F349813

General Info

Members Datasets Scaffolds Average Seq Length
237 208 148 251

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100423637|Ga0070699_1004236372
Length 296
Sequence MAIGVPPLVPASRAAIRVGSAILGERLDHRQRVRYAAWVTDLRGRWALVTGATSGFGLATARAIASQGCHVAITGRREDRLQAAAGEIRDRYRVEAVPLRFDVRDLAQVRLALEGASDLLSKLDILVNNAGLALALDPLQAGSPDDWDQMIDTNVKGLLYASRTVLPGMVERGRGHVVNVGSVAGHQTYAGGAVYSATKYAVRAITDALRYDVLGKGIRVSNVEPGLAETEFSEVRFKGDRTRAKTVYDGLTPLVAEDVADAVVWCLTRPPHVNIQSVLIMPTDQASAHAVHRRTK

Samples

Sample ID Description Type Environment
1 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
2 2519103095 Burkholderia sp. KJ006 Isolate Nodule
3 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
4 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
5 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
6 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
7 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
8 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
9 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
10 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
11 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
12 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
13 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
14 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
15 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
16 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
17 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
18 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
19 2818991452 Burkholderia cepacia 561 Isolate Unclassified
20 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
21 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
22 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
23 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
24 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
25 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
26 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
27 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
28 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
29 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
30 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
31 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
32 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
33 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
34 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
35 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
36 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
37 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
38 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
39 2904564687 Burkholderia sp. 571 Isolate Unclassified
40 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
41 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
42 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
43 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
44 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
45 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
46 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
47 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
48 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
49 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
50 2928163908 Burkholderia sp. 567 Isolate Unclassified
51 2928170801 Burkholderia sp. 572 Isolate Unclassified
52 2928536128 Burkholderia sola 565 Isolate Unclassified
53 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
54 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
55 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
56 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
57 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
58 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
59 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
60 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
61 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
62 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
63 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
64 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
65 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
66 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
67 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
68 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
69 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
70 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
71 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
72 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
73 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
74 3004167301 Mesorhizobium loti 582 Isolate Unclassified
75 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
76 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
77 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
78 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
79 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
80 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
