F348976
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 236 | 126 | 472 | 302 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_100007776|Ga0075428_10000777611 |
| Length | 332 |
| Sequence | VPEFRHRPVLVGEVLEGLGLSGGRWSRLVGKSAERTGNGRRWSADPTLWVDGTVGGGGHAAEILRASAPGGRLIGFDRDAVAIEAASKALSDFAGRFELHHGNFSELAGTIERGSCDGVLLDLGVSSPQLDQAERGFSFQQQGPLDMRMDRRQALTAAELVNGWDARELAKIFREFGDEPQAGRFARGIAQERTRARFETTTQLARLIERLAPRHGSKRHPATRVFQALRMAVNDEGRSLKSGLAAACTCLRSGGRLVVITFHSLEDRIVKEFGREKTRDYTFEGDVDVPELRRPVAPGMKWVQRKAVQPSEAEVKENPRARSAQLRVLEKI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 2 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 12 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 13 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 14 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 15 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 16 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 17 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 18 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 19 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 20 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 21 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 25 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 26 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 37 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 38 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 39 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 40 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 41 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 42 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 43 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 44 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 45 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 46 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 47 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 48 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 49 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 50 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 51 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 52 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 53 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 54 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 55 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 56 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 57 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 58 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 59 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 60 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 61 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 62 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 63 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 64 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 65 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 66 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 67 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 68 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 69 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 70 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 71 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 72 