F349766

General Info

Members Datasets Scaffolds Average Seq Length
237 127 474 236

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100260692|Ga0070714_1002606922
Length 253
Sequence MTTPPSHPIPTDHLPGFAPERKAAYVEAMFDTIAPRYDLMNRLMTFGMDRRWRNCVVARAAPPVGGSALDVATGTGDIALALARRVGPRGAVLATDFSEGMMRPGPGKAAKAGVGGIVRFMAADALALPFPDNTFDCVTSGFAMRNVTDIERAFREMRRVTKPGGRVVCLDVAKPDFPPVRFLHQGYFNRVVPLLGRIVTGHGEAYRYLPESARNFPPPPALKAIMERAGLRDVRFRRLTLGAVAVHTGTKTD

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
12 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
35 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
45 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
47 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
48 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
49 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
50 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
51 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
52 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
55 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
56 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
57 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
58 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
59 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
60 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
61 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
62 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
63 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
64 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
65 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
66 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
67 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
68 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
69 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
70 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
71 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
72 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
73 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
74 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
75 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
76 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
77 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
78 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
79 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
92 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
93 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
94 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
95 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
96 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
97 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
98 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
99 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
100 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
101 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
102 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
103 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
104 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
105 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
108 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
109 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
110 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
111 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
112 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
