F349683

General Info

Members Datasets Scaffolds Average Seq Length
237 151 474 127

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_11509052|Ga0070658_115090521
Length 126
Sequence MDLLDTQLYALIGDDGFARLTAAFFRRVPTDPILAPMYQHDLAGAEWRLREFLVGRFGGPTRYIEQRGHPRLRMRHAPFKINTAARNRWIETMTAALEEAALPPEANATLRRFFDDAATFMINHPD

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
68 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
129 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
130 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.05
Metatranscriptomes 2.95
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0
Rhizoplane 2.11
Rhizosphere 85.23
Stem 0
Stem Tuber 0
Unclassified 13.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_11509052 3300005327 Bacteria 583
2 Ga0070658_10904592 3300005327 Bacteria 767
3 Ga0070676_10099707 3300005328 Bacteria 1792
4 Ga0070676_10366273 3300005328 Bacteria 994
5 Ga0070683_101150807 3300005329 Bacteria 745
6 Ga0070683_101527654 3300005329 Bacteria 642
7 Ga0070690_100016588 3300005330 Bacteria 4417
8 Ga0070677_10260752 3300005333 Bacteria 865
9 Ga0068869_100002479 3300005334 Bacteria 11131
10 Ga0070680_100027031 3300005336 Bacteria 4593
11 Ga0070680_101286692 3300005336 Bacteria 633
12 Ga0070682_101885154 3300005337 Unclassified 523
13 Ga0068868_101235844 3300005338 Bacteria 692
14 Ga0070660_100026355 3300005339 Bacteria 4327
15 Ga0070660_100038571 3300005339 Bacteria 3627
16 Ga0070689_100120269 3300005340 Bacteria 2097
17 Ga0070689_100154668 3300005340 Bacteria 1851
18 Ga0070691_10030942 3300005341 Bacteria 2508
19 Ga0070669_100264902 3300005353 Bacteria 1372
20 Ga0070675_100001621 3300005354 Bacteria 16598
21 Ga0070671_100362783 3300005355 Bacteria 1237
22 Ga0070673_100020088 3300005364 Bacteria 4810
23 Ga0070688_100136490 3300005365 Bacteria 1661
24 Ga0070667_100029195 3300005367 Bacteria 4594
25 Ga0070667_100640427 3300005367 Bacteria 981
26 Ga0070667_100939030 3300005367 Bacteria 806
27 Ga0070667_101856969 3300005367 Bacteria 567
28 Ga0070713_100013675 3300005436 Bacteria 5999
29 Ga0070713_100043922 3300005436 Bacteria 3656
30 Ga0070701_10009264 3300005438 Bacteria 4306
31 Ga0070700_100082832 3300005441 Bacteria 2075
32 Ga0070678_100329185 3300005456 Bacteria 1307
33 Ga0070681_10196958 3300005458 Bacteria 1933
34 Ga0070681_10787156 3300005458 Bacteria 868
35 Ga0068867_100005747 3300005459 Bacteria 8800
36 Ga0070679_100018221 3300005530 Bacteria 6809
37 Ga0070684_100006622 3300005535 Bacteria 8973
38 Ga0068853_100091014 3300005539 Bacteria 2682
39 Ga0068853_101932794 3300005539 Bacteria 572
40 Ga0070672_100022640 3300005543 Bacteria 4620
41 Ga0070686_100546403 3300005544 Bacteria 905
42 Ga0070665_100367722 3300005548 Bacteria 1445
43 Ga0070665_100783265 3300005548 Bacteria 967
44 Ga0068855_100102606 3300005563 Bacteria 3292
45 Ga0068857_100007886 3300005577 Bacteria 9185
46 Ga0068854_100143045 3300005578 Bacteria 1837
47 Ga0068854_100186865 3300005578 Bacteria 1622
48 Ga0068854_100462005 3300005578 Bacteria 1062
49 Ga0068856_100001598 3300005614 Bacteria 23676
50 Ga0068856_100018153 3300005614 Bacteria 6821
51 Ga0068852_100055546 3300005616 Bacteria 3418
52 Ga0068852_100334061 3300005616 Bacteria 1475