81 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
82 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
83 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
84 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
85 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
86 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
87 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
88 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
89 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
90 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
91 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
92 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
93 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
94 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
95 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
96 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
97 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
98 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
99 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
100 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
101 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
102 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
103 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
104 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
105 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
106 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
107 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
111 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
112 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
124 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
125 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
126 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
138 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
140 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
156 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
157 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
158 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
159 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
178 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
179 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
197 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
198 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
199 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
200 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
201 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
202 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
203 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
204 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
205 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
206 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
207 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
208 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 62.45
Metatranscriptomes 0
Isolates 37.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.46
Nodule 21.1
Rhizoplane 4.64
Rhizosphere 46.41
Stem 0
Stem Tuber 0
Unclassified 11.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10001032 3300001989 Bacteria 10321
2 JGI24739J22299_10020137 3300001989 Bacteria 2384
3 JGI24739J22299_10043043 3300001989 Bacteria 1495
4 JGI25153J46596_10022228 3300003215 Unclassified 2344
5 rootH1_10099834 3300003316 Bacteria 1653
6 rootH2_10249391 3300003320 Bacteria 2871
7 Ga0055532_1003764 3300003758 Bacteria 2471
8 Ga0055532_1005442 3300003758 Bacteria 1789
9 Ga0055532_1005530 3300003758 Bacteria 1769
10 Ga0055527_1003238 3300003760 Bacteria 2474
11 Ga0055527_1003240 3300003760 Bacteria 2474
12 Ga0055535_1006179 3300003761 Bacteria 2474
13 Ga0055535_1006180 3300003761 Bacteria 2474
14 Ga0055542_1000282 3300003762 Bacteria 57045
15 Ga0055542_1006657 3300003762 Bacteria 2442
16 Ga0055529_1003381 3300003763 Bacteria 2665
17 Ga0055528_1000873 3300003790 Bacteria 20420
18 Ga0055528_1006211 3300003790 Bacteria 5442
19 Ga0055530_10001217 3300003791 Bacteria 19834
20 Ga0055541_1007934 3300003841 Bacteria 1717
21 Ga0058692_1003038 3300003856 Bacteria 5359
22 Ga0065165_1000148 3300005262 Bacteria 122640
23 Ga0070683_100122312 3300005329 Bacteria 2459
24 Ga0070661_100126304 3300005344 Bacteria 1919
25 Ga0070669_100392388 3300005353 Bacteria 1134
26 Ga0070694_100000006 3300005444 Bacteria 100858
27 Ga0070663_100054765 3300005455 Bacteria 2852
28 Ga0070707_100039569 3300005468 Bacteria 4507
29 Ga0070698_100405588 3300005471 Bacteria 1297
30 Ga0070699_100423637 3300005518 Bacteria 1205
31 Ga0070695_100039677 3300005545 Bacteria 2978
32 Ga0070696_100130503 3300005546 Bacteria 1828
33 Ga0068855_100539131 3300005563 Bacteria 1264
34 Ga0068852_100011338 3300005616 Bacteria 6705
35 Ga0068859_100094269 3300005617 Bacteria 3046
36 Ga0068870_10060654 3300005840 Bacteria 2031
37 Ga0068858_100155456 3300005842 Bacteria 2152
38 Ga0081455_10047652 3300005937 Bacteria 3709
39 Ga0070717_10013331 3300006028 Bacteria 6295
40 Ga0075428_100001061 3300006844 Bacteria 29174
41 Ga0075430_100007342 3300006846 Bacteria 9313
