F349273

General Info

Members Datasets Scaffolds Average Seq Length
236 150 472 94

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0178751|Ga0395901_0178751_20_301
Length 93
Sequence MLYMVIERFREGQAPAVYQRAREQGRMMPPGLTYVSSWVEPDFSRCFQMMECEDPDLLRQWMDAWEDLTEFEVVPVITSAEAAERMAGAPILP

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
90 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
95 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
106 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
107 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
108 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
109 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
110 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
111 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
115 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
116 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
117 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
120 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
121 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
122 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
143 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
144 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
150 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.69
Nodule 0
Rhizoplane 2.12
Rhizosphere 91.53
Stem 0
Stem Tuber 0
Unclassified 22.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0178751 3300038443 Bacteria 2225
2 rootL2_10120050 3300003322 Bacteria 5177
3 rootH1_10180000 3300003323 Unclassified 1898
4 rootH1_10289918 3300003323 Bacteria 2779
5 rootH1_10332002 3300003323 Unclassified 1453
6 rootH1_10404819 3300003323 Unclassified 1248
7 Ga0070683_100011097 3300005329 Bacteria 7768
8 Ga0070683_100301365 3300005329 Bacteria 1525
9 Ga0070670_100855789 3300005331 Unclassified 823
10 Ga0068869_100219274 3300005334 Bacteria 1507
11 Ga0070682_100035558 3300005337 Bacteria 3042
12 Ga0070682_100130162 3300005337 Unclassified 1702
13 Ga0070689_100006397 3300005340 Bacteria 8148
14 Ga0070689_101829713 3300005340 Bacteria 554
15 Ga0070687_100252351 3300005343 Bacteria 1097
16 Ga0070668_100286372 3300005347 Bacteria 1378
17 Ga0070668_101323367 3300005347 Bacteria 655
18 Ga0070669_100087348 3300005353 Bacteria 2331
19 Ga0070669_100229042 3300005353 Bacteria 1472
20 Ga0070675_100085151 3300005354 Bacteria 2641
21 Ga0070675_101051650 3300005354 Unclassified 748
22 Ga0070675_101450963 3300005354 Unclassified 633
23 Ga0070674_100697569 3300005356 Unclassified 867
24 Ga0070673_100017058 3300005364 Bacteria 5151
25 Ga0070688_100503059 3300005365 Bacteria 914
26 Ga0070688_100628468 3300005365 Bacteria 825
27 Ga0070688_101126270 3300005365 Bacteria 628
28 Ga0070703_10314492 3300005406 Bacteria 657
29 Ga0070701_10445495 3300005438 Bacteria 830
30 Ga0070711_100084133 3300005439 Bacteria 2275
31 Ga0070705_100029068 3300005440 Bacteria 3035
32 Ga0070694_100048160 3300005444 Bacteria 2867
33 Ga0070678_100179625 3300005456 Bacteria 1731
34 Ga0070678_101384995 3300005456 Unclassified 656
35 Ga0070662_100841617 3300005457 Bacteria 781
36 Ga0070681_10187364 3300005458 Bacteria 1989
37 Ga0068867_100071479 3300005459 Unclassified 2596
38 Ga0068867_100116303 3300005459 Bacteria 2061
39 Ga0068867_100220074 3300005459 Bacteria 1530
40 Ga0068867_101724671 3300005459 Bacteria 588
41 Ga0070685_10880721 3300005466 Unclassified 665
42 Ga0070685_11442667 3300005466 Unclassified 529
43 Ga0070685_11522246 3300005466 Unclassified 516
44 Ga0070698_101158494 3300005471 Bacteria 722
45 Ga0070679_100633411 3300005530 Bacteria 1012
46 Ga0070684_100037301 3300005535 Bacteria 4169
