0207658_10000978 3300025986 Bacteria 23578
101 Ga0207677_10242317 3300026023 Bacteria 1459
102 Ga0207703_10000676 3300026035 Bacteria 33962
103 Ga0207703_10038213 3300026035 Bacteria 3830
104 Ga0207675_100038796 3300026118 Bacteria 4445
105 Ga0209983_1019661 3300027665 Bacteria 1405
106 Ga0268266_10146117 3300028379 Bacteria 2126
107 Ga0268265_10002611 3300028380 Bacteria 13407
108 Ga0268264_11056790 3300028381 Bacteria 820
109 Ga0307413_10231933 3300031824 Bacteria 1356
110 Ga0307416_100113420 3300032002 Bacteria 2395
111 Ga0307416_101935371 3300032002 Bacteria 693
112 Ga0307414_10829218 3300032004 Bacteria 845
113 Ga0307414_11283304 3300032004 Bacteria 679
114 Ga0307415_100035189 3300032126 Bacteria 3269
115 Ga0373938_0064552 3300034957 Bacteria 863
116 Ga0395898_0303010 3300037466 Bacteria 1524
117 Ga0395905_0868754 3300037471 Bacteria 805
118 Ga0436365_0202345 3300039437 Bacteria 614
119 Ga0436365_1147937 3300039437 Bacteria 8358
120 Ga0436363_1713960 3300039450 Bacteria 535
121 Ga0439465_0079722 3300041413 Bacteria 1109
122 Ga0439465_0162966 3300041413 Bacteria 800
123 Ga0451798_0143725 3300041458 Bacteria 658
124 Ga0451802_0913877 3300041460 Bacteria 740
125 Ga0439431_0040017 3300041997 Bacteria 1191
126 Ga0439448_0157394 3300042005 Bacteria 790
127 Ga0439450_027803 3300042008 Bacteria 1254
128 Ga0439454_054649 3300042011 Bacteria 682
129 Ga0439463_001883 3300042016 Bacteria 5442
130 Ga0439463_026042 3300042016 Bacteria 1469
131 Ga0450910_013303 3300042147 Bacteria 1196
132 Ga0450910_036341 3300042147 Bacteria 787
133 Ga0439435_0279635 3300042436 Bacteria 568
134 Ga0439464_0124165 3300042439 Bacteria 797
135 Ga0439440_0003784 3300042993 Bacteria 2945
136 Ga0439440_0077562 3300042993 Bacteria 874
137 Ga0453683_0116225 3300044673 Bacteria 1683
138 Ga0466966_0130551 3300044684 Bacteria 1539
139 Ga0466960_0027059 3300044901 Bacteria 2612
140 Ga0495661_0207318 3300046665 Bacteria 1023
141 Ga0495670_0540344 3300046691 Bacteria 634
142 Ga0495636_0194352 3300047318 Bacteria 925
143 Ga0496100_0492709 3300048903 Bacteria 944
144 Ga0496102_0354447 3300048905 Bacteria 1381
145 Ga0496104_0761808 3300048907 Bacteria 875
146 Ga0496107_0219687 3300048910 Bacteria 1414
147 Ga0496111_0642810 3300048914 Bacteria 774
148 Ga0496118_0176757 3300048921 Bacteria 1296
149 Ga0501031_0218704 3300049568 Unclassified 1241
150 Ga0501032_0787793 3300049569 Bacteria 601
151 Ga0501033_0129379 3300049570 Bacteria 1830
152 Ga0501033_0455549 3300049570 Bacteria 888
153 Ga0501036_0314599 3300049572 Bacteria 1309
154 Ga0501036_0341227 3300049572 Bacteria 1251
155 Ga0501036_0554499 3300049572 Bacteria 955
156 Ga0501036_1195662 3300049572 Unclassified 620
157 Ga0501038_0225220 3300049574 Bacteria 1495
158 Ga0501039_0091320 3300049575 Bacteria 2373
159 Ga0501039_0164549 3300049575 Unclassified 1744
160 Ga0501040_0080555 3300049576 Bacteria 2255
161 Ga0501040_0118662 3300049576 Bacteria 1855
162 Ga0501040_0218917 3300049576 Bacteria 1354
163 Ga0501041_0124566 3300049577 Bacteria 1603
164 Ga0501041_0134615 3300049577 Bacteria 1540
165 Ga0501041_0186260 3300049577 Unclassified 1300
166 Ga0501041_0316818 3300049577 Bacteria 984
167 Ga0501041_0332350 3300049577 Bacteria 959
168 Ga0501042_0155820 3300049578 Bacteria 1648
169 Ga0501042_0721584 3300049578 Unclassified 725
170 Ga0501043_0197918 3300049579 Bacteria 1561
171 Ga0501043_0203275 3300049579 Bacteria 1537
172 Ga0501046_0031402 3300049580 Bacteria 4305
173 Ga0501046_0112570 3300049580 Unclassified 2078
174 Ga0501046_0190975 3300049580 Bacteria 1528
175 Ga0501048_0044913 3300049582 Bacteria 3157
176 Ga0501048_0177985 3300049582 Bacteria 1507
177 Ga0501048_0266113 3300049582 Bacteria 1218
178 Ga0501067_0007514 3300049583 Bacteria 6056
179 Ga0501068_0026191 3300049584 Bacteria 3435
180 Ga0501068_0287805 3300049584 Bacteria 1051
181 Ga0501068_0356195 3300049584 Bacteria 941
182 Ga0501070_0075275 3300049586 Bacteria 2795
183 Ga0501071_0051129 3300049587 Bacteria 2977
184 Ga0501071_0052725 3300049587 Bacteria 2933