53 Ga0068859_100045205 3300005617 Bacteria 4425
54 Ga0068859_101213977 3300005617 Bacteria 831
55 Ga0068861_100014453 3300005719 Bacteria 5541
56 Ga0068863_100047358 3300005841 Bacteria 4078
57 Ga0068858_100062032 3300005842 Bacteria 3456
58 Ga0068860_100068385 3300005843 Bacteria 3375
59 Ga0068860_100285698 3300005843 Bacteria 1613
60 Ga0068860_101426734 3300005843 Unclassified 714
61 Ga0068862_101796277 3300005844 Bacteria 622
62 Ga0068862_102060881 3300005844 Bacteria 581
63 Ga0081455_10022431 3300005937 Bacteria 5899
64 Ga0068871_100157289 3300006358 Bacteria 1942
65 Ga0075430_100004174 3300006846 Bacteria 12190
66 Ga0068865_100006623 3300006881 Bacteria 7085
67 Ga0097620_100045206 3300006931 Bacteria 4425
68 Ga0097620_101213980 3300006931 Bacteria 831
69 Ga0105240_10006444 3300009093 Bacteria 17256
70 Ga0105240_10051948 3300009093 Bacteria 5155
71 Ga0105240_10343082 3300009093 Bacteria 1696
72 Ga0105240_10438203 3300009093 Bacteria 1465
73 Ga0105245_10219011 3300009098 Bacteria 1836
74 Ga0105243_10020195 3300009148 Bacteria 5051
75 Ga0105241_10003203 3300009174 Bacteria 12180
76 Ga0105241_10138775 3300009174 Bacteria 1977
77 Ga0105242_10024408 3300009176 Bacteria 4775
78 Ga0105248_11550029 3300009177 Bacteria 750
79 Ga0105248_11653272 3300009177 Unclassified 726
80 Ga0105248_11663020 3300009177 Bacteria 724
81 Ga0105237_10002468 3300009545 Bacteria 22939
82 Ga0105237_10003436 3300009545 Bacteria 18797
83 Ga0105237_10549339 3300009545 Bacteria 1162
84 Ga0105238_10051490 3300009551 Bacteria 4142
85 Ga0105238_12050965 3300009551 Bacteria 606
86 Ga0105239_10005790 3300010375 Bacteria 14418
87 Ga0105239_13464594 3300010375 Unclassified 513
88 Ga0105246_10244201 3300011119 Bacteria 1421
89 Ga0157371_10489948 3300013102 Bacteria 907
90 Ga0157370_10014827 3300013104 Bacteria 7955
91 Ga0157369_10002355 3300013105 Bacteria 22728
92 Ga0157369_10022199 3300013105 Bacteria 7089
93 Ga0157369_10037998 3300013105 Bacteria 5266
94 Ga0157369_10724045 3300013105 Unclassified 1024
95 Ga0157369_11846207 3300013105 Bacteria 614
96 Ga0157374_10936459 3300013296 Bacteria 884
97 Ga0157374_12609548 3300013296 Bacteria 533
98 Ga0163162_12399536 3300013306 Bacteria 606
99 Ga0157372_10042820 3300013307 Bacteria 5010
100 Ga0157372_10175353 3300013307 Unclassified 2481
101 Ga0157372_10528423 3300013307 Bacteria 1375
102 Ga0157372_11400710 3300013307 Bacteria 806
103 Ga0163163_10028968 3300014325 Bacteria 5323
104 Ga0157380_11616616 3300014326 Unclassified 704
105 Ga0157377_10167123 3300014745 Bacteria 1373
106 Ga0163161_10114579 3300017792 Bacteria 2019
107 Ga0206355_1110139 3300020076 Bacteria 1225
108 Ga0206351_10390314 3300020077 Unclassified 1101
109 Ga0206350_11393626 3300020080 Unclassified 925
110 Ga0206354_11115091 3300020081 Unclassified 746
111 Ga0206353_11127493 3300020082 Bacteria 952
112 Ga0154015_1082207 3300020610 Unclassified 1076
113 Ga0213874_10160976 3300021377 Bacteria 789
114 Ga0213876_10015764 3300021384 Bacteria 4000
115 Ga0213876_10044201 3300021384 Bacteria 2354
116 Ga0213876_10134291 3300021384 Bacteria 1316
117 Ga0213875_10005613 3300021388 Bacteria 6703
118 Ga0213875_10151420 3300021388 Bacteria 1087
119 Ga0213875_10169626 3300021388 Unclassified 1024