113 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
114 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
115 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
116 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
119 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
120 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
121 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
122 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
123 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
124 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
125 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
126 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
127 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.44
Nodule 0
Rhizoplane 1.69
Rhizosphere 86.5
Stem 0
Stem Tuber 0
Unclassified 0.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100260692 3300005435 Bacteria 1605
2 JGI25407J50210_10001971 3300003373 Bacteria 4776
3 Ga0070669_100187591 3300005353 Bacteria 1621
4 Ga0070667_100029650 3300005367 Bacteria 4561
5 Ga0070708_100032554 3300005445 Bacteria 4524
6 Ga0070662_100409472 3300005457 Bacteria 1120
7 Ga0070706_100182670 3300005467 Bacteria 1959
8 Ga0070706_100799301 3300005467 Unclassified 873
9 Ga0070707_100001798 3300005468 Bacteria 20598
10 Ga0070707_100161322 3300005468 Bacteria 2184
11 Ga0070698_100003367 3300005471 Bacteria 17584
12 Ga0070699_100027899 3300005518 Bacteria 4870
13 Ga0070704_100070610 3300005549 Bacteria 2534
14 Ga0068858_100264296 3300005842 Bacteria 1636
15 Ga0068860_100012697 3300005843 Bacteria 8287
16 Ga0068862_100848529 3300005844 Bacteria 895
17 Ga0081455_10015805 3300005937 Bacteria 7310
18 Ga0081538_10000131 3300005981 Bacteria 77253
19 Ga0081538_10029977 3300005981 Bacteria 3703
20 Ga0081538_10038015 3300005981 Bacteria 3112
21 Ga0081538_10047563 3300005981 Bacteria 2629
22 Ga0075363_100041856 3300006048 Bacteria 2417
23 Ga0075364_10019421 3300006051 Bacteria 4265
24 Ga0075364_10050994 3300006051 Bacteria 2701
25 Ga0075364_10066884 3300006051 Bacteria 2361
26 Ga0075432_10046109 3300006058 Bacteria 1530
27 Ga0075428_100000321 3300006844 Bacteria 47452
28 Ga0075428_100026321 3300006844 Bacteria 6439
29 Ga0075428_100038196 3300006844 Bacteria 5283
30 Ga0075430_100000590 3300006846 Bacteria 27564
31 Ga0075430_100009205 3300006846 Bacteria 8346
32 Ga0075430_100323939 3300006846 Bacteria 1274
33 Ga0075431_100002898 3300006847 Bacteria 16590
34 Ga0075431_100013713 3300006847 Bacteria 8188
35 Ga0075431_100074394 3300006847 Bacteria 3505
36 Ga0075434_100007974 3300006871 Bacteria 9816
37 Ga0075429_100000279 3300006880 Bacteria 36024
38 Ga0075429_100001235 3300006880 Bacteria 20728
39 Ga0075429_100090959 3300006880 Bacteria 2662
40 Ga0075429_100125184 3300006880 Bacteria 2247
41 Ga0111539_10005341 3300009094 Bacteria 16619
42 Ga0105247_10042076 3300009101 Bacteria 2796
43 Ga0105247_10287529 3300009101 Bacteria 1136
44 Ga0114129_10002716 3300009147 Bacteria 24646
45 Ga0114129_10123354 3300009147 Bacteria 3563
46 Ga0114129_10200284 3300009147 Bacteria 2705
47 Ga0114129_10375656 3300009147 Bacteria 1878
48 Ga0105243_10366592 3300009148 Bacteria 1328
49 Ga0105248_10060180 3300009177 Bacteria 4264
50 Ga0105249_10033145 3300009553 Bacteria 4676
51 Ga0105239_10427859 3300010375 Bacteria 1500
52 Ga0157374_10544115 3300013296 Bacteria 1168
53 Ga0163163_10079725 3300014325 Bacteria 3273
54 Ga0157377_10195826 3300014745 Bacteria 1280
55 Ga0207645_10081030 3300025907 Bacteria 2081
56 Ga0207684_10018372 3300025910 Bacteria 5986