47 Ga0070684_101397405 3300005535 Unclassified 659
48 Ga0070684_102205544 3300005535 Bacteria 520
49 Ga0070697_100721095 3300005536 Unclassified 880
50 Ga0070672_100014421 3300005543 Bacteria 5600
51 Ga0070672_100336140 3300005543 Unclassified 1285
52 Ga0070672_100722275 3300005543 Bacteria 873
53 Ga0070686_100916381 3300005544 Bacteria 714
54 Ga0070695_100030850 3300005545 Bacteria 3339
55 Ga0070696_100147412 3300005546 Bacteria 1725
56 Ga0070696_101097276 3300005546 Bacteria 669
57 Ga0070693_100801488 3300005547 Bacteria 698
58 Ga0070693_101499142 3300005547 Bacteria 527
59 Ga0070665_100894243 3300005548 Bacteria 901
60 Ga0070704_100530815 3300005549 Bacteria 1026
61 Ga0070664_100186985 3300005564 Bacteria 1844
62 Ga0070664_100237433 3300005564 Unclassified 1635
63 Ga0068857_100102256 3300005577 Bacteria 2572
64 Ga0068859_100796652 3300005617 Bacteria 1033
65 Ga0068864_100062225 3300005618 Bacteria 3234
66 Ga0068864_100116805 3300005618 Bacteria 2381
67 Ga0068866_10402345 3300005718 Bacteria 883
68 Ga0068861_100113933 3300005719 Bacteria 2170
69 Ga0068861_100905816 3300005719 Bacteria 836
70 Ga0068861_101187325 3300005719 Unclassified 737
71 Ga0068861_101772281 3300005719 Unclassified 612
72 Ga0068863_100061732 3300005841 Unclassified 3544
73 Ga0068863_101339086 3300005841 Unclassified 723
74 Ga0068863_101638267 3300005841 Bacteria 653
75 Ga0068858_101095085 3300005842 Bacteria 782
76 Ga0068858_102267608 3300005842 Unclassified 537
77 Ga0068860_100004122 3300005843 Bacteria 14893
78 Ga0068862_100037104 3300005844 Bacteria 4130
79 Ga0068862_100226452 3300005844 Bacteria 1695
80 Ga0068862_100262224 3300005844 Bacteria 1578
81 Ga0068862_100324525 3300005844 Bacteria 1422
82 Ga0068862_100580698 3300005844 Bacteria 1074
83 Ga0068862_101060522 3300005844 Bacteria 804
84 Ga0068862_101254983 3300005844 Bacteria 741
85 Ga0068862_101395103 3300005844 Unclassified 704
86 Ga0068862_101812310 3300005844 Unclassified 620
87 Ga0081455_10088234 3300005937 Bacteria 2521
88 Ga0081455_10397783 3300005937 Bacteria 957
89 Ga0081539_10030478 3300005985 Bacteria 3346
90 Ga0075366_10509464 3300006195 Bacteria 744
91 Ga0068871_100451653 3300006358 Unclassified 1152
92 Ga0075429_101162205 3300006880 Bacteria 674
93 Ga0068865_100902639 3300006881 Unclassified 768
94 Ga0068865_101179030 3300006881 Bacteria 677
95 Ga0097620_100796599 3300006931 Bacteria 1033
96 Ga0111539_10179709 3300009094 Bacteria 2472
97 Ga0111539_10379622 3300009094 Bacteria 1645
98 Ga0111539_11282710 3300009094 Unclassified 850
99 Ga0105245_10397833 3300009098 Bacteria 1376
100 Ga0114129_10612487 3300009147 Unclassified 1409
101 Ga0105243_10567073 3300009148 Bacteria 1087
102 Ga0105248_10313637 3300009177 Unclassified 1766
103 Ga0105249_10752110 3300009553 Bacteria 1037
104 Ga0105249_12146700 3300009553 Bacteria 631
105 Ga0105249_12222120 3300009553 Bacteria 621
106 Ga0157373_10948433 3300013100 Bacteria 640
107 Ga0157372_11981051 3300013307 Bacteria 669
108 Ga0157375_10188335 3300013308 Unclassified 2218
109 Ga0157375_10521950 3300013308 Bacteria 1351
110 Ga0157375_10783092 3300013308 Bacteria 1103
111 Ga0157375_11254274 3300013308 Bacteria 870
112 Ga0157375_12716123 3300013308 Bacteria 592
113 Ga0163163_10651369 3300014325 Bacteria 1117
114 Ga0157380_10034071 3300014326 Unclassified 3926
115 Ga0157380_10445240 3300014326 Bacteria 1242
116 Ga0157380_10753969 3300014326 Bacteria 985
117 Ga0157380_10954645 3300014326 Bacteria 888
118 Ga0157380_12778527 3300014326 Unclassified 556
119 Ga0157376_12279360 3300014969 Bacteria 581
120 Ga0207642_10294021 3300025899 Bacteria 939
121 Ga0207688_10813460 3300025901 Bacteria 592