42 Ga0075433_10000044 3300006852 Bacteria 51321
43 Ga0075433_10176637 3300006852 Bacteria 1900
44 Ga0075434_100000739 3300006871 Bacteria 25699
45 Ga0075436_100006966 3300006914 Bacteria 7738
46 Ga0097620_100094269 3300006931 Bacteria 3046
47 Ga0075435_100002236 3300007076 Bacteria 12773
48 Ga0105240_10053617 3300009093 Bacteria 5061
49 Ga0105240_10189399 3300009093 Bacteria 2420
50 Ga0111539_10121060 3300009094 Bacteria 3066
51 Ga0105237_10116609 3300009545 Bacteria 2664
52 Ga0105239_10195723 3300010375 Bacteria 2264
53 Ga0157370_10291108 3300013104 Bacteria 1508
54 Ga0157369_10532233 3300013105 Bacteria 1215
55 Ga0157374_10057533 3300013296 Bacteria 3631
56 Ga0157380_10136256 3300014326 Bacteria 2102
57 Ga0182007_10019740 3300015262 Bacteria 2418
58 Ga0213876_10021437 3300021384 Bacteria 3417
59 Ga0213875_10013164 3300021388 Bacteria 4067
60 Ga0209566_100170 3300025225 Bacteria 70792
61 Ga0209674_106298 3300025226 Bacteria 1636
62 Ga0209672_100028 3300025228 Bacteria 341962
63 Ga0209672_100038 3300025228 Bacteria 286731
64 Ga0209147_100112 3300025229 Bacteria 145046
65 Ga0209147_100117 3300025229 Bacteria 143852
66 Ga0209258_100109 3300025242 Bacteria 203881
67 Ga0209258_100112 3300025242 Bacteria 192884
68 Ga0209148_1000081 3300025254 Bacteria 273676
69 Ga0209148_1006317 3300025254 Bacteria 2579
70 Ga0209233_1000010 3300025261 Bacteria 1194329
71 Ga0209565_1013835 3300025263 Bacteria 1875
72 Ga0209455_1000050 3300025272 Bacteria 373239
73 Ga0209455_1004581 3300025272 Bacteria 4481
74 Ga0209673_1000038 3300025273 Bacteria 312957
75 Ga0209673_1000197 3300025273 Bacteria 121313
76 Ga0209564_1010172 3300025295 Bacteria 4370
77 Ga0209564_1011209 3300025295 Bacteria 4042
78 Ga0209758_1007645 3300025297 Bacteria 7287
79 Ga0209758_1084786 3300025297 Bacteria 946
80 Ga0209050_1000359 3300025298 Bacteria 87723
81 Ga0207426_1001227 3300025302 Bacteria 22612
82 Ga0209257_1001909 3300025304 Bacteria 22511
83 Ga0207699_10121668 3300025906 Bacteria 1689
84 Ga0207695_10124931 3300025913 Bacteria 2537
85 Ga0207671_10021022 3300025914 Bacteria 4959
86 Ga0207649_10081734 3300025920 Bacteria 2093
87 Ga0207646_10045553 3300025922 Bacteria 3938
88 Ga0207694_10032485 3300025924 Bacteria 3995
89 Ga0207700_10475183 3300025928 Bacteria 1104
90 Ga0207667_10096258 3300025949 Bacteria 3055
91 Ga0207703_10158741 3300026035 Bacteria 1979
92 Ga0207639_10108400 3300026041 Bacteria 2258
93 Ga0207678_10098564 3300026067 Bacteria 2497
94 Ga0207674_10048304 3300026116 Bacteria 4356
95 Ga0207698_10003551 3300026142 Bacteria 9402
96 Ga0209371_1000090 3300027312 Bacteria 173119
97 Ga0265319_1036694 3300028563 Bacteria 1675
98 Ga0265318_10081538 3300028577 Bacteria 1195
99 Ga0268256_1000115 3300030500 Bacteria 116918
100 Ga0265340_10008752 3300031247 Bacteria 5459
101 Ga0316575_10007987 3300031665 Bacteria 3843
102 Ga0265314_10040705 3300031711 Bacteria 3333
103 Ga0316576_10117905 3300031727 Bacteria 1992
104 Ga0307406_10102849 3300031901 Bacteria 1950
105 Ga0307406_10241266 3300031901 Bacteria 1356
106 Ga0307409_100940673 3300031995 Bacteria 880
107 Ga0307409_100983681 3300031995 Bacteria 861
108 Ga0373933_0121019 3300035724 Bacteria 1639
109 Ga0373937_0312826 3300036401 Bacteria 1486
110 Ga0316582_0149507 3300036647 Bacteria 1578
111 Ga0395899_0389744 3300037312 Unclassified 924
112 Ga0395898_0270819 3300037466 Bacteria 1620
113 Ga0395905_0550524 3300037471 Bacteria 1055
114 Ga0436364_0555257 3300037853 Bacteria 3956
115 Ga0436364_0623022 3300037853 Bacteria 1707
116 Ga0436364_0643089 3300037853 Bacteria 10909
117 Ga0395901_0075758 3300038443 Bacteria 3510
118 Ga0395901_0324921 3300038443 Bacteria 1591
119 Ga0436365_0438553 3300039437 Bacteria 3811
120 Ga0436365_1022867 3300039437 Bacteria 2838
121 Ga0436360_0818696 3300039438 Bacteria 1258
122 Ga0436363_1110489 3300039450 Bacteria 2124
123 Ga0451795_0217659 3300041456 Bacteria 1796
124 Ga0451795_0336354 3300041456 Bacteria 1003
125 Ga0451795_0511034 3300041456 Bacteria 1445
126 Ga0451577_0011367 3300042876 Bacteria 8426
127 Ga0466969_0033067 3300044656 Bacteria 2628
128 Ga0466965_0165147 3300044683 Bacteria 1162
129 Ga0466965_0177673 3300044683 Bacteria 1122
130 Ga0466961_0015504 3300044693 Bacteria 4890
131 Ga0453684_0103765 3300044712 Bacteria 3473
132 Ga0453684_0278913 3300044712 Bacteria 1907
133 Ga0466959_0261626 3300045049 Bacteria 1191
134 Ga0451576_0096880 3300045051 Unclassified 3068
135 Ga0496104_0163090 3300048907 Bacteria 2138
136 Ga0496105_0208598 3300048908 Bacteria 1593
137 Ga0496114_0028911 3300048917 Bacteria 4553
138 Ga0496115_0023550 3300048918 Bacteria 4778
139 Ga0496118_0242583 3300048921 Bacteria 1030
140 Ga0501047_0001904 3300049581 Bacteria 20068
141 Ga0501035_0007192 3300049822 Bacteria 10417
142 Ga0501044_0012908 3300049823 Bacteria 9042
143 nmdc:mga0qj67_312454_c1 3300050509 Bacteria 1272
144 nmdc:mga06r32_162927_c1 3300050510 Unclassified 2212
145 nmdc:mga08y16_315754_c1 3300050511 Bacteria 1609
146 nmdc:mga0n895_119_c1 3300050512 Bacteria 46790
147 nmdc:mga0a205_2625_c1 3300050515 Bacteria 15880
148 nmdc:mga0a205_46210_c1 3300050515 Bacteria 4199