185 Ga0501071_1378193 3300049587 Bacteria 544
186 Ga0501072_0011918 3300049588 Bacteria 6640
187 Ga0501072_0048465 3300049588 Bacteria 3346
188 Ga0501072_0165544 3300049588 Bacteria 1764
189 Ga0501072_0592759 3300049588 Bacteria 874
190 Ga0501074_0043158 3300049590 Bacteria 3264
191 Ga0501074_0113604 3300049590 Unclassified 1937
192 Ga0501074_0332887 3300049590 Bacteria 1078
193 Ga0501075_0025849 3300049591 Bacteria 4315
194 Ga0501075_0115766 3300049591 Bacteria 2038
195 Ga0501075_0449878 3300049591 Bacteria 982
196 Ga0501076_0053336 3300049592 Bacteria 3204
197 Ga0501076_0802745 3300049592 Unclassified 776
198 Ga0501077_0328482 3300049593 Unclassified 975
199 Ga0501077_0651761 3300049593 Bacteria 676
200 Ga0501240_018531 3300049673 Bacteria 1025
201 Ga0501079_0148049 3300049741 Unclassified 1830
202 Ga0501079_0220229 3300049741 Bacteria 1483
203 Ga0501079_0588353 3300049741 Bacteria 876
204 Ga0501079_0688933 3300049741 Bacteria 804
205 Ga0501080_0625637 3300049742 Bacteria 954
206 Ga0501081_0047457 3300049743 Bacteria 2955
207 Ga0501081_0168014 3300049743 Bacteria 1583
208 Ga0501081_0442781 3300049743 Bacteria 965
209 Ga0501035_0030460 3300049822 Bacteria 4918
210 Ga0501045_0091223 3300049824 Bacteria 2252
211 Ga0501045_0258028 3300049824 Unclassified 1297
212 nmdc:mga05p37_247332_c1 3300050507 Bacteria 2140
213 nmdc:mga05p37_700783_c1 3300050507 Bacteria 1125
214 nmdc:mga09592_216119_c1 3300050508 Bacteria 1661
215 nmdc:mga09592_356198_c1 3300050508 Bacteria 1266
216 nmdc:mga0qj67_1978_c1 3300050509 Bacteria 14596
217 nmdc:mga0qj67_262552_c1 3300050509 Bacteria 1400
218 nmdc:mga06r32_1421229_c1 3300050510 Bacteria 635
219 nmdc:mga06r32_289424_c1 3300050510 Bacteria 1625
220 nmdc:mga06r32_43534_c1 3300050510 Bacteria 4272
221 nmdc:mga08y16_995742_c1 3300050511 Bacteria 818
222 nmdc:mga0n895_792302_c1 3300050512 Bacteria 939
223 nmdc:mga0rr50_417966_c1 3300050513 Bacteria 1134
224 nmdc:mga08x19_125642_c1 3300050514 Bacteria 1722
225 Ga0495655_0270021 3300053083 Bacteria 577
226 Ga0501084_0124092 3300054114 Bacteria 2172
227 Ga0501084_0943426 3300054114 Bacteria 725
228 Ga0590071_001247 3300059421 Bacteria 6859
229 Ga0590075_001891 3300059424 Bacteria 5081
230 Ga0590077_008131 3300059426 Bacteria 2147
231 Ga0590077_036996 3300059426 Bacteria 1077
232 Ga0501082_0103289 3300060353 Bacteria 2465
233 Ga0501082_0206538 3300060353 Bacteria 1709
234 Ga0501082_1393531 3300060353 Bacteria 612
235 Ga0530510_0012402 3300061734 Bacteria 5988
236 Ga0530510_0028896 3300061734 Bacteria 3977
237 Ga0530510_1202573 3300061734 Bacteria 581
238 Ga0075428_100085799
239 Ga0070683_100383761
240 Ga0068868_100288522
241 Ga0070687_100897779
242 Ga0070668_100003859
243 Ga0070668_100644807
244 Ga0070667_100005195
245 Ga0070705_100007188
246 Ga0070694_100068926
247 Ga0070708_100931985
248 Ga0070706_100151245
249 Ga0070706_100168707
250 Ga0070706_100346990
251 Ga0070706_100919456
252 Ga0070706_101154057
253 Ga0070707_100078494
254 Ga0070707_100236585
255 Ga0070707_100407519
256 Ga0070698_100022155
257 Ga0070698_100023506
258 Ga0070698_100087390
259 Ga0070698_100507607
260 Ga0070699_100096823
261 Ga0070699_100944905
262 Ga0070684_100671714
263 Ga0068853_100115728
264 Ga0070695_100231451
265 Ga0070696_100110876
266 Ga0070693_100062946
267 Ga0070665_100103516
268 Ga0070704_100019473
269 Ga0068854_100029565
270 Ga0070702_100279266
271 Ga0068870_11098084
272 Ga0068858_100296855
273 Ga0068860_100241637
274 Ga0068860_100490102
275 Ga0068862_100001142
276 Ga0068862_100115890
277 Ga0081455_10001196
278 Ga0081455_10007088
279 Ga0081455_10041925
280 Ga0081455_10113174
281 Ga0081538_10070028
282 Ga0070717_10726207
283 Ga0075432_10019815
284 Ga0070716_100163798
285 Ga0075428_100011386
286 Ga0075428_100088583
287 Ga0075428_102089459
288 Ga0075428_102213840
289 Ga0075430_100012641
290 Ga0075431_100004762
291 Ga0075431_100079182
292 Ga0075431_100213091
293 Ga0075433_10001397
294 Ga0075433_11072519
295 Ga0075434_100002269
296 Ga0075434_100680436
297 Ga0075429_100243848
298 Ga0075436_100079721