120 Ga0224712_10042200 3300022467 Bacteria 1727
121 Ga0207682_10004181 3300025893 Bacteria 6099
122 Ga0207699_11167520 3300025906 Bacteria 570
123 Ga0207645_10026966 3300025907 Bacteria 3712
124 Ga0207705_10010902 3300025909 Bacteria 6600
125 Ga0207705_10711275 3300025909 Bacteria 781
126 Ga0207707_10000698 3300025912 Bacteria 33306
127 Ga0207695_10001613 3300025913 Bacteria 36581
128 Ga0207695_10012910 3300025913 Bacteria 9997
129 Ga0207695_10061211 3300025913 Bacteria 3892
130 Ga0207671_10013535 3300025914 Bacteria 6496
131 Ga0207660_10108207 3300025917 Bacteria 2087
132 Ga0207660_10499007 3300025917 Bacteria 987
133 Ga0207657_10003237 3300025919 Bacteria 17428
134 Ga0207657_10046526 3300025919 Unclassified 3799
135 Ga0207649_10165969 3300025920 Bacteria 1534
136 Ga0207652_10004401 3300025921 Bacteria 11477
137 Ga0207652_11784205 3300025921 Bacteria 520
138 Ga0207681_10031798 3300025923 Bacteria 3449
139 Ga0207694_10002147 3300025924 Bacteria 16201
140 Ga0207694_10064683 3300025924 Bacteria 2851
141 Ga0207659_10022140 3300025926 Bacteria 4229
142 Ga0207700_10089180 3300025928 Bacteria 2430
143 Ga0207700_10122209 3300025928 Bacteria 2113
144 Ga0207664_10360522 3300025929 Bacteria 1288
145 Ga0207644_10435318 3300025931 Bacteria 1076
146 Ga0207644_11865494 3300025931 Bacteria 503
147 Ga0207686_10014165 3300025934 Bacteria 4432
148 Ga0207686_10210619 3300025934 Bacteria 1397
149 Ga0207709_10134963 3300025935 Bacteria 1688
150 Ga0207670_10075710 3300025936 Bacteria 2340
151 Ga0207670_10143592 3300025936 Bacteria 1762
152 Ga0207669_10722485 3300025937 Bacteria 820
153 Ga0207704_10007256 3300025938 Bacteria 5222
154 Ga0207691_10031093 3300025940 Bacteria 4986
155 Ga0207689_10005346 3300025942 Bacteria 11500
156 Ga0207661_10000376 3300025944 Bacteria 28667
157 Ga0207679_11422417 3300025945 Bacteria 636
158 Ga0207667_10000253 3300025949 Bacteria 75314
159 Ga0207667_10062980 3300025949 Bacteria 3876
160 Ga0207651_10057093 3300025960 Bacteria 2690
161 Ga0207640_10035521 3300025981 Bacteria 3120
162 Ga0207658_10038827 3300025986 Bacteria 3433
163 Ga0207658_10544746 3300025986 Bacteria 1038
164 Ga0207677_10413373 3300026023 Bacteria 1147
165 Ga0207703_10011461 3300026035 Bacteria 6895
166 Ga0207703_10086449 3300026035 Bacteria 2627
167 Ga0207639_10162073 3300026041 Bacteria 1885
168 Ga0207708_10029918 3300026075 Bacteria 4129
169 Ga0207702_10028827 3300026078 Bacteria 4617
170 Ga0207702_11841718 3300026078 Bacteria 597
171 Ga0207641_10038686 3300026088 Bacteria 3988
172 Ga0207648_10001137 3300026089 Bacteria 29904
173 Ga0207674_10000097 3300026116 Bacteria 98549
174 Ga0207675_100017057 3300026118 Bacteria 6785
175 Ga0207683_10248467 3300026121 Bacteria 1623
176 Ga0207698_10040912 3300026142 Bacteria 3449
177 Ga0207698_10389956 3300026142 Bacteria 1328
178 Ga0268266_10105299 3300028379 Bacteria 2492
179 Ga0268265_10804036 3300028380 Bacteria 917
180 Ga0268265_11810140 3300028380 Bacteria 617
181 Ga0268264_10057854 3300028381 Bacteria 3244
182 Ga0268264_10136743 3300028381 Bacteria 2180
183 Ga0268264_11071414 3300028381 Bacteria 814
184 Ga0307414_11804585 3300032004 Bacteria 571
185 Ga0373955_0372606 3300035172 Unclassified 866
186 Ga0395899_0938650 3300037312 Bacteria 525
