F349416

General Info

Members Datasets Scaffolds Average Seq Length
236 152 220 212

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0802614|Ga0496108_0802614_59_787
Length 242
Sequence MKDERPARSTSRPGGGPDWDTGSVAPGTRTVVHLLRHGEVHNPEKILYGRLPGYRLSEAGRAMADGIADHLAGSDITYLAASSLTRAQETAAPSARSLNLPVTTDDRLIEAANAFEGMRVAVGDGALRRPQHWPKLRNPLLPSWGERYLDVAHRMLGAVYAAVGKAQGHQALLVSHQLPIWTVRRYFEGRRLWHNPTRRQCGLASLTSLRFEDGVFVGLSYAEPVAHLARPAGGREGPQVGA

Samples

Sample ID Description Type Environment
1 2527291627 Frankia casuarinae Thr Isolate Nodule
2 2527291629 Frankia sp. BMG5.23 Isolate Nodule
3 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
4 2576861822 Frankia sp. CeD Isolate Nodule
5 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
6 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
7 2684623036 Frankia sp. CgIM4 Isolate Nodule
8 2710264753 Frankia sp. KB5 Isolate Nodule
9 2773857924 Frankia sp. CgIS1 Isolate Nodule
10 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
11 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
12 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
13 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
14 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
15 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
110 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
122 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
151 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
152 637000116 Frankia casuarinae CcI3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.8
Metatranscriptomes 0.42
Isolates 6.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 2.97
Rhizoplane 8.47
Rhizosphere 82.63
Stem 0
Stem Tuber 0
Unclassified 5.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100431050 3300005334 Bacteria 1089
2 Ga0070668_100403964 3300005347 Bacteria 1167
3 Ga0070675_100456505 3300005354 Bacteria 1146
4 Ga0070671_100105858 3300005355 Bacteria 2361
5 Ga0070673_100530437 3300005364 Bacteria 1068
6 Ga0070659_101175051 3300005366 Bacteria 678
7 Ga0070714_100272258 3300005435 Bacteria 1571
8 Ga0070714_100828780 3300005435 Bacteria 896
9 Ga0070711_100232565 3300005439 Bacteria 1438
10 Ga0070711_100357121 3300005439 Bacteria 1176
11 Ga0070663_100009904 3300005455 Bacteria 5921
12 Ga0070663_100217862 3300005455 Bacteria 1497
13 Ga0070681_10519500 3300005458 Bacteria 1104
14 Ga0068867_100077161 3300005459 Bacteria 2503
15 Ga0070679_100236439 3300005530 Bacteria 1786
16 Ga0068853_100150688 3300005539 Bacteria 2093
17 Ga0070672_100414793 3300005543 Bacteria 1156
18 Ga0070665_100253528 3300005548 Bacteria 1760
19 Ga0070665_100967394 3300005548 Bacteria 864
20 Ga0070664_100317674 3300005564 Bacteria 1410
21 Ga0070664_100668256 3300005564 Bacteria 966
22 Ga0068856_100566243 3300005614 Bacteria 1157
23 Ga0070702_100062614 3300005615 Bacteria 2170
24 Ga0068852_100499339 3300005616 Bacteria 1211
25 Ga0068864_100039541 3300005618 Bacteria 4031
26 Ga0068864_100041740 3300005618 Bacteria 3924
27 Ga0068858_100058004 3300005842 Bacteria 3579
28 Ga0081539_10000282 3300005985 Bacteria 114682
29 Ga0070717_10360761 3300006028 Bacteria 1301
30 Ga0070716_100020336 3300006173 Bacteria 3484
31 Ga0070712_100236034 3300006175 Bacteria 1455
32 Ga0068871_100284724 3300006358 Bacteria 1447
33 Ga0111539_10066739 3300009094 Bacteria 4250
34 Ga0105245_10504273 3300009098 Bacteria 1227
35 Ga0105242_10401048 3300009176 Bacteria 1280
36 Ga0105248_10097148 3300009177 Bacteria 3319
37 Ga0105248_10102163 3300009177 Bacteria 3231