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2958158011 2958162653 234
2 3300009094 Ga0111539_10121060 Ga0111539_101210602 236
3 3300050510 nmdc:mga06r32_162927_c1 nmdc:mga06r32_162927_c1_1406_2155 236
4 iso_pu_bacteria 2510065059 2510316022 239
5 iso_pu_bacteria 2693429783 2694630740 239
6 iso_pu_bacteria 2693429784 2694634894 239
7 iso_pu_bacteria 2756170246 2756670902 239
8 iso_pu_bacteria 2844002411 2844009015 239
9 iso_pu_bacteria 2856328259 2856333598 239
10 iso_pu_bacteria 2856334872 2856337989 239
11 iso_pu_bacteria 2857367948 2857371849 239
12 iso_pu_bacteria 2869249662 2869252050 239
13 iso_pu_bacteria 2869264136 2869268009 239
14 iso_pu_bacteria 2869271264 2869274775 239
15 iso_pu_bacteria 2871459585 2871463702 239
16 iso_pu_bacteria 2871466892 2871469087 239
17 iso_pu_bacteria 2874131515 2874137036 239
18 iso_pu_bacteria 2874162495 2874164981 239
19 iso_pu_bacteria 2876377896 2876380516 239
20 iso_pu_bacteria 2876399893 2876405079 239
21 iso_pu_bacteria 2876406927 2876408992 239
22 iso_pu_bacteria 2878774303 2878776784 239
23 iso_pu_bacteria 2906363423 2906364779 239
24 iso_pu_bacteria 2906370794 2906376848 239
25 iso_pu_bacteria 2906378014 2906378766 239
26 iso_pu_bacteria 2906386501 2906391145 239
27 iso_pu_bacteria 2906408224 2906411210 239
28 iso_pu_bacteria 2922172374 2922178440 239
29 iso_pu_bacteria 2924733363 2924733950 239
30 iso_pu_bacteria 2924748358 2924749541 239
31 iso_pu_bacteria 2937868953 2937875251 239
32 iso_pu_bacteria 2938014810 2938016872 239
33 iso_pu_bacteria 2958122699 2958130064 239
34 iso_pu_bacteria 2958137437 2958143386 239
35 iso_pu_bacteria 2961136820 2961142498 239
36 iso_pu_bacteria 2965025482 2965025891 239
37 iso_pu_bacteria 2965032056 2965036626 239
38 iso_pu_bacteria 2965040258 2965043157 239
39 iso_pu_bacteria 2965047637 2965049332 239
40 iso_pu_bacteria 2965089291 2965096392 239
41 iso_pu_bacteria 2965102966 2965105648 239
42 iso_pu_bacteria 2970547951 2970551585 239
43 iso_pu_bacteria 2977872689 2977879547 239
44 iso_pu_bacteria 2977915119 2977918063 239
45 iso_pu_bacteria 2977935797 2977941982 239
46 iso_pu_bacteria 2977950692 2977954261 239
47 iso_pu_bacteria 2987645492 2987648806 239
48 iso_pu_bacteria 3004167301 3004167318 239
49 iso_pu_bacteria 3004195979 3004203680 239
50 iso_pu_bacteria 3004239961 3004244338 239
51 iso_pu_bacteria 8004300914 8004307206 239
52 iso_pu_bacteria 8004361976 8004364630 239
53 iso_pu_bacteria 8004695233 8004703259 239
54 iso_pu_bacteria 2989771324 2989775313 240
55 3300025261 Ga0209233_1000010 Ga0209233_1000010619 241
56 3300037466 Ga0395898_0270819 Ga0395898_0270819_478_1227 241
57 3300037471 Ga0395905_0550524 Ga0395905_0550524_34_783 241
58 3300038443 Ga0395901_0075758 Ga0395901_0075758_2459_3208 241
59 3300038443 Ga0395901_0324921 Ga0395901_0324921_784_1533 241
60 3300031901 Ga0307406_10241266 Ga0307406_102412662 242
61 iso_pu_bacteria 2519103095 2519457923 242
62 iso_pu_bacteria 2582581311 2585295222 242
63 iso_pu_bacteria 2599185239 2599737097 242
64 iso_pu_bacteria 2599185240 2599742825 242
65 iso_pu_bacteria 2599185355 2600204943 242
66 iso_pu_bacteria 2675903129 2676741932 242
67 iso_pu_bacteria 2791355137 2792833065 242
68 iso_pu_bacteria 2808606384 2808971523 242