187 Ga0395900_0708591 3300037418 Bacteria 940
188 Ga0395900_1032173 3300037418 Bacteria 741
189 Ga0436364_0013516 3300037853 Bacteria 1374
190 Ga0436364_0062641 3300037853 Bacteria 4691
191 Ga0436364_0142057 3300037853 Bacteria 3777
192 Ga0436364_0204841 3300037853 Unclassified 594
193 Ga0436364_0337644 3300037853 Unclassified 1030
194 Ga0436364_0428015 3300037853 Bacteria 1483
195 Ga0436364_1099042 3300037853 Bacteria 1140
196 Ga0436364_1343295 3300037853 Bacteria 10293
197 Ga0436364_1454828 3300037853 Unclassified 3755
198 Ga0395901_0149080 3300038443 Bacteria 2458
199 Ga0395901_1881769 3300038443 Bacteria 546
200 Ga0436365_0051105 3300039437 Bacteria 1940
201 Ga0436365_0461944 3300039437 Unclassified 519
202 Ga0436365_0567334 3300039437 Bacteria 668
203 Ga0436365_0726286 3300039437 Unclassified 3143
204 Ga0436365_1320300 3300039437 Unclassified 554
205 Ga0436365_1780951 3300039437 Unclassified 801
206 Ga0436365_1794116 3300039437 Bacteria 5908
207 Ga0436360_0018833 3300039438 Bacteria 916
208 Ga0436360_0587790 3300039438 Bacteria 10791
209 Ga0436363_0634885 3300039450 Bacteria 2045
210 Ga0436363_0876153 3300039450 Unclassified 934
211 Ga0436363_1071062 3300039450 Bacteria 840
212 Ga0436363_1660764 3300039450 Unclassified 598
213 Ga0436362_0396570 3300039453 Bacteria 1511
214 Ga0436362_1108818 3300039453 Bacteria 3155
215 Ga0451853_3788330 3300041512 Bacteria 574
216 Ga0466966_0387360 3300044684 Unclassified 840
217 Ga0466963_0149434 3300044694 Bacteria 1622
218 Ga0466960_1029624 3300044901 Bacteria 507
219 Ga0466967_0869192 3300045976 Unclassified 896
220 Ga0495594_0050859 3300046499 Bacteria 2280
221 Ga0495630_0169272 3300046517 Bacteria 1664
222 Ga0495630_1095565 3300046517 Unclassified 604
223 Ga0495652_0020257 3300046529 Bacteria 5913
224 Ga0495587_0149247 3300046536 Unclassified 1332
225 Ga0495667_0324454 3300046559 Unclassified 974
226 Ga0495599_0010634 3300046678 Bacteria 5632
227 Ga0495636_0077069 3300047318 Unclassified 1430
228 Ga0495680_0100788 3300047322 Bacteria 2151
229 Ga0495684_0093150 3300047471 Bacteria 2282
230 Ga0496102_1332176 3300048905 Unclassified 637
231 Ga0496104_0815032 3300048907 Bacteria 839
232 Ga0496112_1683305 3300048915 Unclassified 547
233 Ga0496112_1785378 3300048915 Unclassified 527
234 Ga0496114_0379246 3300048917 Bacteria 1252
235 Ga0501034_0413290 3300049571 Bacteria 1271
236 nmdc:mga00v17_177881_c1 3300050491 Bacteria 1372
237 nmdc:mga0yw44_467931_c1 3300050492 Archaea 855
238 Ga0070658_11509052
239 Ga0070658_10904592
240 Ga0070676_10099707
241 Ga0070676_10366273
242 Ga0070683_101150807
243 Ga0070683_101527654
244 Ga0070690_100016588
245 Ga0070677_10260752
246 Ga0068869_100002479
247 Ga0070680_100027031
248 Ga0070680_101286692
249 Ga0070682_101885154
250 Ga0068868_101235844
251 Ga0070660_100026355
252 Ga0070660_100038571
253 Ga0070689_100120269
254 Ga0070689_100154668
255 Ga0070691_10030942
256 Ga0070669_100264902
257 Ga0070675_100001621
258 Ga0070671_100362783
259 Ga0070673_100020088
260 Ga0070688_100136490
261 Ga0070667_100029195
262 Ga0070667_100640427
263 Ga0070667_100939030
264 Ga0070667_101856969
265 Ga0070713_100013675
266 Ga0070713_100043922
267 Ga0070701_10009264
268 Ga0070700_100082832