57 Ga0207684_10338707 3300025910 Bacteria 1295
58 Ga0207646_10009682 3300025922 Bacteria 9499
59 Ga0207681_10046153 3300025923 Bacteria 2930
60 Ga0207687_10005416 3300025927 Bacteria 8437
61 Ga0207667_10071342 3300025949 Bacteria 3612
62 Ga0207658_10081391 3300025986 Bacteria 2483
63 Ga0207658_10378173 3300025986 Bacteria 1240
64 Ga0207641_10157767 3300026088 Bacteria 2060
65 Ga0207683_10083884 3300026121 Bacteria 2832
66 Ga0207428_10116638 3300027907 Bacteria 2050
67 Ga0268264_10045549 3300028381 Bacteria 3642
68 Ga0268264_10241497 3300028381 Bacteria 1673
69 Ga0265338_10235789 3300028800 Bacteria 1358
70 Ga0265327_10051954 3300031251 Bacteria 2136
71 Ga0265327_10124588 3300031251 Bacteria 1218
72 Ga0307408_100581096 3300031548 Bacteria 993
73 Ga0307410_10005227 3300031852 Bacteria 6838
74 Ga0307406_10063167 3300031901 Bacteria 2398
75 Ga0307407_10026237 3300031903 Bacteria 3082
76 Ga0307409_100078336 3300031995 Bacteria 2658
77 Ga0307409_100302472 3300031995 Bacteria 1489
78 Ga0307416_100171728 3300032002 Bacteria 2019
79 Ga0307411_10169396 3300032005 Bacteria 1645
80 Ga0307415_100018088 3300032126 Bacteria 4246
81 Ga0307415_100029861 3300032126 Bacteria 3490
82 Ga0316584_0174443 3300036712 Bacteria 1593
83 Ga0400483_021490 3300039062 Bacteria 16592
84 Ga0400483_050617 3300039062 Bacteria 4139
85 Ga0400483_113768 3300039062 Bacteria 9598
86 Ga0400483_154184 3300039062 Bacteria 4492
87 Ga0400483_166419 3300039062 Bacteria 1060
88 Ga0400483_227031 3300039062 Bacteria 10357
89 Ga0400483_227474 3300039062 Bacteria 15004
90 Ga0451837_0911603 3300041494 Bacteria 888
91 Ga0439448_0038753 3300042005 Bacteria 1535
92 Ga0439451_028952 3300042009 Bacteria 1116
93 Ga0439463_007501 3300042016 Bacteria 2692
94 Ga0439435_0085161 3300042436 Bacteria 954
95 Ga0439460_0000962 3300042461 Bacteria 6612
96 Ga0451577_0021735 3300042876 Bacteria 5867
97 Ga0466957_0485310 3300044842 Bacteria 855
98 Ga0495603_0010358 3300046455 Bacteria 5645
99 Ga0495596_0143589 3300046500 Bacteria 927
100 Ga0495630_0077311 3300046517 Bacteria 2509
101 Ga0495586_0018345 3300046535 Bacteria 3726
102 Ga0495656_0039917 3300046615 Bacteria 1953
103 Ga0495634_0003081 3300046642 Bacteria 13564
104 Ga0495588_0035482 3300046674 Bacteria 2527
105 Ga0495658_0096940 3300046683 Bacteria 1755
106 Ga0495613_0000201 3300046689 Bacteria 58736
107 Ga0495672_0003750 3300047320 Bacteria 12813
108 Ga0496109_0127164 3300048912 Bacteria 2376
109 Ga0496110_0288782 3300048913 Bacteria 1494
110 Ga0496110_0590440 3300048913 Bacteria 1008
111 Ga0496114_0004753 3300048917 Bacteria 10575
112 Ga0501032_0033031 3300049569 Bacteria 3546
113 Ga0501034_0021102 3300049571 Bacteria 6646
114 Ga0501034_0045857 3300049571 Bacteria 4416
115 Ga0501034_0091423 3300049571 Bacteria 3041
116 Ga0501034_0117825 3300049571 Bacteria 2643
117 Ga0501036_0002032 3300049572 Bacteria 15758
118 Ga0501036_0150060 3300049572 Bacteria 1966
119 Ga0501036_0159008 3300049572 Bacteria 1905
120 Ga0501036_0180180 3300049572 Bacteria 1779
121 Ga0501037_0048996 3300049573 Bacteria 3094
122 Ga0501038_0059460 3300049574 Bacteria 3274
123 Ga0501039_0030919 3300049575 Bacteria 4129
124 Ga0501039_0058522 3300049575 Bacteria 2985
125 Ga0501039_0241809 3300049575 Bacteria 1419
126 Ga0501040_0022462 3300049576 Bacteria 4221
127 Ga0501040_0036077 3300049576 Bacteria 3354
128 Ga0501041_0029287 3300049577 Bacteria 3322
129 Ga0501041_0521215 3300049577 Bacteria 757
130 Ga0501042_0010311 3300049578 Bacteria 6257
131 Ga0501042_0162029 3300049578 Bacteria 1614