69 iso_pu_bacteria 2808606390 2809006352 242
70 iso_pu_bacteria 2808606391 2809013730 242
71 iso_pu_bacteria 2816332253 2817260100 242
72 iso_pu_bacteria 2816332256 2817277764 242
73 iso_pu_bacteria 2816332286 2817455906 242
74 iso_pu_bacteria 2818991452 2819632593 242
75 iso_pu_bacteria 2863421361 2863421623 242
76 iso_pu_bacteria 2870068957 2870072428 242
77 iso_pu_bacteria 2904564687 2904565788 242
78 iso_pu_bacteria 2904571731 2904572831 242
79 iso_pu_bacteria 2928157003 2928159795 242
80 iso_pu_bacteria 2928163908 2928164146 242
81 iso_pu_bacteria 2928170801 2928173299 242
82 iso_pu_bacteria 2928536128 2928538645 242
83 iso_pu_bacteria 2981990288 2981994240 242
84 iso_pu_bacteria 641736154 642418017 242
85 iso_pu_bacteria 8020807995 8020813008 242
86 iso_pu_bacteria 8020938398 8020944806 242
87 iso_pu_bacteria 8020945358 8020949678 242
88 iso_pu_bacteria 8020953355 8020959884 242
89 iso_pu_bacteria 8039098773 8039099242 242
90 iso_pu_bacteria 8040167225 8040172322 242
91 iso_pu_bacteria 8040173305 8040175727 242
92 3300005444 Ga0070694_100000006 Ga0070694_10000000677 244
93 3300039450 Ga0436363_1110489 Ga0436363_1110489_591_1343 244
94 3300001989 JGI24739J22299_10020137 JGI24739J22299_100201373 246
95 3300001989 JGI24739J22299_10043043 JGI24739J22299_100430431 246
96 3300003316 rootH1_10099834 rootH1_100998342 246
97 3300003758 Ga0055532_1003764 Ga0055532_10037641 246
98 3300003758 Ga0055532_1005442 Ga0055532_10054422 246
99 3300003758 Ga0055532_1005530 Ga0055532_10055302 246
100 3300003760 Ga0055527_1003238 Ga0055527_10032381 246
101 3300003760 Ga0055527_1003240 Ga0055527_10032403 246
102 3300003761 Ga0055535_1006179 Ga0055535_10061793 246
103 3300003761 Ga0055535_1006180 Ga0055535_10061803 246
104 3300003762 Ga0055542_1000282 Ga0055542_10002822 246
105 3300003762 Ga0055542_1006657 Ga0055542_10066573 246
106 3300003763 Ga0055529_1003381 Ga0055529_10033813 246
107 3300003790 Ga0055528_1006211 Ga0055528_10062117 246
108 3300003841 Ga0055541_1007934 Ga0055541_10079342 246
109 3300003856 Ga0058692_1003038 Ga0058692_10030383 246
110 3300005344 Ga0070661_100126304 Ga0070661_1001263042 246
111 3300005455 Ga0070663_100054765 Ga0070663_1000547653 246
112 3300005563 Ga0068855_100539131 Ga0068855_1005391311 246
113 3300005616 Ga0068852_100011338 Ga0068852_1000113382 246
114 3300005842 Ga0068858_100155456 Ga0068858_1001554562 246
115 3300009093 Ga0105240_10053617 Ga0105240_100536171 246
116 3300009093 Ga0105240_10189399 Ga0105240_101893991 246
117 3300009545 Ga0105237_10116609 Ga0105237_101166093 246
118 3300010375 Ga0105239_10195723 Ga0105239_101957232 246
119 3300013104 Ga0157370_10291108 Ga0157370_102911081 246
120 3300015262 Ga0182007_10019740 Ga0182007_100197403 246
121 3300025225 Ga0209566_100170 Ga0209566_10017025 246
122 3300025226 Ga0209674_106298 Ga0209674_1062982 246
123 3300025228 Ga0209672_100028 Ga0209672_100028237 246
124 3300025228 Ga0209672_100038 Ga0209672_10003889 246
125 3300025229 Ga0209147_100112 Ga0209147_10011267 246
126 3300025229 Ga0209147_100117 Ga0209147_10011749 246
127 3300025242 Ga0209258_100109 Ga0209258_10010987 246
128 3300025242 Ga0209258_100112 Ga0209258_10011291 246
129 3300025254 Ga0209148_1000081 Ga0209148_10000811 246
130 3300025254 Ga0209148_1006317 Ga0209148_10063173 246