269 Ga0070678_100329185
270 Ga0070681_10196958
271 Ga0070681_10787156
272 Ga0068867_100005747
273 Ga0070679_100018221
274 Ga0070684_100006622
275 Ga0068853_100091014
276 Ga0068853_101932794
277 Ga0070672_100022640
278 Ga0070686_100546403
279 Ga0070665_100367722
280 Ga0070665_100783265
281 Ga0068855_100102606
282 Ga0068857_100007886
283 Ga0068854_100143045
284 Ga0068854_100186865
285 Ga0068854_100462005
286 Ga0068856_100001598
287 Ga0068856_100018153
288 Ga0068852_100055546
289 Ga0068852_100334061
290 Ga0068859_100045205
291 Ga0068859_101213977
292 Ga0068861_100014453
293 Ga0068863_100047358
294 Ga0068858_100062032
295 Ga0068860_100068385
296 Ga0068860_100285698
297 Ga0068860_101426734
298 Ga0068862_101796277
299 Ga0068862_102060881
300 Ga0081455_10022431
301 Ga0068871_100157289
302 Ga0075430_100004174
303 Ga0068865_100006623
304 Ga0097620_100045206
305 Ga0097620_101213980
306 Ga0105240_10006444
307 Ga0105240_10051948
308 Ga0105240_10343082
309 Ga0105240_10438203
310 Ga0105245_10219011
311 Ga0105243_10020195
312 Ga0105241_10003203
313 Ga0105241_10138775
314 Ga0105242_10024408
315 Ga0105248_11550029
316 Ga0105248_11653272
317 Ga0105248_11663020
318 Ga0105237_10002468
319 Ga0105237_10003436
320 Ga0105237_10549339
321 Ga0105238_10051490
322 Ga0105238_12050965
323 Ga0105239_10005790
324 Ga0105239_13464594
325 Ga0105246_10244201
326 Ga0157371_10489948
327 Ga0157370_10014827
328 Ga0157369_10002355
329 Ga0157369_10022199
330 Ga0157369_10037998
331 Ga0157369_10724045
332 Ga0157369_11846207
333 Ga0157374_10936459
334 Ga0157374_12609548
335 Ga0163162_12399536
336 Ga0157372_10042820
337 Ga0157372_10175353
338 Ga0157372_10528423
339 Ga0157372_11400710
340 Ga0163163_10028968
341 Ga0157380_11616616
342 Ga0157377_10167123
343 Ga0163161_10114579
344 Ga0206355_1110139
345 Ga0206351_10390314
346 Ga0206350_11393626
347 Ga0206354_11115091
348 Ga0206353_11127493
349 Ga0154015_1082207
350 Ga0213874_10160976
351 Ga0213876_10015764
352 Ga0213876_10044201
353 Ga0213876_10134291
354 Ga0213875_10005613
355 Ga0213875_10151420
356 Ga0213875_10169626
357 Ga0224712_10042200
358 Ga0207682_10004181
359 Ga0207699_11167520
360 Ga0207645_10026966
361 Ga0207705_10010902
362 Ga0207705_10711275
363 Ga0207707_10000698
364 Ga0207695_10001613
365 Ga0207695_10012910
366 Ga0207695_10061211
367 Ga0207671_10013535
368 Ga0207660_10108207
369 Ga0207660_10499007
370 Ga0207657_10003237
371 Ga0207657_10046526
372 Ga0207649_10165969
373 Ga0207652_10004401
374 Ga0207652_11784205
375 Ga0207681_10031798
376 Ga0207694_10002147
377 Ga0207694_10064683
378 Ga0207659_10022140
379 Ga0207700_10089180
380 Ga0207700_10122209
381 Ga0207664_10360522
382 Ga0207644_10435318
383 Ga0207644_11865494
384 Ga0207686_10014165
385 Ga0207686_10210619
386 Ga0207709_10134963
387 Ga0207670_10075710
388 Ga0207670_10143592
389 Ga0207669_10722485
390 Ga0207704_10007256
391 Ga0207691_10031093
392 Ga0207689_10005346
393 Ga0207661_10000376
394 Ga0207679_11422417
395 Ga0207667_10000253
396 Ga0207667_10062980
397 Ga0207651_10057093
398 Ga0207640_10035521
399 Ga0207658_10038827
400 Ga0207658_10544746
401 Ga0207677_10413373
402 Ga0207703_10011461
403 Ga0207703_10086449
404 Ga0207639_10162073
405 Ga0207708_10029918
406 Ga0207702_10028827