38 Ga0105248_10197787 3300009177 Bacteria 2265
39 Ga0105238_10052326 3300009551 Bacteria 4104
40 Ga0105238_10300847 3300009551 Bacteria 1588
41 Ga0105238_11067464 3300009551 Bacteria 830
42 Ga0105249_10053218 3300009553 Bacteria 3700
43 Ga0105246_10394281 3300011119 Bacteria 1148
44 Ga0157369_10316503 3300013105 Bacteria 1622
45 Ga0157372_10071993 3300013307 Bacteria 3895
46 Ga0163163_10095026 3300014325 Bacteria 3000
47 Ga0163163_10814318 3300014325 Bacteria 997
48 Ga0157379_10051936 3300014968 Bacteria 3660
49 Ga0206353_11210822 3300020082 Bacteria 904
50 Ga0213876_10106865 3300021384 Bacteria 1485
51 Ga0207642_10100876 3300025899 Bacteria 1449
52 Ga0207688_10177137 3300025901 Bacteria 1270
53 Ga0207645_10005165 3300025907 Bacteria 9541
54 Ga0207643_10157886 3300025908 Bacteria 1363
55 Ga0207643_10168418 3300025908 Bacteria 1321
56 Ga0207707_10454920 3300025912 Bacteria 1095
57 Ga0207660_10250402 3300025917 Bacteria 1398
58 Ga0207660_10330853 3300025917 Bacteria 1218
59 Ga0207662_10166133 3300025918 Bacteria 1413
60 Ga0207657_10259261 3300025919 Bacteria 1384
61 Ga0207649_10182057 3300025920 Bacteria 1471
62 Ga0207650_10150934 3300025925 Bacteria 1834
63 Ga0207650_11013675 3300025925 Bacteria 706
64 Ga0207659_10027907 3300025926 Bacteria 3829
65 Ga0207659_10794819 3300025926 Bacteria 813
66 Ga0207687_10043254 3300025927 Bacteria 3103
67 Ga0207664_10042728 3300025929 Bacteria 3540
68 Ga0207664_10111437 3300025929 Bacteria 2277
69 Ga0207690_10196101 3300025932 Bacteria 1530
70 Ga0207706_10014937 3300025933 Bacteria 7032
71 Ga0207670_10373989 3300025936 Bacteria 1133
72 Ga0207704_10063734 3300025938 Bacteria 2299
73 Ga0207665_10374287 3300025939 Bacteria 1080
74 Ga0207691_10148317 3300025940 Bacteria 2063
75 Ga0207711_10055910 3300025941 Bacteria 3389
76 Ga0207711_10308220 3300025941 Bacteria 1461
77 Ga0207689_10023158 3300025942 Bacteria 5215
78 Ga0207661_10107238 3300025944 Bacteria 2356
79 Ga0207661_10895172 3300025944 Bacteria 817
80 Ga0207679_10002163 3300025945 Bacteria 12156
81 Ga0207679_10261407 3300025945 Bacteria 1476
82 Ga0207712_10068965 3300025961 Bacteria 2536
83 Ga0207668_10304829 3300025972 Bacteria 1316
84 Ga0207703_10076549 3300026035 Bacteria 2776
85 Ga0207703_10248674 3300026035 Bacteria 1601
86 Ga0207639_10154026 3300026041 Bacteria 1928
87 Ga0207678_10004102 3300026067 Bacteria 13100
88 Ga0207678_10220895 3300026067 Bacteria 1622
89 Ga0207678_10311481 3300026067 Bacteria 1353
90 Ga0207676_10010258 3300026095 Bacteria 6667
91 Ga0207676_10082022 3300026095 Bacteria 2621
92 Ga0207674_10017440 3300026116 Bacteria 7836
93 Ga0207683_10090615 3300026121 Bacteria 2723
94 Ga0207428_10077806 3300027907 Bacteria 2597
95 Ga0268266_10716890 3300028379 Bacteria 964
96 Ga0268265_10315506 3300028380 Bacteria 1413
97 Ga0268264_10163403 3300028381 Bacteria 2008
98 Ga0307515_10061677 3300028794 Bacteria 5312
99 Ga0307511_10255731 3300030521 Bacteria 836
100 Ga0307408_100067199 3300031548 Bacteria 2635
101 Ga0307408_100186574 3300031548 Bacteria 1668
102 Ga0307405_10027103 3300031731 Bacteria 3317
103 Ga0307405_10057749 3300031731 Bacteria 2439
104 Ga0307405_10139350 3300031731 Bacteria 1688
105 Ga0307405_10339720 3300031731 Bacteria 1154
106 Ga0307405_10736839 3300031731 Bacteria 820
107 Ga0307518_10000304 3300031838 Bacteria 37119
108 Ga0307410_10113793 3300031852 Bacteria 1962
109 Ga0307410_10163399 3300031852 Bacteria 1671
110 Ga0307410_10174807 3300031852 Bacteria 1621
111 Ga0307410_10416763 3300031852 Bacteria 1088