122 Ga0207663_10669674 3300025916 Unclassified 820
123 Ga0207659_10074687 3300025926 Bacteria 2485
124 Ga0207706_10789122 3300025933 Bacteria 807
125 Ga0207670_10082409 3300025936 Bacteria 2254
126 Ga0207670_10914024 3300025936 Bacteria 735
127 Ga0207691_10241022 3300025940 Bacteria 1563
128 Ga0207691_10409366 3300025940 Bacteria 1156
129 Ga0207661_10001892 3300025944 Bacteria 14350
130 Ga0207661_10577910 3300025944 Bacteria 1031
131 Ga0207651_10296791 3300025960 Unclassified 1342
132 Ga0207712_11009798 3300025961 Bacteria 738
133 Ga0207712_11064564 3300025961 Bacteria 719
134 Ga0207668_10076152 3300025972 Bacteria 2415
135 Ga0207640_11934747 3300025981 Bacteria 534
136 Ga0207703_11948891 3300026035 Unclassified 564
137 Ga0207678_11049748 3300026067 Bacteria 721
138 Ga0207641_10074239 3300026088 Unclassified 2933
139 Ga0207648_10059992 3300026089 Unclassified 3318
140 Ga0207648_10096766 3300026089 Bacteria 2583
141 Ga0207676_10100544 3300026095 Bacteria 2396
142 Ga0207674_10088030 3300026116 Bacteria 3099
143 Ga0207674_10120255 3300026116 Bacteria 2595
144 Ga0207675_100062882 3300026118 Bacteria 3468
145 Ga0207675_100154230 3300026118 Bacteria 2188
146 Ga0207675_100175546 3300026118 Bacteria 2050
147 Ga0207675_100624116 3300026118 Bacteria 1082
148 Ga0207683_10083860 3300026121 Bacteria 2832
149 Ga0268266_11443081 3300028379 Bacteria 664
150 Ga0268265_10024050 3300028380 Bacteria 4304
151 Ga0268265_10055588 3300028380 Unclassified 3008
152 Ga0268265_10254599 3300028380 Bacteria 1557
153 Ga0268265_10260369 3300028380 Bacteria 1542
154 Ga0268265_10330419 3300028380 Bacteria 1384
155 Ga0268265_10616822 3300028380 Bacteria 1039
156 Ga0268265_11071456 3300028380 Bacteria 799
157 Ga0268264_10000631 3300028381 Bacteria 41866
158 Ga0268264_10048093 3300028381 Bacteria 3547
159 Ga0268264_10127270 3300028381 Bacteria 2253
160 Ga0268264_10977579 3300028381 Unclassified 852
161 Ga0307517_10322420 3300028786 Bacteria 854
162 Ga0307509_10014687 3300031507 Bacteria 9187
163 Ga0307509_10093016 3300031507 Bacteria 3080
164 Ga0265313_10087420 3300031595 Bacteria 1405
165 Ga0307405_11912616 3300031731 Bacteria 529
166 Ga0373936_0097507 3300035113 Unclassified 1238
167 Ga0373943_0116380 3300035170 Bacteria 1416
168 Ga0373924_0125390 3300035410 Unclassified 1116
169 Ga0373935_0026271 3300035692 Bacteria 3592
170 Ga0373927_0033122 3300035695 Bacteria 3364
171 Ga0373947_0020727 3300035725 Bacteria 3799
172 Ga0373937_0197359 3300036401 Bacteria 1891
173 Ga0373937_1388416 3300036401 Unclassified 650
174 Ga0373925_0062532 3300037068 Bacteria 2799
175 Ga0395905_0073126 3300037471 Bacteria 3213
176 Ga0436360_0854032 3300039438 Bacteria 1499
177 Ga0436361_0087752 3300039447 Bacteria 545
178 Ga0436361_0314686 3300039447 Bacteria 1966
179 Ga0436362_0956660 3300039453 Bacteria 818
180 Ga0451789_0610497 3300041443 Unclassified 534
181 Ga0451798_1089567 3300041458 Bacteria 912
182 Ga0451802_1407809 3300041460 Unclassified 685
183 Ga0451807_0503003 3300041486 Bacteria 547
184 Ga0451807_0917587 3300041486 Unclassified 668
185 Ga0451849_0492686 3300041505 Bacteria 906
186 Ga0451851_1316600 3300041507 Bacteria 532
187 Ga0451843_0855429 3300041509 Unclassified 528
188 Ga0451576_0114301 3300045051 Bacteria 2810
189 Ga0495638_0029941 3300046460 Bacteria 3509
190 Ga0495616_0004558 3300046513 Bacteria 8721
191 Ga0495632_0056830 3300046519 Bacteria 1912
192 Ga0495654_0293856 3300046530 Bacteria 665
193 Ga0495656_0051172 3300046615 Bacteria 1767
194 Ga0495656_0306679 3300046615 Unclassified 815
195 Ga0495668_0439450 3300046616 Bacteria 718
196 Ga0495625_0035272 3300046660 Bacteria 3688
197 Ga0495625_0048718 3300046660 Bacteria 3049