132 Ga0501042_0176321 3300049578 Bacteria 1542
133 Ga0501042_0356155 3300049578 Bacteria 1059
134 Ga0501043_0054176 3300049579 Bacteria 3150
135 Ga0501046_0038319 3300049580 Bacteria 3848
136 Ga0501046_0058497 3300049580 Bacteria 3021
137 Ga0501048_0038491 3300049582 Bacteria 3431
138 Ga0501048_0199567 3300049582 Bacteria 1418
139 Ga0501068_0004232 3300049584 Bacteria 7783
140 Ga0501068_0018882 3300049584 Bacteria 3995
141 Ga0501068_0039921 3300049584 Bacteria 2816
142 Ga0501068_0113256 3300049584 Bacteria 1688
143 Ga0501068_0144068 3300049584 Bacteria 1495
144 Ga0501069_0077665 3300049585 Bacteria 1867
145 Ga0501069_0140698 3300049585 Bacteria 1384
146 Ga0501069_0159115 3300049585 Bacteria 1300
147 Ga0501069_0254928 3300049585 Bacteria 1024
148 Ga0501070_0000376 3300049586 Bacteria 40641
149 Ga0501070_0001488 3300049586 Bacteria 20962
150 Ga0501070_0002115 3300049586 Bacteria 17423
151 Ga0501070_0528172 3300049586 Bacteria 946
152 Ga0501071_0035170 3300049587 Bacteria 3568
153 Ga0501071_0077169 3300049587 Bacteria 2433
154 Ga0501071_0486125 3300049587 Bacteria 946
155 Ga0501072_0000356 3300049588 Bacteria 32647
156 Ga0501072_0016234 3300049588 Bacteria 5712
157 Ga0501072_0037182 3300049588 Bacteria 3818
158 Ga0501072_0040821 3300049588 Bacteria 3644
159 Ga0501072_0041077 3300049588 Bacteria 3632
160 Ga0501073_0009281 3300049589 Bacteria 7256
161 Ga0501073_0202485 3300049589 Bacteria 1373
162 Ga0501074_0038605 3300049590 Bacteria 3460
163 Ga0501074_0125265 3300049590 Bacteria 1838
164 Ga0501074_0139065 3300049590 Bacteria 1737
165 Ga0501075_0004623 3300049591 Bacteria 9342
166 Ga0501075_0074792 3300049591 Bacteria 2562
167 Ga0501075_0167855 3300049591 Bacteria 1674
168 Ga0501075_0341843 3300049591 Bacteria 1140
169 Ga0501076_0021142 3300049592 Bacteria 4987
170 Ga0501076_0046274 3300049592 Bacteria 3437
171 Ga0501076_0056161 3300049592 Bacteria 3124
172 Ga0501076_0352618 3300049592 Bacteria 1208
173 Ga0501077_0006128 3300049593 Bacteria 7344
174 Ga0501077_0035188 3300049593 Bacteria 3188
175 Ga0501079_0039165 3300049741 Bacteria 3655
176 Ga0501079_0116540 3300049741 Bacteria 2076
177 Ga0501079_0363397 3300049741 Bacteria 1134
178 Ga0501080_0190167 3300049742 Bacteria 1887
179 Ga0501080_0191525 3300049742 Bacteria 1879
180 Ga0501080_0622743 3300049742 Bacteria 957
181 Ga0501080_0814298 3300049742 Bacteria 818
182 Ga0501081_0006672 3300049743 Bacteria 7505
183 Ga0501081_0053861 3300049743 Bacteria 2778
184 Ga0501083_0000769 3300049744 Bacteria 20998
185 Ga0501083_0002021 3300049744 Bacteria 13960
186 Ga0501035_0237261 3300049822 Bacteria 1552
187 Ga0501035_0559693 3300049822 Bacteria 936
188 Ga0501044_0005328 3300049823 Bacteria 14310
189 Ga0501044_0016334 3300049823 Bacteria 7969
190 Ga0501045_0000300 3300049824 Bacteria 29049
191 Ga0501045_0039346 3300049824 Bacteria 3441
192 Ga0501045_0112375 3300049824 Bacteria 2020
193 nmdc:mga03683_15937_c1 3300050489 Bacteria 2814
194 nmdc:mga03683_71108_c1 3300050489 Bacteria 1488
195 nmdc:mga03n38_34760_c1 3300050490 Bacteria 2155
196 nmdc:mga03n38_74782_c1 3300050490 Bacteria 1576
197 nmdc:mga03n38_75588_c1 3300050490 Bacteria 1569
198 nmdc:mga00v17_1059_c1 3300050491 Bacteria 14534
199 nmdc:mga00v17_140037_c1 3300050491 Bacteria 1550
200 nmdc:mga00v17_251785_c1 3300050491 Bacteria 1145
201 nmdc:mga00v17_5771_c1 3300050491 Bacteria 6540
202 nmdc:mga0yw44_180040_c1 3300050492 Bacteria 1391
203 nmdc:mga0yw44_341654_c1 3300050492 Bacteria 1007
204 nmdc:mga0yw44_514284_c1 3300050492 Bacteria 812
205 nmdc:mga06z11_127654_c1 3300050494 Bacteria 1425