112 Ga0307406_10067710 3300031901 Bacteria 2329
113 Ga0307406_10085625 3300031901 Bacteria 2108
114 Ga0307406_10210292 3300031901 Bacteria 1438
115 Ga0307406_10232733 3300031901 Bacteria 1377
116 Ga0307406_10389817 3300031901 Bacteria 1101
117 Ga0307406_10493302 3300031901 Bacteria 991
118 Ga0307406_10498186 3300031901 Bacteria 987
119 Ga0307407_10073874 3300031903 Bacteria 2039
120 Ga0307407_10108113 3300031903 Bacteria 1741
121 Ga0307407_10140256 3300031903 Bacteria 1559
122 Ga0307407_10551825 3300031903 Bacteria 852
123 Ga0307412_10044370 3300031911 Bacteria 2900
124 Ga0307412_10353829 3300031911 Bacteria 1180
125 Ga0307409_100017243 3300031995 Bacteria 4806
126 Ga0307409_100037474 3300031995 Bacteria 3575
127 Ga0307409_100048401 3300031995 Bacteria 3235
128 Ga0307409_100108984 3300031995 Bacteria 2317
129 Ga0307409_100277994 3300031995 Bacteria 1546
130 Ga0307409_100406257 3300031995 Bacteria 1302
131 Ga0307409_100548485 3300031995 Bacteria 1134
132 Ga0307409_100751283 3300031995 Bacteria 979
133 Ga0307409_100789524 3300031995 Bacteria 956
134 Ga0307409_100889579 3300031995 Bacteria 903
135 Ga0307416_100042052 3300032002 Bacteria 3564
136 Ga0307416_100101334 3300032002 Bacteria 2507
137 Ga0307416_100179757 3300032002 Bacteria 1981
138 Ga0307416_100195266 3300032002 Bacteria 1914
139 Ga0307416_100218145 3300032002 Bacteria 1827
140 Ga0307416_100397473 3300032002 Bacteria 1415
141 Ga0307414_10023900 3300032004 Bacteria 3885
142 Ga0307414_10217237 3300032004 Bacteria 1567
143 Ga0307414_10386334 3300032004 Bacteria 1212
144 Ga0307414_10608127 3300032004 Bacteria 981
145 Ga0307414_10999230 3300032004 Bacteria 770
146 Ga0307411_10002867 3300032005 Bacteria 7793
147 Ga0307411_10373891 3300032005 Bacteria 1170
148 Ga0307411_10395967 3300032005 Bacteria 1140
149 Ga0307415_100006733 3300032126 Bacteria 6228
150 Ga0307415_100011239 3300032126 Bacteria 5114
151 Ga0307415_100011740 3300032126 Bacteria 5029
152 Ga0307415_100026840 3300032126 Bacteria 3640
153 Ga0307415_100315100 3300032126 Bacteria 1302
154 Ga0307415_100623033 3300032126 Bacteria 963
155 Ga0307415_100647527 3300032126 Bacteria 947
156 Ga0307415_100657560 3300032126 Bacteria 940
157 Ga0307415_100918343 3300032126 Bacteria 808
158 Ga0307415_100921229 3300032126 Bacteria 807
159 Ga0373958_0037433 3300034819 Bacteria 979
160 Ga0373927_0645765 3300035695 Bacteria 699
161 Ga0395901_0019021 3300038443 Bacteria 7022
162 Ga0436365_1342528 3300039437 Bacteria 1466
163 Ga0436362_1143699 3300039453 Bacteria 929
164 Ga0466972_0003690 3300044658 Bacteria 7619
165 Ga0466965_0016132 3300044683 Bacteria 3550
166 Ga0466961_0109338 3300044693 Bacteria 1740
167 Ga0466961_0215388 3300044693 Bacteria 1185
168 Ga0466968_0190315 3300044735 Bacteria 957
169 Ga0466960_0162762 3300044901 Bacteria 1199
170 Ga0466959_0080023 3300045049 Bacteria 2356
171 Ga0466967_0010018 3300045976 Bacteria 7079
172 Ga0466967_0442292 3300045976 Bacteria 1270
173 Ga0466967_1129018 3300045976 Bacteria 781
174 Ga0495629_0226349 3300046459 Bacteria 1289
175 Ga0495594_0003819 3300046499 Bacteria 7734
176 Ga0495594_0161402 3300046499 Bacteria 1274
177 Ga0495648_0042022 3300046524 Bacteria 2880
178 Ga0495668_0338399 3300046616 Bacteria 826
179 Ga0495674_0602255 3300047319 Bacteria 870
180 Ga0495593_0291003 3300047673 Bacteria 817
181 Ga0495614_0223883 3300048089 Bacteria 856
182 Ga0496100_0543088 3300048903 Bacteria 899
183 Ga0496101_0156843 3300048904 Bacteria 1744
184 Ga0496104_0062285 3300048907 Bacteria 3537