299 Ga0075436_100126871
300 Ga0075435_100003645
301 Ga0075435_100264780
302 Ga0075435_100565910
303 Ga0111539_10011280
304 Ga0105245_10109469
305 Ga0105247_10458766
306 Ga0114129_10001737
307 Ga0114129_10112467
308 Ga0114129_10200789
309 Ga0114129_10244639
310 Ga0105243_10496262
311 Ga0105248_10000860
312 Ga0105249_10004678
313 Ga0105249_10467767
314 Ga0105239_10524184
315 Ga0105239_10677361
316 Ga0157369_10553276
317 Ga0163162_11634645
318 Ga0163163_10235451
319 Ga0157380_10214770
320 Ga0157379_10000430
321 Ga0157379_10042780
322 Ga0163161_10141882
323 Ga0213876_10208062
324 Ga0207710_10247836
325 Ga0207684_10047999
326 Ga0207684_11067625
327 Ga0207662_10350371
328 Ga0207646_10009081
329 Ga0207646_10220501
330 Ga0207646_10518471
331 Ga0207687_10583346
332 Ga0207665_10050616
333 Ga0207711_10000675
334 Ga0207661_10262900
335 Ga0207712_10002254
336 Ga0207668_10002800
337 Ga0207658_10000978
338 Ga0207677_10242317
339 Ga0207703_10000676
340 Ga0207703_10038213
341 Ga0207675_100038796
342 Ga0209983_1019661
343 Ga0268266_10146117
344 Ga0268265_10002611
345 Ga0268264_11056790
346 Ga0307413_10231933
347 Ga0307416_100113420
348 Ga0307416_101935371
349 Ga0307414_10829218
350 Ga0307414_11283304
351 Ga0307415_100035189
352 Ga0373938_0064552
353 Ga0395898_0303010
354 Ga0395905_0868754
355 Ga0436365_0202345
356 Ga0436365_1147937
357 Ga0436363_1713960
358 Ga0439465_0079722
359 Ga0439465_0162966
360 Ga0451798_0143725
361 Ga0451802_0913877
362 Ga0439431_0040017
363 Ga0439448_0157394
364 Ga0439450_027803
365 Ga0439454_054649
366 Ga0439463_001883
367 Ga0439463_026042
368 Ga0450910_013303
369 Ga0450910_036341
370 Ga0439435_0279635
371 Ga0439464_0124165
372 Ga0439440_0003784
373 Ga0439440_0077562
374 Ga0453683_0116225
375 Ga0466966_0130551
376 Ga0466960_0027059
377 Ga0495661_0207318
378 Ga0495670_0540344
379 Ga0495636_0194352
380 Ga0496100_0492709
381 Ga0496102_0354447
382 Ga0496104_0761808
383 Ga0496107_0219687
384 Ga0496111_0642810
385 Ga0496118_0176757
386 Ga0501031_0218704
387 Ga0501032_0787793
388 Ga0501033_0129379
389 Ga0501033_0455549
390 Ga0501036_0314599
391 Ga0501036_0341227
392 Ga0501036_0554499
393 Ga0501036_1195662
394 Ga0501038_0225220
395 Ga0501039_0091320
396 Ga0501039_0164549
397 Ga0501040_0080555
398 Ga0501040_0118662
399 Ga0501040_0218917
400 Ga0501041_0124566
401 Ga0501041_0134615
402 Ga0501041_0186260
403 Ga0501041_0316818
404 Ga0501041_0332350
405 Ga0501042_0155820
406 Ga0501042_0721584
407 Ga0501043_0197918
408 Ga0501043_0203275
409 Ga0501046_0031402
410 Ga0501046_0112570
411 Ga0501046_0190975
412 Ga0501048_0044913
413 Ga0501048_0177985
414 Ga0501048_0266113
415 Ga0501067_0007514
416 Ga0501068_0026191
417 Ga0501068_0287805
418 Ga0501068_0356195
419 Ga0501070_0075275
420 Ga0501071_0051129
421 Ga0501071_0052725
422 Ga0501071_1378193
423 Ga0501072_0011918
424 Ga0501072_0048465
425 Ga0501072_0165544
426 Ga0501072_0592759
427 Ga0501074_0043158
428 Ga0501074_0113604
429 Ga0501074_0332887
430 Ga0501075_0025849
431 Ga0501075_0115766
432 Ga0501075_0449878
433 Ga0501076_0053336
434 Ga0501076_0802745
435 Ga0501077_0328482
436 Ga0501077_0651761
437 Ga0501240_018531
438 Ga0501079_0148049
439 Ga0501079_0220229
440 Ga0501079_0588353
441 Ga0501079_0688933
442 Ga0501080_0625637
443 Ga0501081_0047457
444 Ga0501081_0168014
445 Ga0501081_0442781
446 Ga0501035_0030460
447 Ga0501045_0091223
448 Ga0501045_0258028
449 nmdc:mga05p37_247332_c1
450 nmdc:mga05p37_700783_c1
451 nmdc:mga09592_216119_c1
452 nmdc:mga09592_356198_c1
453 nmdc:mga0qj67_1978_c1
454 nmdc:mga0qj67_262552_c1
455 nmdc:mga06r32_1421229_c1
456 nmdc:mga06r32_289424_c1
457 nmdc:mga06r32_43534_c1
458 nmdc:mga08y16_995742_c1
459 nmdc:mga0n895_792302_c1
460 nmdc:mga0rr50_417966_c1
461 nmdc:mga08x19_125642_c1
462 Ga0495655_0270021
463 Ga0501084_0124092
464 Ga0501084_0943426
465 Ga0590071_001247
466 Ga0590075_001891
467 Ga0590077_008131
468 Ga0590077_036996
469 Ga0501082_0103289
470 Ga0501082_0206538
471 Ga0501082_1393531
472 Ga0530510_0012402
473 Ga0530510_0028896
474 Ga0530510_1202573