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 73 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 74 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 75 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 76 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 77 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 78 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 79 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 80 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 81 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 110 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 111 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 112 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 113 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 114 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 116 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 118 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 123 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 124 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 125 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 126 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.42 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 99.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075428_100007776 | 3300006844 | Bacteria | 11878 |
| 2 | Ga0070689_100033156 | 3300005340 | Bacteria | 3933 |
| 3 | Ga0070689_100090975 | 3300005340 | Unclassified | 2405 |
| 4 | Ga0070669_100289656 | 3300005353 | Bacteria | 1314 |
| 5 | Ga0070675_100301388 | 3300005354 | Unclassified | 1412 |
| 6 | Ga0070688_100339708 | 3300005365 | Unclassified | 1096 |
| 7 | Ga0070701_10019660 | 3300005438 | Unclassified | 3193 |
| 8 | Ga0070700_100249053 | 3300005441 | Bacteria | 1273 |
| 9 | Ga0070694_100004469 | 3300005444 | Bacteria | 8409 |
| 10 | Ga0070686_100007381 | 3300005544 | Bacteria | 6131 |
| 11 | Ga0070704_100016724 | 3300005549 | Unclassified | 4643 |
| 12 | Ga0068857_100123656 | 3300005577 | Bacteria | 2331 |
| 13 | Ga0068856_100192927 | 3300005614 | Bacteria | 2051 |
| 14 | Ga0068859_100583693 | 3300005617 | Bacteria | 1211 |
| 15 | Ga0068863_100018246 | 3300005841 | Bacteria | 6718 |
| 16 | Ga0068863_100025911 | 3300005841 | Bacteria | 5595 |
| 17 | Ga0075430_100168042 | 3300006846 | Bacteria | 1824 |
| 18 | Ga0075431_100296242 | 3300006847 | Bacteria | 1635 |
| 19 | Ga0075431_100587502 | 3300006847 | Bacteria | 1099 |
| 20 | Ga0075434_100287120 | 3300006871 | Bacteria | 1665 |
| 21 | Ga0075429_100028975 | 3300006880 | Bacteria | 4809 |
| 22 | Ga0097620_100583737 | 3300006931 | Unclassified | 1211 |
| 23 | Ga0105240_10019053 | 3300009093 | Bacteria | 9178 |
| 24 | Ga0105240_10051859 | 3300009093 | Bacteria | 5160 |
| 25 | Ga0105240_10298042 | 3300009093 | Bacteria | 1845 |
| 26 | Ga0111539_10189927 | 3300009094 | Bacteria | 2397 |
| 27 | Ga0111539_10935805 | 3300009094 | Unclassified | 1008 |
| 28 | Ga0105242_10022674 | 3300009176 | Unclassified | 4942 |
| 29 | Ga0105238_10069069 | 3300009551 | Bacteria | 3534 |
| 30 | Ga0105238_10094915 | 3300009551 | Bacteria | 2970 |
| 31 | Ga0157375_10000017 | 3300013308 | Bacteria | 286152 |
| 32 | Ga0157375_10357477 | 3300013308 | Bacteria | 1626 |
| 33 | Ga0163163_10000194 | 3300014325 | Bacteria | 62568 |
| 34 | Ga0163163_10014910 | 3300014325 | Bacteria | 7160 |