185 Ga0496104_0254025 3300048907 Bacteria 1671
186 Ga0496105_0054376 3300048908 Bacteria 3305
187 Ga0496105_0345556 3300048908 Bacteria 1189
188 Ga0496106_0385059 3300048909 Bacteria 1127
189 Ga0496108_0036480 3300048911 Bacteria 4090
190 Ga0496108_0802614 3300048911 Bacteria 812
191 Ga0496109_0001469 3300048912 Bacteria 19561
192 Ga0496110_0002677 3300048913 Bacteria 13447
193 Ga0496111_0012498 3300048914 Bacteria 5751
194 Ga0496111_0628133 3300048914 Bacteria 785
195 Ga0496113_0005146 3300048916 Bacteria 8130
196 Ga0496113_0403815 3300048916 Bacteria 1097
197 Ga0496113_0921076 3300048916 Bacteria 691
198 Ga0496114_0002602 3300048917 Bacteria 13775
199 Ga0496114_0102781 3300048917 Bacteria 2442
200 Ga0496114_0404109 3300048917 Bacteria 1209
201 Ga0496126_0001593 3300048929 Bacteria 34557
202 Ga0501033_0005915 3300049570 Bacteria 9609
203 Ga0501034_0024714 3300049571 Bacteria 6111
204 Ga0501036_0321417 3300049572 Bacteria 1293
205 Ga0501037_0122403 3300049573 Bacteria 1869
206 Ga0501041_0175774 3300049577 Bacteria 1340
207 Ga0501043_0085988 3300049579 Bacteria 2471
208 Ga0501046_0008714 3300049580 Bacteria 8811
209 Ga0501047_0188116 3300049581 Bacteria 1929
210 Ga0501048_0069493 3300049582 Bacteria 2488
211 Ga0501048_0767942 3300049582 Bacteria 692
212 Ga0501070_0250228 3300049586 Bacteria 1450
213 Ga0501071_0775865 3300049587 Bacteria 739
214 Ga0501075_0163584 3300049591 Bacteria 1698
215 Ga0501044_0079597 3300049823 Bacteria 3320
216 nmdc:mga0qj67_329916_c1 3300050509 Bacteria 1235
217 nmdc:mga0qj67_387387_c1 3300050509 Bacteria 1128
218 nmdc:mga08y16_116013_c1 3300050511 Bacteria 2788
219 Ga0500646_0000053 3300053090 Bacteria 31668
220 Ga0500583_0098904 3300053092 Bacteria 1427

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0024714 Ga0501034_0024714_5567_6094 166
2 3300049579 Ga0501043_0085988 Ga0501043_0085988_1896_2423 166
3 3300049582 Ga0501048_0767942 Ga0501048_0767942_40_567 166
4 3300034819 Ga0373958_0037433 Ga0373958_0037433_274_927 174
5 3300031901 Ga0307406_10493302 Ga0307406_104933022 195
6 3300031995 Ga0307409_100548485 Ga0307409_1005484852 195
7 3300032004 Ga0307414_10999230 Ga0307414_109992301 195
8 3300032005 Ga0307411_10373891 Ga0307411_103738912 195
9 iso_pu_bacteria 2939660829 2939664303 198
10 3300031911 Ga0307412_10353829 Ga0307412_103538292 201
11 3300046524 Ga0495648_0042022 Ga0495648_0042022_1786_2406 201
12 3300049570 Ga0501033_0005915 Ga0501033_0005915_8729_9364 201
13 3300049573 Ga0501037_0122403 Ga0501037_0122403_812_1447 201
14 3300049580 Ga0501046_0008714 Ga0501046_0008714_4789_5424 201
15 3300049581 Ga0501047_0188116 Ga0501047_0188116_120_755 201
16 3300049586 Ga0501070_0250228 Ga0501070_0250228_505_1140 201
17 3300049823 Ga0501044_0079597 Ga0501044_0079597_791_1426 201
18 3300044658 Ga0466972_0003690 Ga0466972_0003690_5548_6156 202
19 3300044693 Ga0466961_0109338 Ga0466961_0109338_1035_1655 202
20 3300048929 Ga0496126_0001593 Ga0496126_0001593_3050_3814 202
21 iso_pu_bacteria 2848551377 2848553314 202
22 iso_pu_bacteria 2835188231 2835191048 203
23 3300031901 Ga0307406_10498186 Ga0307406_104981862 204
24 3300005616 Ga0068852_100499339 Ga0068852_1004993391 205
25 3300021384 Ga0213876_10106865 Ga0213876_101068652 205
26 3300039437 Ga0436365_1342528 Ga0436365_1342528_466_1092 205
27 iso_pu_bacteria 2891326441 2891331625 205
28 3300039453 Ga0436362_1143699 Ga0436362_1143699_87_722 206
29 3300048916 Ga0496113_0403815 Ga0496113_0403815_95_793 206
30 iso_pu_bacteria 2527291627 2528206693 206