198 Ga0495625_0399229 3300046660 Bacteria 859
199 Ga0495649_0390041 3300046694 Bacteria 700
200 Ga0495649_0439767 3300046694 Unclassified 652
201 Ga0495672_0472521 3300047320 Bacteria 562
202 Ga0495626_0420960 3300048091 Bacteria 515
203 Ga0501036_0067415 3300049572 Bacteria 3028
204 Ga0501038_0299470 3300049574 Bacteria 1262
205 Ga0501038_1070018 3300049574 Bacteria 590
206 Ga0501040_0353384 3300049576 Bacteria 1053
207 Ga0501040_0506832 3300049576 Bacteria 870
208 Ga0501041_0041237 3300049577 Bacteria 2803
209 Ga0501042_0533297 3300049578 Bacteria 853
210 Ga0501046_0093418 3300049580 Bacteria 2312
211 Ga0501048_0038924 3300049582 Bacteria 3412
212 Ga0501067_0386721 3300049583 Bacteria 780
213 Ga0501068_0104713 3300049584 Bacteria 1756
214 Ga0501071_0045977 3300049587 Bacteria 3135
215 Ga0501071_1575265 3300049587 Bacteria 507
216 Ga0501072_0010608 3300049588 Bacteria 7016
217 Ga0501073_0426253 3300049589 Unclassified 917
218 Ga0501075_0308994 3300049591 Unclassified 1205
219 Ga0501076_0000941 3300049592 Bacteria 18993
220 Ga0501076_1452708 3300049592 Unclassified 563
221 Ga0501077_0108156 3300049593 Bacteria 1761
222 Ga0501079_0276372 3300049741 Bacteria 1313
223 Ga0501079_1233888 3300049741 Unclassified 589
224 Ga0501080_0680846 3300049742 Bacteria 908
225 Ga0501081_0498487 3300049743 Bacteria 907
226 Ga0501083_0102968 3300049744 Bacteria 1882
227 Ga0501083_0324232 3300049744 Bacteria 1002
228 Ga0501269_011968 3300049766 Unclassified 1058
229 nmdc:mga03n38_366904_c1 3300050490 Bacteria 786
230 nmdc:mga0k408_583402_c1 3300050493 Bacteria 660
231 nmdc:mga05p37_472472_c1 3300050507 Bacteria 1446
232 nmdc:mga08y16_242860_c1 3300050511 Bacteria 1861
233 Ga0500645_029678 3300053730 Bacteria 1650
234 Ga0501084_0056999 3300054114 Bacteria 3269
235 Ga0501082_0003064 3300060353 Bacteria 14587
236 Ga0530510_0000710 3300061734 Bacteria 21611
237 Ga0395901_0178751
238 rootL2_10120050
239 rootH1_10180000
240 rootH1_10289918
241 rootH1_10332002
242 rootH1_10404819
243 Ga0070683_100011097
244 Ga0070683_100301365
245 Ga0070670_100855789
246 Ga0068869_100219274
247 Ga0070682_100035558
248 Ga0070682_100130162
249 Ga0070689_100006397
250 Ga0070689_101829713
251 Ga0070687_100252351
252 Ga0070668_100286372
253 Ga0070668_101323367
254 Ga0070669_100087348
255 Ga0070669_100229042
256 Ga0070675_100085151
257 Ga0070675_101051650
258 Ga0070675_101450963
259 Ga0070674_100697569
260 Ga0070673_100017058
261 Ga0070688_100503059
262 Ga0070688_100628468
263 Ga0070688_101126270
264 Ga0070703_10314492
265 Ga0070701_10445495
266 Ga0070711_100084133
267 Ga0070705_100029068
268 Ga0070694_100048160
269 Ga0070678_100179625
270 Ga0070678_101384995
271 Ga0070662_100841617
272 Ga0070681_10187364
273 Ga0068867_100071479
274 Ga0068867_100116303
275 Ga0068867_100220074
276 Ga0068867_101724671
277 Ga0070685_10880721
278 Ga0070685_11442667
279 Ga0070685_11522246
280 Ga0070698_101158494
281 Ga0070679_100633411
282 Ga0070684_100037301
283 Ga0070684_101397405
284 Ga0070684_102205544
285 Ga0070697_100721095
286 Ga0070672_100014421
287 Ga0070672_100336140
288 Ga0070672_100722275
289 Ga0070686_100916381
290 Ga0070695_100030850
291 Ga0070696_100147412
292 Ga0070696_101097276
293 Ga0070693_100801488
294 Ga0070693_101499142
295 Ga0070665_100894243
296 Ga0070704_100530815
297 Ga0070664_100186985
298 Ga0070664_100237433
299 Ga0068857_100102256
300 Ga0068859_100796652
301 Ga0068864_100062225
302 Ga0068864_100116805
303 Ga0068866_10402345
304 Ga0068861_100113933
305 Ga0068861_100905816
306 Ga0068861_101187325
307 Ga0068861_101772281
308 Ga0068863_100061732
309 Ga0068863_101339086
310 Ga0068863_101638267
311 Ga0068858_101095085
312 Ga0068858_102267608