| 35 | Ga0163163_10015916 | 3300014325 | Bacteria | 6966 |
| 36 | Ga0207707_10237195 | 3300025912 | Unclassified | 1586 |
| 37 | Ga0207695_10041569 | 3300025913 | Unclassified | 4920 |
| 38 | Ga0207695_10243036 | 3300025913 | Bacteria | 1701 |
| 39 | Ga0207663_10001297 | 3300025916 | Bacteria | 11584 |
| 40 | Ga0207694_10048711 | 3300025924 | Bacteria | 3279 |
| 41 | Ga0207670_10003688 | 3300025936 | Bacteria | 8128 |
| 42 | Ga0207670_10039048 | 3300025936 | Bacteria | 3106 |
| 43 | Ga0207670_10069467 | 3300025936 | Unclassified | 2430 |
| 44 | Ga0207670_10139852 | 3300025936 | Bacteria | 1784 |
| 45 | Ga0207667_10097623 | 3300025949 | Bacteria | 3032 |
| 46 | Ga0207667_10102894 | 3300025949 | Bacteria | 2946 |
| 47 | Ga0207702_10000669 | 3300026078 | Bacteria | 37291 |
| 48 | Ga0207641_10005591 | 3300026088 | Bacteria | 10713 |
| 49 | Ga0207641_10598384 | 3300026088 | Bacteria | 1079 |
| 50 | Ga0207676_10089336 | 3300026095 | Unclassified | 2525 |
| 51 | Ga0207674_10006645 | 3300026116 | Bacteria | 13585 |
| 52 | Ga0207674_10107758 | 3300026116 | Unclassified | 2763 |
| 53 | Ga0265337_1000077 | 3300028556 | Bacteria | 46215 |
| 54 | Ga0265337_1001501 | 3300028556 | Bacteria | 11453 |
| 55 | Ga0265337_1008122 | 3300028556 | Bacteria | 3850 |
| 56 | Ga0265337_1008271 | 3300028556 | Bacteria | 3799 |
| 57 | Ga0265326_10014800 | 3300028558 | Unclassified | 2270 |
| 58 | Ga0265319_1000004 | 3300028563 | Bacteria | 305085 |
| 59 | Ga0265319_1005911 | 3300028563 | Bacteria | 5756 |
| 60 | Ga0265319_1017379 | 3300028563 | Bacteria | 2735 |
| 61 | Ga0265334_10011816 | 3300028573 | Bacteria | 3669 |
| 62 | Ga0265334_10027591 | 3300028573 | Bacteria | 2287 |
| 63 | Ga0265318_10010114 | 3300028577 | Bacteria | 4121 |
| 64 | Ga0265318_10075614 | 3300028577 | Bacteria | 1246 |
| 65 | Ga0265323_10000058 | 3300028653 | Bacteria | 61416 |
| 66 | Ga0265323_10027426 | 3300028653 | Unclassified | 2139 |
| 67 | Ga0265336_10011067 | 3300028666 | Bacteria | 3074 |
| 68 | Ga0265336_10025002 | 3300028666 | Bacteria | 1883 |
| 69 | Ga0265336_10038214 | 3300028666 | Bacteria | 1474 |
| 70 | Ga0265338_10000038 | 3300028800 | Bacteria | 237195 |
| 71 | Ga0265338_10000214 | 3300028800 | Bacteria | 106870 |
| 72 | Ga0265338_10000276 | 3300028800 | Bacteria | 93585 |
| 73 | Ga0265338_10000439 | 3300028800 | Bacteria | 74770 |
| 74 | Ga0265338_10000533 | 3300028800 | Bacteria | 66710 |
| 75 | Ga0265338_10001209 | 3300028800 | Bacteria | 42710 |
| 76 | Ga0265338_10003168 | 3300028800 | Bacteria | 23481 |
| 77 | Ga0265338_10004206 | 3300028800 | Bacteria | 19630 |
| 78 | Ga0265338_10005205 | 3300028800 | Bacteria | 17062 |
| 79 | Ga0265338_10005909 | 3300028800 | Bacteria | 15775 |
| 80 | Ga0265338_10033054 | 3300028800 | Bacteria | 5029 |
| 81 | Ga0265338_10038777 | 3300028800 | Bacteria | 4507 |
| 82 | Ga0265338_10045690 | 3300028800 | Bacteria | 4023 |
| 83 | Ga0265338_10058663 | 3300028800 | Bacteria | 3395 |
| 84 | Ga0265338_10072150 | 3300028800 | Bacteria | 2949 |
| 85 | Ga0265324_10000237 | 3300029957 | Bacteria | 41672 |
| 86 | Ga0265324_10000865 | 3300029957 | Bacteria | 19451 |
| 87 | Ga0265324_10009715 | 3300029957 | Bacteria | 3742 |
| 88 | Ga0265324_10014393 | 3300029957 | Bacteria | 2928 |
| 89 | Ga0265324_10029402 | 3300029957 | Bacteria | 1932 |
| 90 | Ga0265324_10039999 | 3300029957 | Bacteria | 1625 |