31 iso_pu_bacteria 2527291629 2528211997 206
32 iso_pu_bacteria 2546825537 2546946980 206
33 iso_pu_bacteria 2576861822 2579747511 206
34 iso_pu_bacteria 2585427649 2586064716 206
35 iso_pu_bacteria 2622736605 2623497734 206
36 iso_pu_bacteria 2684623036 2686543505 206
37 iso_pu_bacteria 2710264753 2710604250 206
38 iso_pu_bacteria 2773857924 2774867102 206
39 iso_pu_bacteria 2808606522 2809586053 206
40 iso_pu_bacteria 2915768154 2915773535 206
41 iso_pu_bacteria 637000116 637877837 206
42 3300044683 Ga0466965_0016132 Ga0466965_0016132_924_1571 207
43 3300048916 Ga0496113_0921076 Ga0496113_0921076_29_655 207
44 3300005435 Ga0070714_100828780 Ga0070714_1008287802 208
45 3300009551 Ga0105238_10300847 Ga0105238_103008473 208
46 3300025899 Ga0207642_10100876 Ga0207642_101008762 208
47 3300025901 Ga0207688_10177137 Ga0207688_101771371 208
48 3300025908 Ga0207643_10157886 Ga0207643_101578862 208
49 3300025917 Ga0207660_10330853 Ga0207660_103308532 208
50 3300025920 Ga0207649_10182057 Ga0207649_101820572 208
51 3300025925 Ga0207650_10150934 Ga0207650_101509343 208
52 3300025926 Ga0207659_10027907 Ga0207659_100279074 208
53 3300025927 Ga0207687_10043254 Ga0207687_100432542 208
54 3300025929 Ga0207664_10042728 Ga0207664_100427282 208
55 3300025932 Ga0207690_10196101 Ga0207690_101961012 208
56 3300025933 Ga0207706_10014937 Ga0207706_100149378 208
57 3300025938 Ga0207704_10063734 Ga0207704_100637343 208
58 3300025942 Ga0207689_10023158 Ga0207689_100231585 208
59 3300025944 Ga0207661_10107238 Ga0207661_101072384 208
60 3300025945 Ga0207679_10002163 Ga0207679_1000216311 208
61 3300025961 Ga0207712_10068965 Ga0207712_100689652 208
62 3300026035 Ga0207703_10248674 Ga0207703_102486742 208
63 3300026067 Ga0207678_10004102 Ga0207678_100041027 208
64 3300026116 Ga0207674_10017440 Ga0207674_100174405 208
65 3300026121 Ga0207683_10090615 Ga0207683_100906153 208
66 3300027907 Ga0207428_10077806 Ga0207428_100778062 208
67 3300028380 Ga0268265_10315506 Ga0268265_103155063 208
68 3300028381 Ga0268264_10163403 Ga0268264_101634033 208
69 3300028794 Ga0307515_10061677 Ga0307515_100616772 208
70 3300030521 Ga0307511_10255731 Ga0307511_102557311 208
71 3300031731 Ga0307405_10057749 Ga0307405_100577492 208
72 3300031731 Ga0307405_10339720 Ga0307405_103397202 208
73 3300031901 Ga0307406_10067710 Ga0307406_100677102 208
74 3300031901 Ga0307406_10085625 Ga0307406_100856252 208
75 3300031903 Ga0307407_10551825 Ga0307407_105518252 208
76 3300031995 Ga0307409_100048401 Ga0307409_1000484012 208
77 3300032002 Ga0307416_100195266 Ga0307416_1001952661 208
78 3300032126 Ga0307415_100006733 Ga0307415_1000067335 208
79 3300032126 Ga0307415_100026840 Ga0307415_1000268402 208
80 3300032126 Ga0307415_100647527 Ga0307415_1006475272 208
81 3300032126 Ga0307415_100921229 Ga0307415_1009212292 208
82 3300044735 Ga0466968_0190315 Ga0466968_0190315_25_663 208
83 3300050509 nmdc:mga0qj67_387387_c1 nmdc:mga0qj67_387387_c1_77_721 208
84 3300050511 nmdc:mga08y16_116013_c1 nmdc:mga08y16_116013_c1_49_693 208
85 3300005334 Ga0068869_100431050 Ga0068869_1004310502 209
86 3300005347 Ga0070668_100403964 Ga0070668_1004039641 209
87 3300005354 Ga0070675_100456505 Ga0070675_1004565052 209
88 3300005355 Ga0070671_100105858 Ga0070671_1001058584 209
89 3300005364 Ga0070673_100530437 Ga0070673_1005304372 209
90 3300005366 Ga0070659_101175051 Ga0070659_1011750511 209
91 3300005435 Ga0070714_100272258 Ga0070714_1002722582 209
92 3300005439 Ga0070711_100232565 Ga0070711_1002325652 209