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

22

161

0.92

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

12

157

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ldk-assembly1.cif.gz_A solution nmr structure of protein aaur_3427 from arthrobacter aurescens, northeast structural genomics consortium target aar96 0.9724 3 162
2ldk-assembly1.cif.gz_A solution nmr structure of protein aaur_3427 from arthrobacter aurescens, northeast structural genomics consortium target aar96 0.9378 3 162
3uid-assembly2.cif.gz_B crystal structure of protein ms6760 from mycobacterium smegmatis 0.9376 2 164
3uid-assembly2.cif.gz_B crystal structure of protein ms6760 from mycobacterium smegmatis 0.9319 2 164
3uid-assembly1.cif.gz_A crystal structure of protein ms6760 from mycobacterium smegmatis 0.9227 2 160
ID Description Score Start End Superfamily
2ldkA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9724 3 162 3.30.530.20
2ldkA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9378 3 162 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9376 2 164 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9319 2 164 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9184 4 160 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A7X8TGX4-F1-model_v4 SRPBCC domain-containing protein 0.992 1 97
AF-A0A6J6X5I8-F1-model_v4 Unannotated protein 0.9877 1 162
AF-A0A7W0P264-F1-model_v4 SRPBCC domain-containing protein 0.9859 1 160
AF-A0A7X0GGL7-F1-model_v4 Uncharacterized protein YndB with AHSA1/START domain 0.9855 14 162
AF-W0Z718-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9843 1 157

Map