407 Ga0207702_11841718
408 Ga0207641_10038686
409 Ga0207648_10001137
410 Ga0207674_10000097
411 Ga0207675_100017057
412 Ga0207683_10248467
413 Ga0207698_10040912
414 Ga0207698_10389956
415 Ga0268266_10105299
416 Ga0268265_10804036
417 Ga0268265_11810140
418 Ga0268264_10057854
419 Ga0268264_10136743
420 Ga0268264_11071414
421 Ga0307414_11804585
422 Ga0373955_0372606
423 Ga0395899_0938650
424 Ga0395900_0708591
425 Ga0395900_1032173
426 Ga0436364_0013516
427 Ga0436364_0062641
428 Ga0436364_0142057
429 Ga0436364_0204841
430 Ga0436364_0337644
431 Ga0436364_0428015
432 Ga0436364_1099042
433 Ga0436364_1343295
434 Ga0436364_1454828
435 Ga0395901_0149080
436 Ga0395901_1881769
437 Ga0436365_0051105
438 Ga0436365_0461944
439 Ga0436365_0567334
440 Ga0436365_0726286
441 Ga0436365_1320300
442 Ga0436365_1780951
443 Ga0436365_1794116
444 Ga0436360_0018833
445 Ga0436360_0587790
446 Ga0436363_0634885
447 Ga0436363_0876153
448 Ga0436363_1071062
449 Ga0436363_1660764
450 Ga0436362_0396570
451 Ga0436362_1108818
452 Ga0451853_3788330
453 Ga0466966_0387360
454 Ga0466963_0149434
455 Ga0466960_1029624
456 Ga0466967_0869192
457 Ga0495594_0050859
458 Ga0495630_0169272
459 Ga0495630_1095565
460 Ga0495652_0020257
461 Ga0495587_0149247
462 Ga0495667_0324454
463 Ga0495599_0010634
464 Ga0495636_0077069
465 Ga0495680_0100788
466 Ga0495684_0093150
467 Ga0496102_1332176
468 Ga0496104_0815032
469 Ga0496112_1683305
470 Ga0496112_1785378
471 Ga0496114_0379246
472 Ga0501034_0413290
473 nmdc:mga00v17_177881_c1
474 nmdc:mga0yw44_467931_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01152

Bac_globin

Bacterial-like globin

7

123

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qrw-assembly1.cif.gz_H crystal structure of mycobacterium tuberculosis trhbo wg8f mutant 0.9453 6 122
2qrw-assembly7.cif.gz_J crystal structure of mycobacterium tuberculosis trhbo wg8f mutant 0.9451 5 122
2bmm-assembly1.cif.gz_A x-ray structure of a novel thermostable hemoglobin from the actinobacterium thermobifida fusca 0.9327 6 122
1ux8-assembly1.cif.gz_A x-ray structure of truncated oxygen-avid haemoglobin from bacillus subtilis 0.9324 6 122
5d1v-assembly1.cif.gz_B crystal structure and thermal stability of hemoglobin from thermophilic phototrophic bacterium chloroflexus aurantiacus 0.9323 6 123
ID Description Score Start End Superfamily
af_Q2G202_1_105_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9403 19 123 1.10.490.10
2bmmA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9327 6 122 1.10.490.10
5d1vB00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9323 6 123 1.10.490.10
af_Q69XE4_1_153_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9305 5 121 1.10.490.10
1ux8A00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9248 6 123 1.10.490.10
ID Description Score Start End GO Terms
AF-A0A5C9CHQ5-F1-model_v4 Hemoglobin 0.9629 4 123 GO:0005344
GO:0019825
GO:0020037
AF-A0A3L7PR80-F1-model_v4 Globin 0.9607 6 124 GO:0005344
GO:0019825
GO:0020037
AF-A0A6J6ILS9-F1-model_v4 Unannotated protein 0.9603 6 123 GO:0005344
GO:0019825
GO:0020037
AF-A0A6L6AVE5-F1-model_v4 Globin 0.9595 6 123 GO:0005344
GO:0019825
GO:0020037
AF-A0A7J5BH39-F1-model_v4 Globin 0.9589 6 123 GO:0005344
GO:0019825
GO:0020037

Map