93 3300005439 Ga0070711_100357121 Ga0070711_1003571212 209
94 3300005455 Ga0070663_100009904 Ga0070663_1000099044 209
95 3300005455 Ga0070663_100217862 Ga0070663_1002178622 209
96 3300005458 Ga0070681_10519500 Ga0070681_105195002 209
97 3300005459 Ga0068867_100077161 Ga0068867_1000771612 209
98 3300005530 Ga0070679_100236439 Ga0070679_1002364392 209
99 3300005539 Ga0068853_100150688 Ga0068853_1001506882 209
100 3300005543 Ga0070672_100414793 Ga0070672_1004147932 209
101 3300005548 Ga0070665_100253528 Ga0070665_1002535282 209
102 3300005548 Ga0070665_100967394 Ga0070665_1009673942 209
103 3300005564 Ga0070664_100317674 Ga0070664_1003176742 209
104 3300005564 Ga0070664_100668256 Ga0070664_1006682562 209
105 3300005614 Ga0068856_100566243 Ga0068856_1005662431 209
106 3300005615 Ga0070702_100062614 Ga0070702_1000626141 209
107 3300005618 Ga0068864_100039541 Ga0068864_1000395413 209
108 3300005618 Ga0068864_100041740 Ga0068864_1000417402 209
109 3300005842 Ga0068858_100058004 Ga0068858_1000580043 209
110 3300005985 Ga0081539_10000282 Ga0081539_1000028225 209
111 3300006028 Ga0070717_10360761 Ga0070717_103607612 209
112 3300006173 Ga0070716_100020336 Ga0070716_1000203364 209
113 3300006175 Ga0070712_100236034 Ga0070712_1002360342 209
114 3300006358 Ga0068871_100284724 Ga0068871_1002847242 209
115 3300009094 Ga0111539_10066739 Ga0111539_100667392 209
116 3300009098 Ga0105245_10504273 Ga0105245_105042731 209
117 3300009176 Ga0105242_10401048 Ga0105242_104010482 209
118 3300009177 Ga0105248_10097148 Ga0105248_100971484 209
119 3300009177 Ga0105248_10102163 Ga0105248_101021634 209
120 3300009177 Ga0105248_10197787 Ga0105248_101977873 209
121 3300009551 Ga0105238_10052326 Ga0105238_100523262 209
122 3300009551 Ga0105238_11067464 Ga0105238_110674641 209
123 3300009553 Ga0105249_10053218 Ga0105249_100532184 209
124 3300011119 Ga0105246_10394281 Ga0105246_103942812 209
125 3300013105 Ga0157369_10316503 Ga0157369_103165032 209
126 3300013307 Ga0157372_10071993 Ga0157372_100719934 209
127 3300014325 Ga0163163_10095026 Ga0163163_100950262 209
128 3300014325 Ga0163163_10814318 Ga0163163_108143182 209
129 3300014968 Ga0157379_10051936 Ga0157379_100519362 209
130 3300020082 Ga0206353_11210822 Ga0206353_112108222 209
131 3300025907 Ga0207645_10005165 Ga0207645_100051652 209
132 3300025908 Ga0207643_10168418 Ga0207643_101684182 209
133 3300025912 Ga0207707_10454920 Ga0207707_104549202 209
134 3300025917 Ga0207660_10250402 Ga0207660_102504022 209
135 3300025918 Ga0207662_10166133 Ga0207662_101661332 209
136 3300025919 Ga0207657_10259261 Ga0207657_102592612 209
137 3300025925 Ga0207650_11013675 Ga0207650_110136751 209
138 3300025926 Ga0207659_10794819 Ga0207659_107948192 209
139 3300025929 Ga0207664_10111437 Ga0207664_101114373 209
140 3300025936 Ga0207670_10373989 Ga0207670_103739892 209
141 3300025939 Ga0207665_10374287 Ga0207665_103742872 209
142 3300025940 Ga0207691_10148317 Ga0207691_101483172 209
143 3300025941 Ga0207711_10055910 Ga0207711_100559102 209
144 3300025941 Ga0207711_10308220 Ga0207711_103082202 209
145 3300025944 Ga0207661_10895172 Ga0207661_108951721 209
146 3300025945 Ga0207679_10261407 Ga0207679_102614072 209
147 3300025972 Ga0207668_10304829 Ga0207668_103048292 209
148 3300026035 Ga0207703_10076549 Ga0207703_100765493 209
149 3300026041 Ga0207639_10154026 Ga0207639_101540262 209
150 3300026067 Ga0207678_10220895 Ga0207678_102208953 209
151 3300026067 Ga0207678_10311481 Ga0207678_103114812 209
152 3300026095 Ga0207676_10010258 Ga0207676_100102585 209