206 nmdc:mga06z11_144404_c1 3300050494 Bacteria 1347
207 nmdc:mga05p37_52674_c1 3300050507 Bacteria 5003
208 nmdc:mga05p37_5521_c1 3300050507 Bacteria 14853
209 nmdc:mga05p37_81122_c1 3300050507 Bacteria 3996
210 nmdc:mga09592_302790_c1 3300050508 Bacteria 1386
211 nmdc:mga09592_3527_c1 3300050508 Bacteria 12638
212 nmdc:mga09592_625_c1 3300050508 Bacteria 27036
213 nmdc:mga0qj67_1212_c1 3300050509 Bacteria 17926
214 nmdc:mga0qj67_423854_c1 3300050509 Bacteria 1073
215 nmdc:mga06r32_172100_c1 3300050510 Bacteria 2149
216 nmdc:mga06r32_4414_c1 3300050510 Bacteria 12585
217 nmdc:mga06r32_52999_c1 3300050510 Bacteria 3886
218 nmdc:mga06r32_91585_c1 3300050510 Bacteria 2972
219 nmdc:mga08y16_44778_c1 3300050511 Bacteria 4638
220 nmdc:mga0n895_1501_c1 3300050512 Bacteria 17505
221 nmdc:mga0rr50_4038_c1 3300050513 Bacteria 8563
222 nmdc:mga0a205_513_c1 3300050515 Bacteria 30367
223 Ga0495601_0346696 3300053077 Bacteria 966
224 Ga0500635_0001860 3300053080 Bacteria 5146
225 Ga0495655_0044907 3300053083 Bacteria 1145
226 Ga0500568_0000239 3300053139 Bacteria 46970
227 Ga0501084_0001339 3300054114 Bacteria 19448
228 Ga0501084_0071006 3300054114 Bacteria 2915
229 Ga0501084_0120278 3300054114 Bacteria 2208
230 Ga0501084_0129484 3300054114 Bacteria 2124
231 Ga0501082_0100635 3300060353 Bacteria 2500
232 Ga0501082_0114963 3300060353 Bacteria 2330
233 Ga0501082_0202044 3300060353 Bacteria 1729
234 Ga0501082_0314710 3300060353 Bacteria 1363
235 Ga0530510_0046084 3300061734 Bacteria 3149
236 Ga0530510_0185002 3300061734 Bacteria 1545
237 Ga0530510_0697420 3300061734 Bacteria 774
238 Ga0070714_100260692
239 JGI25407J50210_10001971
240 Ga0070669_100187591
241 Ga0070667_100029650
242 Ga0070708_100032554
243 Ga0070662_100409472
244 Ga0070706_100182670
245 Ga0070706_100799301
246 Ga0070707_100001798
247 Ga0070707_100161322
248 Ga0070698_100003367
249 Ga0070699_100027899
250 Ga0070704_100070610
251 Ga0068858_100264296
252 Ga0068860_100012697
253 Ga0068862_100848529
254 Ga0081455_10015805
255 Ga0081538_10000131
256 Ga0081538_10029977
257 Ga0081538_10038015
258 Ga0081538_10047563
259 Ga0075363_100041856
260 Ga0075364_10019421
261 Ga0075364_10050994
262 Ga0075364_10066884
263 Ga0075432_10046109
264 Ga0075428_100000321
265 Ga0075428_100026321
266 Ga0075428_100038196
267 Ga0075430_100000590
268 Ga0075430_100009205
269 Ga0075430_100323939
270 Ga0075431_100002898
271 Ga0075431_100013713
272 Ga0075431_100074394
273 Ga0075434_100007974
274 Ga0075429_100000279
275 Ga0075429_100001235
276 Ga0075429_100090959
277 Ga0075429_100125184
278 Ga0111539_10005341
279 Ga0105247_10042076
280 Ga0105247_10287529
281 Ga0114129_10002716
282 Ga0114129_10123354
283 Ga0114129_10200284
284 Ga0114129_10375656
285 Ga0105243_10366592
286 Ga0105248_10060180
287 Ga0105249_10033145
288 Ga0105239_10427859
289 Ga0157374_10544115
290 Ga0163163_10079725
291 Ga0157377_10195826
292 Ga0207645_10081030
293 Ga0207684_10018372
294 Ga0207684_10338707
295 Ga0207646_10009682
296 Ga0207681_10046153
297 Ga0207687_10005416
298 Ga0207667_10071342
299 Ga0207658_10081391
300 Ga0207658_10378173
301 Ga0207641_10157767
302 Ga0207683_10083884
303 Ga0207428_10116638
304 Ga0268264_10045549
305 Ga0268264_10241497
306 Ga0265338_10235789
307 Ga0265327_10051954
308 Ga0265327_10124588
309 Ga0307408_100581096
310 Ga0307410_10005227
311 Ga0307406_10063167
312 Ga0307407_10026237
313 Ga0307409_100078336
314 Ga0307409_100302472
315 Ga0307416_100171728
316 Ga0307411_10169396
317 Ga0307415_100018088
318 Ga0307415_100029861
319 Ga0316584_0174443
320 Ga0400483_021490