131 3300025263 Ga0209565_1013835 Ga0209565_10138353 246
132 3300025272 Ga0209455_1000050 Ga0209455_100005083 246
133 3300025272 Ga0209455_1004581 Ga0209455_10045811 246
134 3300025273 Ga0209673_1000038 Ga0209673_100003822 246
135 3300025295 Ga0209564_1011209 Ga0209564_10112091 246
136 3300025913 Ga0207695_10124931 Ga0207695_101249314 246
137 3300025914 Ga0207671_10021022 Ga0207671_100210222 246
138 3300025920 Ga0207649_10081734 Ga0207649_100817342 246
139 3300025924 Ga0207694_10032485 Ga0207694_100324852 246
140 3300025949 Ga0207667_10096258 Ga0207667_100962582 246
141 3300026035 Ga0207703_10158741 Ga0207703_101587411 246
142 3300026041 Ga0207639_10108400 Ga0207639_101084002 246
143 3300026067 Ga0207678_10098564 Ga0207678_100985643 246
144 3300026116 Ga0207674_10048304 Ga0207674_100483042 246
145 3300026142 Ga0207698_10003551 Ga0207698_100035518 246
146 3300027312 Ga0209371_1000090 Ga0209371_100009074 246
147 3300030500 Ga0268256_1000115 Ga0268256_100011521 246
148 3300031247 Ga0265340_10008752 Ga0265340_100087522 246
149 3300037312 Ga0395899_0389744 Ga0395899_0389744_27_788 246
150 3300039437 Ga0436365_1022867 Ga0436365_1022867_1876_2622 246
151 3300044683 Ga0466965_0177673 Ga0466965_0177673_286_1032 246
152 3300048921 Ga0496118_0242583 Ga0496118_0242583_150_896 246
153 3300005329 Ga0070683_100122312 Ga0070683_1001223122 247
154 3300013105 Ga0157369_10532233 Ga0157369_105322332 247
155 3300013296 Ga0157374_10057533 Ga0157374_100575332 247
156 3300025928 Ga0207700_10475183 Ga0207700_104751832 247
157 3300031901 Ga0307406_10102849 Ga0307406_101028493 247
158 3300031995 Ga0307409_100940673 Ga0307409_1009406731 247
159 3300031995 Ga0307409_100983681 Ga0307409_1009836811 247
160 3300035724 Ga0373933_0121019 Ga0373933_0121019_197_946 247
161 3300036401 Ga0373937_0312826 Ga0373937_0312826_590_1339 247
162 3300045051 Ga0451576_0096880 Ga0451576_0096880_1140_1889 247
163 3300048907 Ga0496104_0163090 Ga0496104_0163090_325_1074 247
164 3300048908 Ga0496105_0208598 Ga0496105_0208598_474_1223 247
165 3300048917 Ga0496114_0028911 Ga0496114_0028911_2962_3711 247
166 3300048918 Ga0496115_0023550 Ga0496115_0023550_2856_3605 247
167 3300050509 nmdc:mga0qj67_312454_c1 nmdc:mga0qj67_312454_c1_234_1013 247
168 iso_pu_bacteria 2524023250 2524610890 247
169 iso_pu_bacteria 2842333319 2842333408 247
170 iso_pu_bacteria 2856287931 2856291997 247
171 iso_pu_bacteria 2929239360 2929245355 247
172 iso_pu_bacteria 8018845410 8018849047 247
173 iso_pu_bacteria 8021120328 8021126661 247
174 3300006028 Ga0070717_10013331 Ga0070717_100133311 248
175 3300021384 Ga0213876_10021437 Ga0213876_100214373 248
176 3300021388 Ga0213875_10013164 Ga0213875_100131642 248
177 3300028563 Ga0265319_1036694 Ga0265319_10366942 248
178 3300028577 Ga0265318_10081538 Ga0265318_100815382 248
179 3300031711 Ga0265314_10040705 Ga0265314_100407053 248
180 3300037853 Ga0436364_0555257 Ga0436364_0555257_2444_3205 248
181 3300037853 Ga0436364_0623022 Ga0436364_0623022_922_1689 248
182 3300037853 Ga0436364_0643089 Ga0436364_0643089_7840_8613 248
183 3300039437 Ga0436365_0438553 Ga0436365_0438553_1000_1761 248
184 3300039438 Ga0436360_0818696 Ga0436360_0818696_485_1240 248
185 3300044712 Ga0453684_0278913 Ga0453684_0278913_369_1130 248
