F348976

General Info

Members Datasets Scaffolds Average Seq Length
236 126 472 302

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100007776|Ga0075428_10000777611
Length 332
Sequence VPEFRHRPVLVGEVLEGLGLSGGRWSRLVGKSAERTGNGRRWSADPTLWVDGTVGGGGHAAEILRASAPGGRLIGFDRDAVAIEAASKALSDFAGRFELHHGNFSELAGTIERGSCDGVLLDLGVSSPQLDQAERGFSFQQQGPLDMRMDRRQALTAAELVNGWDARELAKIFREFGDEPQAGRFARGIAQERTRARFETTTQLARLIERLAPRHGSKRHPATRVFQALRMAVNDEGRSLKSGLAAACTCLRSGGRLVVITFHSLEDRIVKEFGREKTRDYTFEGDVDVPELRRPVAPGMKWVQRKAVQPSEAEVKENPRARSAQLRVLEKI

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
10 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
15 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
18 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
19 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
37 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
38 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
39 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
40 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
41 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
42 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
45 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
46 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
47 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
48 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
49 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
50 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
51 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
52 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
53 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
54 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
57 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
58 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
59 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
60 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
61 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
62 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
63 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
64 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
65 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
66 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
67 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
68 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
69 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
70 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
71 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
74 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
82 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
83 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
84 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
85 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
89 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
90 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
91 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
96 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
97 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
98 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
99 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
100 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
103 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
108 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
123 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 0
Rhizosphere 99.58
Stem 0
Stem Tuber 0
Unclassified 13.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100007776 3300006844 Bacteria 11878
2 Ga0070689_100033156 3300005340 Bacteria 3933
3 Ga0070689_100090975 3300005340 Unclassified 2405
4 Ga0070669_100289656 3300005353 Bacteria 1314
5 Ga0070675_100301388 3300005354 Unclassified 1412
6 Ga0070688_100339708 3300005365 Unclassified 1096
7 Ga0070701_10019660 3300005438 Unclassified 3193
8 Ga0070700_100249053 3300005441 Bacteria 1273
9 Ga0070694_100004469 3300005444 Bacteria 8409
10 Ga0070686_100007381 3300005544 Bacteria 6131