321 Ga0400483_050617
322 Ga0400483_113768
323 Ga0400483_154184
324 Ga0400483_166419
325 Ga0400483_227031
326 Ga0400483_227474
327 Ga0451837_0911603
328 Ga0439448_0038753
329 Ga0439451_028952
330 Ga0439463_007501
331 Ga0439435_0085161
332 Ga0439460_0000962
333 Ga0451577_0021735
334 Ga0466957_0485310
335 Ga0495603_0010358
336 Ga0495596_0143589
337 Ga0495630_0077311
338 Ga0495586_0018345
339 Ga0495656_0039917
340 Ga0495634_0003081
341 Ga0495588_0035482
342 Ga0495658_0096940
343 Ga0495613_0000201
344 Ga0495672_0003750
345 Ga0496109_0127164
346 Ga0496110_0288782
347 Ga0496110_0590440
348 Ga0496114_0004753
349 Ga0501032_0033031
350 Ga0501034_0021102
351 Ga0501034_0045857
352 Ga0501034_0091423
353 Ga0501034_0117825
354 Ga0501036_0002032
355 Ga0501036_0150060
356 Ga0501036_0159008
357 Ga0501036_0180180
358 Ga0501037_0048996
359 Ga0501038_0059460
360 Ga0501039_0030919
361 Ga0501039_0058522
362 Ga0501039_0241809
363 Ga0501040_0022462
364 Ga0501040_0036077
365 Ga0501041_0029287
366 Ga0501041_0521215
367 Ga0501042_0010311
368 Ga0501042_0162029
369 Ga0501042_0176321
370 Ga0501042_0356155
371 Ga0501043_0054176
372 Ga0501046_0038319
373 Ga0501046_0058497
374 Ga0501048_0038491
375 Ga0501048_0199567
376 Ga0501068_0004232
377 Ga0501068_0018882
378 Ga0501068_0039921
379 Ga0501068_0113256
380 Ga0501068_0144068
381 Ga0501069_0077665
382 Ga0501069_0140698
383 Ga0501069_0159115
384 Ga0501069_0254928
385 Ga0501070_0000376
386 Ga0501070_0001488
387 Ga0501070_0002115
388 Ga0501070_0528172
389 Ga0501071_0035170
390 Ga0501071_0077169
391 Ga0501071_0486125
392 Ga0501072_0000356
393 Ga0501072_0016234
394 Ga0501072_0037182
395 Ga0501072_0040821
396 Ga0501072_0041077
397 Ga0501073_0009281
398 Ga0501073_0202485
399 Ga0501074_0038605
400 Ga0501074_0125265
401 Ga0501074_0139065
402 Ga0501075_0004623
403 Ga0501075_0074792
404 Ga0501075_0167855
405 Ga0501075_0341843
406 Ga0501076_0021142
407 Ga0501076_0046274
408 Ga0501076_0056161
409 Ga0501076_0352618
410 Ga0501077_0006128
411 Ga0501077_0035188
412 Ga0501079_0039165
413 Ga0501079_0116540
414 Ga0501079_0363397
415 Ga0501080_0190167
416 Ga0501080_0191525
417 Ga0501080_0622743
418 Ga0501080_0814298
419 Ga0501081_0006672
420 Ga0501081_0053861
421 Ga0501083_0000769
422 Ga0501083_0002021
423 Ga0501035_0237261
424 Ga0501035_0559693
425 Ga0501044_0005328
426 Ga0501044_0016334
427 Ga0501045_0000300
428 Ga0501045_0039346
429 Ga0501045_0112375
430 nmdc:mga03683_15937_c1
431 nmdc:mga03683_71108_c1
432 nmdc:mga03n38_34760_c1
433 nmdc:mga03n38_74782_c1
434 nmdc:mga03n38_75588_c1
435 nmdc:mga00v17_1059_c1
436 nmdc:mga00v17_140037_c1
437 nmdc:mga00v17_251785_c1
438 nmdc:mga00v17_5771_c1
439 nmdc:mga0yw44_180040_c1
440 nmdc:mga0yw44_341654_c1
441 nmdc:mga0yw44_514284_c1
442 nmdc:mga06z11_127654_c1
443 nmdc:mga06z11_144404_c1
444 nmdc:mga05p37_52674_c1
445 nmdc:mga05p37_5521_c1
446 nmdc:mga05p37_81122_c1
447 nmdc:mga09592_302790_c1
448 nmdc:mga09592_3527_c1
449 nmdc:mga09592_625_c1
450 nmdc:mga0qj67_1212_c1
451 nmdc:mga0qj67_423854_c1
452 nmdc:mga06r32_172100_c1
453 nmdc:mga06r32_4414_c1
454 nmdc:mga06r32_52999_c1
455 nmdc:mga06r32_91585_c1
456 nmdc:mga08y16_44778_c1
457 nmdc:mga0n895_1501_c1
458 nmdc:mga0rr50_4038_c1
459 nmdc:mga0a205_513_c1
460 Ga0495601_0346696
461 Ga0500635_0001860
462 Ga0495655_0044907
463 Ga0500568_0000239
464 Ga0501084_0001339
465 Ga0501084_0071006
466 Ga0501084_0120278
467 Ga0501084_0129484
468 Ga0501082_0100635
469 Ga0501082_0114963
470 Ga0501082_0202044
471 Ga0501082_0314710
472 Ga0530510_0046084
473 Ga0530510_0185002
474 Ga0530510_0697420