153 3300026095 Ga0207676_10082022 Ga0207676_100820222 209
154 3300028379 Ga0268266_10716890 Ga0268266_107168902 209
155 3300031548 Ga0307408_100067199 Ga0307408_1000671993 209
156 3300031548 Ga0307408_100186574 Ga0307408_1001865742 209
157 3300031731 Ga0307405_10027103 Ga0307405_100271033 209
158 3300031731 Ga0307405_10139350 Ga0307405_101393502 209
159 3300031731 Ga0307405_10736839 Ga0307405_107368391 209
160 3300031838 Ga0307518_10000304 Ga0307518_1000030412 209
161 3300031852 Ga0307410_10113793 Ga0307410_101137932 209
162 3300031852 Ga0307410_10163399 Ga0307410_101633993 209
163 3300031852 Ga0307410_10174807 Ga0307410_101748073 209
164 3300031852 Ga0307410_10416763 Ga0307410_104167632 209
165 3300031901 Ga0307406_10210292 Ga0307406_102102923 209
166 3300031901 Ga0307406_10232733 Ga0307406_102327332 209
167 3300031901 Ga0307406_10389817 Ga0307406_103898171 209
168 3300031903 Ga0307407_10073874 Ga0307407_100738743 209
169 3300031903 Ga0307407_10108113 Ga0307407_101081132 209
170 3300031903 Ga0307407_10140256 Ga0307407_101402562 209
171 3300031911 Ga0307412_10044370 Ga0307412_100443702 209
172 3300031995 Ga0307409_100017243 Ga0307409_1000172435 209
173 3300031995 Ga0307409_100037474 Ga0307409_1000374744 209
174 3300031995 Ga0307409_100108984 Ga0307409_1001089843 209
175 3300031995 Ga0307409_100277994 Ga0307409_1002779942 209
176 3300031995 Ga0307409_100406257 Ga0307409_1004062572 209
177 3300031995 Ga0307409_100751283 Ga0307409_1007512832 209
178 3300031995 Ga0307409_100789524 Ga0307409_1007895241 209
179 3300031995 Ga0307409_100889579 Ga0307409_1008895792 209
180 3300032002 Ga0307416_100042052 Ga0307416_1000420522 209
181 3300032002 Ga0307416_100101334 Ga0307416_1001013343 209
182 3300032002 Ga0307416_100179757 Ga0307416_1001797572 209
183 3300032002 Ga0307416_100218145 Ga0307416_1002181452 209
184 3300032002 Ga0307416_100397473 Ga0307416_1003974732 209
185 3300032004 Ga0307414_10023900 Ga0307414_100239003 209
186 3300032004 Ga0307414_10217237 Ga0307414_102172373 209
187 3300032004 Ga0307414_10386334 Ga0307414_103863342 209
188 3300032004 Ga0307414_10608127 Ga0307414_106081272 209
189 3300032005 Ga0307411_10002867 Ga0307411_100028679 209
190 3300032005 Ga0307411_10395967 Ga0307411_103959672 209
191 3300032126 Ga0307415_100011239 Ga0307415_1000112396 209
192 3300032126 Ga0307415_100011740 Ga0307415_1000117405 209
193 3300032126 Ga0307415_100315100 Ga0307415_1003151002 209
194 3300032126 Ga0307415_100623033 Ga0307415_1006230332 209
195 3300032126 Ga0307415_100657560 Ga0307415_1006575601 209
196 3300032126 Ga0307415_100918343 Ga0307415_1009183432 209
197 3300035695 Ga0373927_0645765 Ga0373927_0645765_34_681 209
198 3300038443 Ga0395901_0019021 Ga0395901_0019021_1907_2545 209
199 3300044693 Ga0466961_0215388 Ga0466961_0215388_240_875 209
200 3300044901 Ga0466960_0162762 Ga0466960_0162762_11_658 209
201 3300045049 Ga0466959_0080023 Ga0466959_0080023_335_970 209
202 3300045976 Ga0466967_0010018 Ga0466967_0010018_3309_3947 209
203 3300045976 Ga0466967_0442292 Ga0466967_0442292_166_804 209
204 3300045976 Ga0466967_1129018 Ga0466967_1129018_11_661 209
205 3300046459 Ga0495629_0226349 Ga0495629_0226349_497_1150 209
206 3300046499 Ga0495594_0003819 Ga0495594_0003819_1775_2428 209
207 3300046499 Ga0495594_0161402 Ga0495594_0161402_583_1236 209
208 3300046616 Ga0495668_0338399 Ga0495668_0338399_126_761 209
209 3300047319 Ga0495674_0602255 Ga0495674_0602255_17_664 209
210 3300047673 Ga0495593_0291003 Ga0495593_0291003_20_655 209