11 Ga0070704_100016724 3300005549 Unclassified 4643
12 Ga0068857_100123656 3300005577 Bacteria 2331
13 Ga0068856_100192927 3300005614 Bacteria 2051
14 Ga0068859_100583693 3300005617 Bacteria 1211
15 Ga0068863_100018246 3300005841 Bacteria 6718
16 Ga0068863_100025911 3300005841 Bacteria 5595
17 Ga0075430_100168042 3300006846 Bacteria 1824
18 Ga0075431_100296242 3300006847 Bacteria 1635
19 Ga0075431_100587502 3300006847 Bacteria 1099
20 Ga0075434_100287120 3300006871 Bacteria 1665
21 Ga0075429_100028975 3300006880 Bacteria 4809
22 Ga0097620_100583737 3300006931 Unclassified 1211
23 Ga0105240_10019053 3300009093 Bacteria 9178
24 Ga0105240_10051859 3300009093 Bacteria 5160
25 Ga0105240_10298042 3300009093 Bacteria 1845
26 Ga0111539_10189927 3300009094 Bacteria 2397
27 Ga0111539_10935805 3300009094 Unclassified 1008
28 Ga0105242_10022674 3300009176 Unclassified 4942
29 Ga0105238_10069069 3300009551 Bacteria 3534
30 Ga0105238_10094915 3300009551 Bacteria 2970
31 Ga0157375_10000017 3300013308 Bacteria 286152
32 Ga0157375_10357477 3300013308 Bacteria 1626
33 Ga0163163_10000194 3300014325 Bacteria 62568
34 Ga0163163_10014910 3300014325 Bacteria 7160
35 Ga0163163_10015916 3300014325 Bacteria 6966
36 Ga0207707_10237195 3300025912 Unclassified 1586
37 Ga0207695_10041569 3300025913 Unclassified 4920
38 Ga0207695_10243036 3300025913 Bacteria 1701
39 Ga0207663_10001297 3300025916 Bacteria 11584
40 Ga0207694_10048711 3300025924 Bacteria 3279
41 Ga0207670_10003688 3300025936 Bacteria 8128
42 Ga0207670_10039048 3300025936 Bacteria 3106
43 Ga0207670_10069467 3300025936 Unclassified 2430
44 Ga0207670_10139852 3300025936 Bacteria 1784
45 Ga0207667_10097623 3300025949 Bacteria 3032
46 Ga0207667_10102894 3300025949 Bacteria 2946
47 Ga0207702_10000669 3300026078 Bacteria 37291
48 Ga0207641_10005591 3300026088 Bacteria 10713
49 Ga0207641_10598384 3300026088 Bacteria 1079
50 Ga0207676_10089336 3300026095 Unclassified 2525
51 Ga0207674_10006645 3300026116 Bacteria 13585
52 Ga0207674_10107758 3300026116 Unclassified 2763
53 Ga0265337_1000077 3300028556 Bacteria 46215
54 Ga0265337_1001501 3300028556 Bacteria 11453
55 Ga0265337_1008122 3300028556 Bacteria 3850
56 Ga0265337_1008271 3300028556 Bacteria 3799
57 Ga0265326_10014800 3300028558 Unclassified 2270
58 Ga0265319_1000004 3300028563 Bacteria 305085
59 Ga0265319_1005911 3300028563 Bacteria 5756
60 Ga0265319_1017379 3300028563 Bacteria 2735
61 Ga0265334_10011816 3300028573 Bacteria 3669
62 Ga0265334_10027591 3300028573 Bacteria 2287
63 Ga0265318_10010114 3300028577 Bacteria 4121
64 Ga0265318_10075614 3300028577 Bacteria 1246
65 Ga0265323_10000058 3300028653 Bacteria 61416
66 Ga0265323_10027426 3300028653 Unclassified 2139
67 Ga0265336_10011067 3300028666 Bacteria 3074
68 Ga0265336_10025002 3300028666 Bacteria 1883
69 Ga0265336_10038214 3300028666 Bacteria 1474
70 Ga0265338_10000038 3300028800 Bacteria 237195
71 Ga0265338_10000214 3300028800 Bacteria 106870
72 Ga0265338_10000276 3300028800 Bacteria 93585
73 Ga0265338_10000439 3300028800 Bacteria 74770
74 Ga0265338_10000533 3300028800 Bacteria 66710
75 Ga0265338_10001209 3300028800 Bacteria 42710
76 Ga0265338_10003168 3300028800 Bacteria 23481
77 Ga0265338_10004206 3300028800 Bacteria 19630
78 Ga0265338_10005205 3300028800 Bacteria 17062
79 Ga0265338_10005909 3300028800 Bacteria 15775
80 Ga0265338_10033054 3300028800 Bacteria 5029
81 Ga0265338_10038777 3300028800 Bacteria 4507
82 Ga0265338_10045690 3300028800 Bacteria 4023
83 Ga0265338_10058663 3300028800 Bacteria 3395
84 Ga0265338_10072150 3300028800 Bacteria 2949
85 Ga0265324_10000237 3300029957 Bacteria 41672
86 Ga0265324_10000865 3300029957 Bacteria 19451
87 Ga0265324_10009715 3300029957 Bacteria 3742
88 Ga0265324_10014393 3300029957 Bacteria 2928
89 Ga0265324_10029402 3300029957 Bacteria 1932
90 Ga0265324_10039999 3300029957 Bacteria 1625
91 Ga0265324_10061628 3300029957 Unclassified 1281
92 Ga0265332_10007573 3300031238 Bacteria 4907
93 Ga0265332_10063420 3300031238 Bacteria 1579
94 Ga0265320_10000242 3300031240 Bacteria 45162