| 91 | Ga0265324_10061628 | 3300029957 | Unclassified | 1281 |
| 92 | Ga0265332_10007573 | 3300031238 | Bacteria | 4907 |
| 93 | Ga0265332_10063420 | 3300031238 | Bacteria | 1579 |
| 94 | Ga0265320_10000242 | 3300031240 | Bacteria | 45162 |
| 95 | Ga0265320_10000364 | 3300031240 | Bacteria | 36776 |
| 96 | Ga0265320_10010804 | 3300031240 | Bacteria | 5412 |
| 97 | Ga0265320_10093600 | 3300031240 | Bacteria | 1390 |
| 98 | Ga0265320_10105770 | 3300031240 | Bacteria | 1293 |
| 99 | Ga0265325_10028660 | 3300031241 | Bacteria | 2999 |
| 100 | Ga0265325_10061953 | 3300031241 | Bacteria | 1896 |
| 101 | Ga0265340_10019788 | 3300031247 | Bacteria | 3464 |
| 102 | Ga0265340_10121704 | 3300031247 | Bacteria | 1200 |
| 103 | Ga0265339_10038448 | 3300031249 | Bacteria | 2670 |
| 104 | Ga0265339_10062388 | 3300031249 | Bacteria | 2004 |
| 105 | Ga0265327_10011867 | 3300031251 | Bacteria | 5953 |
| 106 | Ga0265327_10027884 | 3300031251 | Unclassified | 3242 |
| 107 | Ga0265316_10001480 | 3300031344 | Bacteria | 25164 |
| 108 | Ga0265316_10007636 | 3300031344 | Bacteria | 10157 |
| 109 | Ga0265316_10046077 | 3300031344 | Bacteria | 3457 |
| 110 | Ga0265316_10059981 | 3300031344 | Bacteria | 2958 |
| 111 | Ga0265316_10117004 | 3300031344 | Bacteria | 2015 |
| 112 | Ga0265316_10127068 | 3300031344 | Bacteria | 1922 |
| 113 | Ga0265316_10129410 | 3300031344 | Unclassified | 1902 |
| 114 | Ga0265314_10000214 | 3300031711 | Bacteria | 85787 |
| 115 | Ga0265314_10062952 | 3300031711 | Bacteria | 2519 |
| 116 | Ga0316578_10088408 | 3300031728 | Bacteria | 1849 |
| 117 | Ga0316577_10024144 | 3300031733 | Unclassified | 3379 |
| 118 | Ga0316577_10126749 | 3300031733 | Unclassified | 1436 |
| 119 | Ga0307410_10072515 | 3300031852 | Bacteria | 2391 |
| 120 | Ga0307406_10208739 | 3300031901 | Bacteria | 1443 |
| 121 | Ga0373950_0014892 | 3300034818 | Bacteria | 1313 |
| 122 | Ga0373928_0000416 | 3300035084 | Bacteria | 8506 |
| 123 | Ga0373929_0002727 | 3300035085 | Bacteria | 3223 |
| 124 | Ga0373934_0040866 | 3300035086 | Bacteria | 1830 |
| 125 | Ga0373944_0000468 | 3300035089 | Bacteria | 9365 |
| 126 | Ga0373944_0008724 | 3300035089 | Bacteria | 2739 |
| 127 | Ga0373949_0001180 | 3300035090 | Bacteria | 7756 |
| 128 | Ga0373951_0013530 | 3300035091 | Bacteria | 1834 |
| 129 | Ga0373932_0000001 | 3300035112 | Bacteria | 1459067 |
| 130 | Ga0373939_0027171 | 3300035114 | Bacteria | 1619 |
| 131 | Ga0373945_0024404 | 3300035116 | Unclassified | 2095 |
| 132 | Ga0373945_0058771 | 3300035116 | Bacteria | 1430 |
| 133 | Ga0373954_0001248 | 3300035118 | Bacteria | 10248 |
| 134 | Ga0373956_0010590 | 3300035119 | Bacteria | 3783 |
| 135 | Ga0373955_0249726 | 3300035172 | Bacteria | 1063 |
| 136 | Ga0373962_0000071 | 3300035242 | Bacteria | 22282 |
| 137 | Ga0373924_0104268 | 3300035410 | Bacteria | 1222 |
| 138 | Ga0373931_0000004 | 3300035691 | Bacteria | 535140 |
| 139 | Ga0373933_0007348 | 3300035724 | Bacteria | 6011 |
| 140 | Ga0373933_0073599 | 3300035724 | Bacteria | 2082 |
| 141 | Ga0373947_0092890 | 3300035725 | Bacteria | 1885 |
| 142 | Ga0373937_0001257 | 3300036401 | Bacteria | 21283 |
| 143 | Ga0316584_0048518 | 3300036712 | Unclassified | 3172 |
| 144 | Ga0373925_0001025 | 3300037068 | Bacteria | 25280 |
| 145 | Ga0373925_0001940 | 3300037068 | Bacteria | 17113 |
| 146 | Ga0373925_0077395 | 3300037068 | Bacteria | 2524 |