211 3300048089 Ga0495614_0223883 Ga0495614_0223883_18_653 209
212 3300048903 Ga0496100_0543088 Ga0496100_0543088_82_711 209
213 3300048904 Ga0496101_0156843 Ga0496101_0156843_351_998 209
214 3300048907 Ga0496104_0062285 Ga0496104_0062285_1541_2188 209
215 3300048907 Ga0496104_0254025 Ga0496104_0254025_637_1266 209
216 3300048908 Ga0496105_0054376 Ga0496105_0054376_1317_1964 209
217 3300048908 Ga0496105_0345556 Ga0496105_0345556_439_1086 209
218 3300048909 Ga0496106_0385059 Ga0496106_0385059_78_707 209
219 3300048911 Ga0496108_0036480 Ga0496108_0036480_1580_2227 209
220 3300048911 Ga0496108_0802614 Ga0496108_0802614_59_787 209
221 3300048912 Ga0496109_0001469 Ga0496109_0001469_6863_7510 209
222 3300048913 Ga0496110_0002677 Ga0496110_0002677_6136_6783 209
223 3300048914 Ga0496111_0012498 Ga0496111_0012498_458_1105 209
224 3300048914 Ga0496111_0628133 Ga0496111_0628133_135_764 209
225 3300048916 Ga0496113_0005146 Ga0496113_0005146_7473_8120 209
226 3300048917 Ga0496114_0002602 Ga0496114_0002602_10788_11435 209
227 3300048917 Ga0496114_0102781 Ga0496114_0102781_791_1420 209
228 3300048917 Ga0496114_0404109 Ga0496114_0404109_363_1091 209
229 3300049572 Ga0501036_0321417 Ga0501036_0321417_71_709 209
230 3300049577 Ga0501041_0175774 Ga0501041_0175774_412_1050 209
231 3300049582 Ga0501048_0069493 Ga0501048_0069493_831_1466 209
232 3300049587 Ga0501071_0775865 Ga0501071_0775865_91_729 209
233 3300049591 Ga0501075_0163584 Ga0501075_0163584_457_1095 209
234 3300050509 nmdc:mga0qj67_329916_c1 nmdc:mga0qj67_329916_c1_134_781 209
235 3300053090 Ga0500646_0000053 Ga0500646_0000053_23318_23965 209
236 3300053092 Ga0500583_0098904 Ga0500583_0098904_669_1316 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

32

224

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ebb-assembly1.cif.gz_A bacillus stearothermophilus yhfr 0.8241 4 191
5y4a-assembly1.cif.gz_B cadmium directed assembly of adenine phosphoribosyltransferase from yersinia pseudotuberculosis. 0.8113 36 78
6e4b-assembly2.cif.gz_D the crystal structure of a putative alpha-ribazole-5'-p phosphatase from escherichia coli str. k-12 substr. mg1655 0.8092 4 191
6nru-assembly5.cif.gz_E crystal structure of the alpha-ribazole phosphatase from shigella flexneri 0.7995 5 191
6e4b-assembly2.cif.gz_C the crystal structure of a putative alpha-ribazole-5'-p phosphatase from escherichia coli str. k-12 substr. mg1655 0.7849 4 191
ID Description Score Start End Superfamily
af_O06391_3_198_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9814 3 196 3.40.50.1240
af_O06391_3_198_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9666 3 196 3.40.50.1240
af_O44899_1_131_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9193 28 84 3.40.50.1240
af_P0A7A2_1_211_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8329 4 183 3.40.50.1240
1ebbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8241 4 191 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A850DJQ2-F1-model_v4 Histidine phosphatase family protein 1 10 91
AF-A0A7K0NY52-F1-model_v4 Histidine phosphatase family protein 0.9963 9 93 GO:0005737
GO:0016791
AF-A0A6G9FI80-F1-model_v4 Histidine phosphatase family protein 0.9887 3 199 GO:0005737
GO:0016791
AF-A0A652L5F3-F1-model_v4 Histidine phosphatase family protein 0.9856 2 191 GO:0005737
GO:0016791
AF-A0A1Q5GGM6-F1-model_v4 Fructose-2,6-bisphosphatase 0.9816 2 199 GO:0005737
GO:0016791

Feature Viewer

pLDDT pTM Quality
88.12 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map