95 Ga0265320_10000364 3300031240 Bacteria 36776
96 Ga0265320_10010804 3300031240 Bacteria 5412
97 Ga0265320_10093600 3300031240 Bacteria 1390
98 Ga0265320_10105770 3300031240 Bacteria 1293
99 Ga0265325_10028660 3300031241 Bacteria 2999
100 Ga0265325_10061953 3300031241 Bacteria 1896
101 Ga0265340_10019788 3300031247 Bacteria 3464
102 Ga0265340_10121704 3300031247 Bacteria 1200
103 Ga0265339_10038448 3300031249 Bacteria 2670
104 Ga0265339_10062388 3300031249 Bacteria 2004
105 Ga0265327_10011867 3300031251 Bacteria 5953
106 Ga0265327_10027884 3300031251 Unclassified 3242
107 Ga0265316_10001480 3300031344 Bacteria 25164
108 Ga0265316_10007636 3300031344 Bacteria 10157
109 Ga0265316_10046077 3300031344 Bacteria 3457
110 Ga0265316_10059981 3300031344 Bacteria 2958
111 Ga0265316_10117004 3300031344 Bacteria 2015
112 Ga0265316_10127068 3300031344 Bacteria 1922
113 Ga0265316_10129410 3300031344 Unclassified 1902
114 Ga0265314_10000214 3300031711 Bacteria 85787
115 Ga0265314_10062952 3300031711 Bacteria 2519
116 Ga0316578_10088408 3300031728 Bacteria 1849
117 Ga0316577_10024144 3300031733 Unclassified 3379
118 Ga0316577_10126749 3300031733 Unclassified 1436
119 Ga0307410_10072515 3300031852 Bacteria 2391
120 Ga0307406_10208739 3300031901 Bacteria 1443
121 Ga0373950_0014892 3300034818 Bacteria 1313
122 Ga0373928_0000416 3300035084 Bacteria 8506
123 Ga0373929_0002727 3300035085 Bacteria 3223
124 Ga0373934_0040866 3300035086 Bacteria 1830
125 Ga0373944_0000468 3300035089 Bacteria 9365
126 Ga0373944_0008724 3300035089 Bacteria 2739
127 Ga0373949_0001180 3300035090 Bacteria 7756
128 Ga0373951_0013530 3300035091 Bacteria 1834
129 Ga0373932_0000001 3300035112 Bacteria 1459067
130 Ga0373939_0027171 3300035114 Bacteria 1619
131 Ga0373945_0024404 3300035116 Unclassified 2095
132 Ga0373945_0058771 3300035116 Bacteria 1430
133 Ga0373954_0001248 3300035118 Bacteria 10248
134 Ga0373956_0010590 3300035119 Bacteria 3783
135 Ga0373955_0249726 3300035172 Bacteria 1063
136 Ga0373962_0000071 3300035242 Bacteria 22282
137 Ga0373924_0104268 3300035410 Bacteria 1222
138 Ga0373931_0000004 3300035691 Bacteria 535140
139 Ga0373933_0007348 3300035724 Bacteria 6011
140 Ga0373933_0073599 3300035724 Bacteria 2082
141 Ga0373947_0092890 3300035725 Bacteria 1885
142 Ga0373937_0001257 3300036401 Bacteria 21283
143 Ga0316584_0048518 3300036712 Unclassified 3172
144 Ga0373925_0001025 3300037068 Bacteria 25280
145 Ga0373925_0001940 3300037068 Bacteria 17113
146 Ga0373925_0077395 3300037068 Bacteria 2524
147 Ga0451577_0001420 3300042876 Bacteria 31947
148 Ga0451577_0016497 3300042876 Bacteria 6839
149 Ga0451577_0021986 3300042876 Bacteria 5829
150 Ga0451577_0105793 3300042876 Bacteria 2515
151 Ga0451577_0569533 3300042876 Bacteria 1028
152 Ga0453684_0005468 3300044712 Bacteria 25149
153 Ga0453684_0013158 3300044712 Bacteria 13492
154 Ga0453684_0155737 3300044712 Bacteria 2710
155 Ga0453684_0199625 3300044712 Bacteria 2332
156 Ga0451576_0093591 3300045051 Bacteria 3125
157 Ga0451576_0165999 3300045051 Unclassified 2304
158 Ga0451576_0222652 3300045051 Bacteria 1970
159 Ga0451576_0261323 3300045051 Unclassified 1810
160 Ga0451576_0283022 3300045051 Bacteria 1734
161 Ga0451576_0358337 3300045051 Bacteria 1527
162 Ga0451576_0444744 3300045051 Unclassified 1360
163 Ga0495592_0000101 3300046454 Bacteria 75856
164 Ga0495629_0013056 3300046459 Bacteria 6002
165 Ga0495582_0020469 3300046473 Bacteria 3622
166 Ga0495662_0063018 3300046476 Bacteria 1791
167 Ga0495662_0129352 3300046476 Bacteria 1241
168 Ga0495618_0001806 3300046514 Bacteria 14162
169 Ga0495618_0009320 3300046514 Bacteria 5925
170 Ga0495628_0001655 3300046516 Bacteria 20382
171 Ga0495628_0142515 3300046516 Bacteria 1829
172 Ga0495630_0000073 3300046517 Bacteria 79321
173 Ga0495630_0012740 3300046517 Bacteria 6108
174 Ga0495630_0027455 3300046517 Unclassified 4224
175 Ga0495630_0027987 3300046517 Bacteria 4188
176 Ga0495666_0067955 3300046526 Bacteria 1697
177 Ga0495652_0215371 3300046529 Bacteria 1447
178 Ga0495640_0029652 3300046533 Bacteria 3925
179 Ga0495640_0078072 3300046533 Bacteria 2206