186 3300045049 Ga0466959_0261626 Ga0466959_0261626_123_881 248
187 3300006844 Ga0075428_100001061 Ga0075428_1000010614 249
188 3300006846 Ga0075430_100007342 Ga0075430_1000073422 249
189 3300044656 Ga0466969_0033067 Ga0466969_0033067_286_1053 249
190 3300044683 Ga0466965_0165147 Ga0466965_0165147_255_1022 249
191 3300044693 Ga0466961_0015504 Ga0466961_0015504_1163_1930 249
192 3300005937 Ga0081455_10047652 Ga0081455_100476523 250
193 3300001989 JGI24739J22299_10001032 JGI24739J22299_100010323 251
194 3300003215 JGI25153J46596_10022228 JGI25153J46596_100222282 251
195 3300003320 rootH2_10249391 rootH2_102493911 251
196 3300003790 Ga0055528_1000873 Ga0055528_10008733 251
197 3300003791 Ga0055530_10001217 Ga0055530_100012179 251
198 3300005262 Ga0065165_1000148 Ga0065165_100014838 251
199 3300005353 Ga0070669_100392388 Ga0070669_1003923882 251
200 3300005468 Ga0070707_100039569 Ga0070707_1000395693 251
201 3300005471 Ga0070698_100405588 Ga0070698_1004055882 251
202 3300005518 Ga0070699_100423637 Ga0070699_1004236372 251
203 3300005545 Ga0070695_100039677 Ga0070695_1000396772 251
204 3300005546 Ga0070696_100130503 Ga0070696_1001305031 251
205 3300005617 Ga0068859_100094269 Ga0068859_1000942693 251
206 3300005840 Ga0068870_10060654 Ga0068870_100606542 251
207 3300006852 Ga0075433_10000044 Ga0075433_1000004413 251
208 3300006852 Ga0075433_10176637 Ga0075433_101766372 251
209 3300006871 Ga0075434_100000739 Ga0075434_10000073927 251
210 3300006914 Ga0075436_100006966 Ga0075436_1000069667 251
211 3300006931 Ga0097620_100094269 Ga0097620_1000942693 251
212 3300007076 Ga0075435_100002236 Ga0075435_1000022363 251
213 3300014326 Ga0157380_10136256 Ga0157380_101362562 251
214 3300025273 Ga0209673_1000197 Ga0209673_100019777 251
215 3300025295 Ga0209564_1010172 Ga0209564_10101722 251
216 3300025297 Ga0209758_1007645 Ga0209758_10076452 251
217 3300025297 Ga0209758_1084786 Ga0209758_10847861 251
218 3300025298 Ga0209050_1000359 Ga0209050_100035910 251
219 3300025302 Ga0207426_1001227 Ga0207426_100122714 251
220 3300025304 Ga0209257_1001909 Ga0209257_100190910 251
221 3300025906 Ga0207699_10121668 Ga0207699_101216681 251
222 3300025922 Ga0207646_10045553 Ga0207646_100455533 251
223 3300031665 Ga0316575_10007987 Ga0316575_100079873 251
224 3300031727 Ga0316576_10117905 Ga0316576_101179052 251
225 3300036647 Ga0316582_0149507 Ga0316582_0149507_448_1212 251
226 3300041456 Ga0451795_0217659 Ga0451795_0217659_428_1213 251
227 3300041456 Ga0451795_0336354 Ga0451795_0336354_58_840 251
228 3300041456 Ga0451795_0511034 Ga0451795_0511034_12_770 251
229 3300042876 Ga0451577_0011367 Ga0451577_0011367_4388_5158 251
230 3300044712 Ga0453684_0103765 Ga0453684_0103765_605_1375 251
231 3300049581 Ga0501047_0001904 Ga0501047_0001904_11407_12183 251
232 3300049822 Ga0501035_0007192 Ga0501035_0007192_29_805 251
233 3300049823 Ga0501044_0012908 Ga0501044_0012908_35_811 251
234 3300050511 nmdc:mga08y16_315754_c1 nmdc:mga08y16_315754_c1_324_1118 251
235 3300050512 nmdc:mga0n895_119_c1 nmdc:mga0n895_119_c1_1131_1913 251
236 3300050515 nmdc:mga0a205_2625_c1 nmdc:mga0a205_2625_c1_13467_14249 251
237 3300050515 nmdc:mga0a205_46210_c1 nmdc:mga0a205_46210_c1_2413_3189 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