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

19

251

0.98

PF08241

Methyltransf_11

Methyltransferase domain

69

169

0.97

PF13649

Methyltransf_25

Methyltransferase domain

68

165

0.95

PF13847

Methyltransf_31

Methyltransferase domain

64

201

0.95

PF08242

Methyltransf_12

Methyltransferase domain

69

167

0.86

PF13489

Methyltransf_23

Methyltransferase domain

47

235

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.8904 24 231
3ege-assembly1.cif.gz_A crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution 0.8359 47 218
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.7998 24 231
4qtt-assembly2.cif.gz_D structure of s. cerevisiae bud23-trm112 complex involved in formation of m7g1575 on 18s rrna (apo-form) 0.7892 33 229
4krg-assembly2.cif.gz_B semet haemonchus contortus phosphoethanolamine n-methyltransferase 1 in complex with phosphoethanolamine and s-adenosylhomocysteine 0.7891 9 153
ID Description Score Start End Superfamily
af_P9WFR3_19_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9632 26 230 3.40.50.150
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9456 24 230 3.40.50.150
af_A4IC78_24_256_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9436 24 231 3.40.50.150
af_Q9VYF8_68_301_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9391 25 230 3.40.50.150
af_Q3ED65_41_261_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.938 25 230 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7T0C3M3-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.9687 14 232 GO:0009234
GO:0032259
GO:0043770
AF-A0A6J4QEY9-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.96 19 231 GO:0009234
GO:0032259
GO:0043770
AF-A0A7C2E450-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.9595 16 232 GO:0009234
GO:0032259
GO:0043770
AF-A0A660TX35-F1-model_v4 Bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE 0.9589 16 230 GO:0008168
GO:0032259
GO:0042181
AF-A0A2E2SF17-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9574 14 230 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770

Map