313 Ga0068860_100004122
314 Ga0068862_100037104
315 Ga0068862_100226452
316 Ga0068862_100262224
317 Ga0068862_100324525
318 Ga0068862_100580698
319 Ga0068862_101060522
320 Ga0068862_101254983
321 Ga0068862_101395103
322 Ga0068862_101812310
323 Ga0081455_10088234
324 Ga0081455_10397783
325 Ga0081539_10030478
326 Ga0075366_10509464
327 Ga0068871_100451653
328 Ga0075429_101162205
329 Ga0068865_100902639
330 Ga0068865_101179030
331 Ga0097620_100796599
332 Ga0111539_10179709
333 Ga0111539_10379622
334 Ga0111539_11282710
335 Ga0105245_10397833
336 Ga0114129_10612487
337 Ga0105243_10567073
338 Ga0105248_10313637
339 Ga0105249_10752110
340 Ga0105249_12146700
341 Ga0105249_12222120
342 Ga0157373_10948433
343 Ga0157372_11981051
344 Ga0157375_10188335
345 Ga0157375_10521950
346 Ga0157375_10783092
347 Ga0157375_11254274
348 Ga0157375_12716123
349 Ga0163163_10651369
350 Ga0157380_10034071
351 Ga0157380_10445240
352 Ga0157380_10753969
353 Ga0157380_10954645
354 Ga0157380_12778527
355 Ga0157376_12279360
356 Ga0207642_10294021
357 Ga0207688_10813460
358 Ga0207663_10669674
359 Ga0207659_10074687
360 Ga0207706_10789122
361 Ga0207670_10082409
362 Ga0207670_10914024
363 Ga0207691_10241022
364 Ga0207691_10409366
365 Ga0207661_10001892
366 Ga0207661_10577910
367 Ga0207651_10296791
368 Ga0207712_11009798
369 Ga0207712_11064564
370 Ga0207668_10076152
371 Ga0207640_11934747
372 Ga0207703_11948891
373 Ga0207678_11049748
374 Ga0207641_10074239
375 Ga0207648_10059992
376 Ga0207648_10096766
377 Ga0207676_10100544
378 Ga0207674_10088030
379 Ga0207674_10120255
380 Ga0207675_100062882
381 Ga0207675_100154230
382 Ga0207675_100175546
383 Ga0207675_100624116
384 Ga0207683_10083860
385 Ga0268266_11443081
386 Ga0268265_10024050
387 Ga0268265_10055588
388 Ga0268265_10254599
389 Ga0268265_10260369
390 Ga0268265_10330419
391 Ga0268265_10616822
392 Ga0268265_11071456
393 Ga0268264_10000631
394 Ga0268264_10048093
395 Ga0268264_10127270
396 Ga0268264_10977579
397 Ga0307517_10322420
398 Ga0307509_10014687
399 Ga0307509_10093016
400 Ga0265313_10087420
401 Ga0307405_11912616
402 Ga0373936_0097507
403 Ga0373943_0116380
404 Ga0373924_0125390
405 Ga0373935_0026271
406 Ga0373927_0033122
407 Ga0373947_0020727
408 Ga0373937_0197359
409 Ga0373937_1388416
410 Ga0373925_0062532
411 Ga0395905_0073126
412 Ga0436360_0854032
413 Ga0436361_0087752
414 Ga0436361_0314686
415 Ga0436362_0956660
416 Ga0451789_0610497
417 Ga0451798_1089567
418 Ga0451802_1407809
419 Ga0451807_0503003
420 Ga0451807_0917587
421 Ga0451849_0492686
422 Ga0451851_1316600
423 Ga0451843_0855429
424 Ga0451576_0114301
425 Ga0495638_0029941
426 Ga0495616_0004558
427 Ga0495632_0056830
428 Ga0495654_0293856
429 Ga0495656_0051172
430 Ga0495656_0306679
431 Ga0495668_0439450
432 Ga0495625_0035272
433 Ga0495625_0048718
434 Ga0495625_0399229
435 Ga0495649_0390041
436 Ga0495649_0439767
437 Ga0495672_0472521
438 Ga0495626_0420960
439 Ga0501036_0067415
440 Ga0501038_0299470
441 Ga0501038_1070018
442 Ga0501040_0353384
443 Ga0501040_0506832
444 Ga0501041_0041237
445 Ga0501042_0533297
446 Ga0501046_0093418
447 Ga0501048_0038924
448 Ga0501067_0386721
449 Ga0501068_0104713
450 Ga0501071_0045977
451 Ga0501071_1575265
452 Ga0501072_0010608
453 Ga0501073_0426253
454 Ga0501075_0308994
455 Ga0501076_0000941
456 Ga0501076_1452708
457 Ga0501077_0108156
458 Ga0501079_0276372
459 Ga0501079_1233888
460 Ga0501080_0680846
461 Ga0501081_0498487
462 Ga0501083_0102968
463 Ga0501083_0324232
464 Ga0501269_011968
465 nmdc:mga03n38_366904_c1
466 nmdc:mga0k408_583402_c1
467 nmdc:mga05p37_472472_c1
468 nmdc:mga08y16_242860_c1
469 Ga0500645_029678
470 Ga0501084_0056999
471 Ga0501082_0003064
472 Ga0530510_0000710