180 Ga0495586_0000040 3300046535 Bacteria 79335
181 Ga0495586_0000348 3300046535 Bacteria 29056
182 Ga0495586_0000548 3300046535 Bacteria 21893
183 Ga0495586_0218234 3300046535 Bacteria 1083
184 Ga0495645_0008072 3300046543 Bacteria 7335
185 Ga0495645_0041238 3300046543 Bacteria 3366
186 Ga0495622_0033752 3300046557 Unclassified 2388
187 Ga0495667_0025781 3300046559 Bacteria 3961
188 Ga0495634_0053868 3300046642 Bacteria 2693
189 Ga0495634_0113823 3300046642 Bacteria 1737
190 Ga0495635_0074856 3300046663 Unclassified 2320
191 Ga0495657_0224190 3300046675 Bacteria 1139
192 Ga0495599_0009385 3300046678 Bacteria 5979
193 Ga0495647_0024491 3300046681 Bacteria 2197
194 Ga0495647_0030847 3300046681 Bacteria 1991
195 Ga0495658_0066699 3300046683 Bacteria 2079
196 Ga0495658_0077211 3300046683 Bacteria 1947
197 Ga0495613_0008133 3300046689 Bacteria 7802
198 Ga0495613_0096341 3300046689 Unclassified 2140
199 Ga0495624_0076878 3300046690 Bacteria 2071
200 Ga0495581_0026721 3300047315 Bacteria 3346
201 Ga0495674_0002615 3300047319 Bacteria 17520
202 Ga0495674_0013832 3300047319 Bacteria 7575
203 Ga0495674_0093892 3300047319 Bacteria 2560
204 Ga0495674_0201492 3300047319 Bacteria 1651
205 Ga0495676_0006224 3300047321 Bacteria 10981
206 Ga0495676_0311681 3300047321 Bacteria 1059
207 Ga0495680_0033867 3300047322 Bacteria 4132
208 Ga0495675_0121405 3300047444 Bacteria 1627
209 Ga0495675_0237722 3300047444 Bacteria 1097
210 Ga0495684_0076775 3300047471 Bacteria 2537
211 Ga0495684_0172883 3300047471 Bacteria 1605
212 Ga0501031_0032938 3300049568 Bacteria 3379
213 Ga0501032_0005152 3300049569 Bacteria 9747
214 Ga0501033_0036884 3300049570 Bacteria 3661
215 Ga0501033_0095320 3300049570 Unclassified 2175
216 Ga0501034_0270022 3300049571 Bacteria 1642
217 Ga0501034_0272003 3300049571 Bacteria 1635
218 Ga0501036_0345504 3300049572 Unclassified 1243
219 Ga0501037_0122566 3300049573 Bacteria 1868
220 Ga0501038_0179930 3300049574 Bacteria 1707
221 Ga0501043_0274592 3300049579 Bacteria 1293
222 Ga0501047_0190745 3300049581 Bacteria 1913
223 Ga0501047_0461920 3300049581 Bacteria 1098
224 Ga0501070_0209785 3300049586 Bacteria 1599
225 Ga0501080_0212767 3300049742 Bacteria 1771
226 Ga0501035_0007978 3300049822 Bacteria 9872
227 Ga0501035_0162951 3300049822 Bacteria 1929
228 Ga0501044_0001072 3300049823 Bacteria 32802
229 Ga0501044_0223893 3300049823 Bacteria 1831
230 nmdc:mga0qj67_118511_c1 3300050509 Bacteria 2140
231 nmdc:mga06r32_175208_c1 3300050510 Bacteria 2129
232 nmdc:mga08y16_119658_c1 3300050511 Bacteria 2741
233 nmdc:mga08y16_282754_c1 3300050511 Bacteria 1711
234 nmdc:mga0n895_156693_c1 3300050512 Bacteria 2308
235 nmdc:mga0n895_274989_c1 3300050512 Bacteria 1708
236 Ga0500650_0055896 3300053098 Unclassified 1838
237 Ga0075428_100007776
238 Ga0070689_100033156
239 Ga0070689_100090975
240 Ga0070669_100289656
241 Ga0070675_100301388
242 Ga0070688_100339708
243 Ga0070701_10019660
244 Ga0070700_100249053
245 Ga0070694_100004469
246 Ga0070686_100007381
247 Ga0070704_100016724
248 Ga0068857_100123656
249 Ga0068856_100192927
250 Ga0068859_100583693
251 Ga0068863_100018246
252 Ga0068863_100025911
253 Ga0075430_100168042
254 Ga0075431_100296242
255 Ga0075431_100587502
256 Ga0075434_100287120
257 Ga0075429_100028975
258 Ga0097620_100583737
259 Ga0105240_10019053
260 Ga0105240_10051859
261 Ga0105240_10298042
262 Ga0111539_10189927
263 Ga0111539_10935805
264 Ga0105242_10022674
265 Ga0105238_10069069
266 Ga0105238_10094915
267 Ga0157375_10000017
268 Ga0157375_10357477
269 Ga0163163_10000194
270 Ga0163163_10014910
271 Ga0163163_10015916
272 Ga0207707_10237195
273 Ga0207695_10041569
274 Ga0207695_10243036
275 Ga0207663_10001297
276 Ga0207694_10048711
277 Ga0207670_10003688
278 Ga0207670_10039048
279 Ga0207670_10069467
280 Ga0207670_10139852
281 Ga0207667_10097623
282 Ga0207667_10102894
283 Ga0207702_10000669
284 Ga0207641_10005591
285 Ga0207641_10598384
286 Ga0207676_10089336
287 Ga0207674_10006645
288 Ga0207674_10107758
289 Ga0265337_1000077
290 Ga0265337_1001501
291 Ga0265337_1008122
292 Ga0265337_1008271