45

241

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

51

270

0.89

PF08659

KR

KR domain

46

224

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rku-assembly1.cif.gz_D substrate fingerprint and the structure of nadp+ dependent serine dehydrogenase from saccharomyces cerevisiae complexed with nadp+ 0.9831 2 251
3rku-assembly1.cif.gz_D substrate fingerprint and the structure of nadp+ dependent serine dehydrogenase from saccharomyces cerevisiae complexed with nadp+ 0.9754 2 251
3asu-assembly1.cif.gz_A-2 crystal structure of serine dehydrogenase from escherichia coli 0.9709 3 243
3asu-assembly1.cif.gz_B-2 crystal structure of serine dehydrogenase from escherichia coli 0.9691 3 243
3asu-assembly1.cif.gz_A-2 crystal structure of serine dehydrogenase from escherichia coli 0.9579 3 243
ID Description Score Start End Superfamily
af_O15744_2_259_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9874 2 251 3.40.50.720
3rkuD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9831 2 251 3.40.50.720
af_O15744_2_259_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9796 2 251 3.40.50.720
af_Q9P7B4_1_257_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9794 2 251 3.40.50.720
3rkuD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9754 2 251 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3D4T8D4-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9989 83 250 GO:0016491
AF-A0A2A4NCL5-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9978 2 251 GO:0016491
AF-A0A353VFZ3-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9973 2 251 GO:0016491
AF-A0A6J4SP57-F1-model_v4 Oxidoreductase, short-chain dehydrogenase/reductase family 0.9966 2 250 GO:0016020
GO:0016491
AF-A0A434ATS1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9961 2 251 GO:0016491

Feature Viewer

pLDDT pTM Quality
95.1 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map