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11746

DUF3303

Domain of unknown function (DUF3303)

1

90

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lub-assembly1.cif.gz_B x-ray structure of prephenate dehydratase from streptococcus mutans 0.7082 2 75
7l08-assembly1.cif.gz_AE cryo-em structure of the human 55s mitoribosome-rrfmt complex. 0.6954 1 77
3ibw-assembly1.cif.gz_B crystal structure of the act domain from gtp pyrophosphokinase of chlorobium tepidum. northeast structural genomics consortium target ctr148a 0.6892 2 75
4lub-assembly1.cif.gz_A x-ray structure of prephenate dehydratase from streptococcus mutans 0.6752 2 75
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.672 1 80
ID Description Score Start End Superfamily
4lubB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.7111 2 76 3.30.70.260
3rhuB01 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.6703 32 52 3.30.980.10
4waoF01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.6693 1 77 3.30.70.60
af_O53289_94_177_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.657 1 81 3.30.70.260
af_Q0IYI4_18_93_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.656 2 76 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A2V6SIE6-F1-model_v4 Uncharacterized protein 0.9701 1 61
AF-A0A831WUG0-F1-model_v4 DUF3303 domain-containing protein 0.962 1 59
AF-A0A7Y5NG27-F1-model_v4 DUF3303 family protein 0.9532 1 71
AF-A0A0N8GEA5-F1-model_v4 DUF3303 domain-containing protein 0.9497 1 90
AF-A0A5S4GHG0-F1-model_v4 DUF3303 domain-containing protein 0.9481 1 92

Map