293 Ga0265326_10014800
294 Ga0265319_1000004
295 Ga0265319_1005911
296 Ga0265319_1017379
297 Ga0265334_10011816
298 Ga0265334_10027591
299 Ga0265318_10010114
300 Ga0265318_10075614
301 Ga0265323_10000058
302 Ga0265323_10027426
303 Ga0265336_10011067
304 Ga0265336_10025002
305 Ga0265336_10038214
306 Ga0265338_10000038
307 Ga0265338_10000214
308 Ga0265338_10000276
309 Ga0265338_10000439
310 Ga0265338_10000533
311 Ga0265338_10001209
312 Ga0265338_10003168
313 Ga0265338_10004206
314 Ga0265338_10005205
315 Ga0265338_10005909
316 Ga0265338_10033054
317 Ga0265338_10038777
318 Ga0265338_10045690
319 Ga0265338_10058663
320 Ga0265338_10072150
321 Ga0265324_10000237
322 Ga0265324_10000865
323 Ga0265324_10009715
324 Ga0265324_10014393
325 Ga0265324_10029402
326 Ga0265324_10039999
327 Ga0265324_10061628
328 Ga0265332_10007573
329 Ga0265332_10063420
330 Ga0265320_10000242
331 Ga0265320_10000364
332 Ga0265320_10010804
333 Ga0265320_10093600
334 Ga0265320_10105770
335 Ga0265325_10028660
336 Ga0265325_10061953
337 Ga0265340_10019788
338 Ga0265340_10121704
339 Ga0265339_10038448
340 Ga0265339_10062388
341 Ga0265327_10011867
342 Ga0265327_10027884
343 Ga0265316_10001480
344 Ga0265316_10007636
345 Ga0265316_10046077
346 Ga0265316_10059981
347 Ga0265316_10117004
348 Ga0265316_10127068
349 Ga0265316_10129410
350 Ga0265314_10000214
351 Ga0265314_10062952
352 Ga0316578_10088408
353 Ga0316577_10024144
354 Ga0316577_10126749
355 Ga0307410_10072515
356 Ga0307406_10208739
357 Ga0373950_0014892
358 Ga0373928_0000416
359 Ga0373929_0002727
360 Ga0373934_0040866
361 Ga0373944_0000468
362 Ga0373944_0008724
363 Ga0373949_0001180
364 Ga0373951_0013530
365 Ga0373932_0000001
366 Ga0373939_0027171
367 Ga0373945_0024404
368 Ga0373945_0058771
369 Ga0373954_0001248
370 Ga0373956_0010590
371 Ga0373955_0249726
372 Ga0373962_0000071
373 Ga0373924_0104268
374 Ga0373931_0000004
375 Ga0373933_0007348
376 Ga0373933_0073599
377 Ga0373947_0092890
378 Ga0373937_0001257
379 Ga0316584_0048518
380 Ga0373925_0001025
381 Ga0373925_0001940
382 Ga0373925_0077395
383 Ga0451577_0001420
384 Ga0451577_0016497
385 Ga0451577_0021986
386 Ga0451577_0105793
387 Ga0451577_0569533
388 Ga0453684_0005468
389 Ga0453684_0013158
390 Ga0453684_0155737
391 Ga0453684_0199625
392 Ga0451576_0093591
393 Ga0451576_0165999
394 Ga0451576_0222652
395 Ga0451576_0261323
396 Ga0451576_0283022
397 Ga0451576_0358337
398 Ga0451576_0444744
399 Ga0495592_0000101
400 Ga0495629_0013056
401 Ga0495582_0020469
402 Ga0495662_0063018
403 Ga0495662_0129352
404 Ga0495618_0001806
405 Ga0495618_0009320
406 Ga0495628_0001655
407 Ga0495628_0142515
408 Ga0495630_0000073
409 Ga0495630_0012740
410 Ga0495630_0027455
411 Ga0495630_0027987
412 Ga0495666_0067955
413 Ga0495652_0215371
414 Ga0495640_0029652
415 Ga0495640_0078072
416 Ga0495586_0000040
417 Ga0495586_0000348
418 Ga0495586_0000548
419 Ga0495586_0218234
420 Ga0495645_0008072
421 Ga0495645_0041238
422 Ga0495622_0033752
423 Ga0495667_0025781
424 Ga0495634_0053868
425 Ga0495634_0113823
426 Ga0495635_0074856
427 Ga0495657_0224190
428 Ga0495599_0009385
429 Ga0495647_0024491
430 Ga0495647_0030847
431 Ga0495658_0066699
432 Ga0495658_0077211
433 Ga0495613_0008133
434 Ga0495613_0096341
435 Ga0495624_0076878
436 Ga0495581_0026721
437 Ga0495674_0002615
438 Ga0495674_0013832
439 Ga0495674_0093892
440 Ga0495674_0201492
441 Ga0495676_0006224
442 Ga0495676_0311681
443 Ga0495680_0033867
444 Ga0495675_0121405
445 Ga0495675_0237722
446 Ga0495684_0076775
447 Ga0495684_0172883
448 Ga0501031_0032938
449 Ga0501032_0005152
450 Ga0501033_0036884
451 Ga0501033_0095320
452 Ga0501034_0270022
453 Ga0501034_0272003
454 Ga0501036_0345504
455 Ga0501037_0122566
456 Ga0501038_0179930
457 Ga0501043_0274592
458 Ga0501047_0190745
459 Ga0501047_0461920
460 Ga0501070_0209785
461 Ga0501080_0212767
462 Ga0501035_0007978
463 Ga0501035_0162951
464 Ga0501044_0001072
465 Ga0501044_0223893
466 nmdc:mga0qj67_118511_c1
467 nmdc:mga06r32_175208_c1
468 nmdc:mga08y16_119658_c1
469 nmdc:mga08y16_282754_c1
470 nmdc:mga0n895_156693_c1
471 nmdc:mga0n895_274989_c1
472 Ga0500650_0055896

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01795

Methyltransf_5

MraW methylase family

3

332

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.9204 1 301
1n2x-assembly1.cif.gz_A crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.9172 1 302
1n2x-assembly2.cif.gz_B crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.9096 1 300
1n2x-assembly1.cif.gz_A crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.9019 1 302
3tka-assembly1.cif.gz_A-2 crystal structure and solution saxs of methyltransferase rsmh from e.coli 0.8957 4 301
ID Description Score Start End Superfamily
3tkaA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9671 104 204 1.10.150.170
1wg8B02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9588 103 205 1.10.150.170
1wg8B02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9495 103 205 1.10.150.170
af_Q9VGY5_27_186_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9405 2 149 3.40.50.150
3tkaA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9386 104 204 1.10.150.170
ID Description Score Start End GO Terms
AF-A0A6N6Q409-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase RsmH 0.9831 2 234 GO:0005737
GO:0070475
GO:0071424
AF-A0A355VG75-F1-model_v4 deleted 0.9605 2 234
AF-A0A645CKM3-F1-model_v4 Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) 0.9577 118 241 GO:0005737
GO:0070475
GO:0071424
AF-A0A2M8L4B4-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase 0.957 1 232 GO:0005737
GO:0070475
GO:0071424
AF-A0A2W4Z2A8-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase 0.9561 2 243 GO:0005737
GO:0070475
GO:0071424

Map