| 147 | Ga0451577_0001420 | 3300042876 | Bacteria | 31947 |
| 148 | Ga0451577_0016497 | 3300042876 | Bacteria | 6839 |
| 149 | Ga0451577_0021986 | 3300042876 | Bacteria | 5829 |
| 150 | Ga0451577_0105793 | 3300042876 | Bacteria | 2515 |
| 151 | Ga0451577_0569533 | 3300042876 | Bacteria | 1028 |
| 152 | Ga0453684_0005468 | 3300044712 | Bacteria | 25149 |
| 153 | Ga0453684_0013158 | 3300044712 | Bacteria | 13492 |
| 154 | Ga0453684_0155737 | 3300044712 | Bacteria | 2710 |
| 155 | Ga0453684_0199625 | 3300044712 | Bacteria | 2332 |
| 156 | Ga0451576_0093591 | 3300045051 | Bacteria | 3125 |
| 157 | Ga0451576_0165999 | 3300045051 | Unclassified | 2304 |
| 158 | Ga0451576_0222652 | 3300045051 | Bacteria | 1970 |
| 159 | Ga0451576_0261323 | 3300045051 | Unclassified | 1810 |
| 160 | Ga0451576_0283022 | 3300045051 | Bacteria | 1734 |
| 161 | Ga0451576_0358337 | 3300045051 | Bacteria | 1527 |
| 162 | Ga0451576_0444744 | 3300045051 | Unclassified | 1360 |
| 163 | Ga0495592_0000101 | 3300046454 | Bacteria | 75856 |
| 164 | Ga0495629_0013056 | 3300046459 | Bacteria | 6002 |
| 165 | Ga0495582_0020469 | 3300046473 | Bacteria | 3622 |
| 166 | Ga0495662_0063018 | 3300046476 | Bacteria | 1791 |
| 167 | Ga0495662_0129352 | 3300046476 | Bacteria | 1241 |
| 168 | Ga0495618_0001806 | 3300046514 | Bacteria | 14162 |
| 169 | Ga0495618_0009320 | 3300046514 | Bacteria | 5925 |
| 170 | Ga0495628_0001655 | 3300046516 | Bacteria | 20382 |
| 171 | Ga0495628_0142515 | 3300046516 | Bacteria | 1829 |
| 172 | Ga0495630_0000073 | 3300046517 | Bacteria | 79321 |
| 173 | Ga0495630_0012740 | 3300046517 | Bacteria | 6108 |
| 174 | Ga0495630_0027455 | 3300046517 | Unclassified | 4224 |
| 175 | Ga0495630_0027987 | 3300046517 | Bacteria | 4188 |
| 176 | Ga0495666_0067955 | 3300046526 | Bacteria | 1697 |
| 177 | Ga0495652_0215371 | 3300046529 | Bacteria | 1447 |
| 178 | Ga0495640_0029652 | 3300046533 | Bacteria | 3925 |
| 179 | Ga0495640_0078072 | 3300046533 | Bacteria | 2206 |
| 180 | Ga0495586_0000040 | 3300046535 | Bacteria | 79335 |
| 181 | Ga0495586_0000348 | 3300046535 | Bacteria | 29056 |
| 182 | Ga0495586_0000548 | 3300046535 | Bacteria | 21893 |
| 183 | Ga0495586_0218234 | 3300046535 | Bacteria | 1083 |
| 184 | Ga0495645_0008072 | 3300046543 | Bacteria | 7335 |
| 185 | Ga0495645_0041238 | 3300046543 | Bacteria | 3366 |
| 186 | Ga0495622_0033752 | 3300046557 | Unclassified | 2388 |
| 187 | Ga0495667_0025781 | 3300046559 | Bacteria | 3961 |
| 188 | Ga0495634_0053868 | 3300046642 | Bacteria | 2693 |
| 189 | Ga0495634_0113823 | 3300046642 | Bacteria | 1737 |
| 190 | Ga0495635_0074856 | 3300046663 | Unclassified | 2320 |
| 191 | Ga0495657_0224190 | 3300046675 | Bacteria | 1139 |
| 192 | Ga0495599_0009385 | 3300046678 | Bacteria | 5979 |
| 193 | Ga0495647_0024491 | 3300046681 | Bacteria | 2197 |
| 194 | Ga0495647_0030847 | 3300046681 | Bacteria | 1991 |
| 195 | Ga0495658_0066699 | 3300046683 | Bacteria | 2079 |
| 196 | Ga0495658_0077211 | 3300046683 | Bacteria | 1947 |
| 197 | Ga0495613_0008133 | 3300046689 | Bacteria | 7802 |
| 198 | Ga0495613_0096341 | 3300046689 | Unclassified | 2140 |
| 199 | Ga0495624_0076878 | 3300046690 | Bacteria | 2071 |
| 200 | Ga0495581_0026721 | 3300047315 | Bacteria | 3346 |
| 201 | Ga0495674_0002615 | 3300047319 | Bacteria | 17520 |
| 202 | Ga0495674_0013832 | 3300047319 | Bacteria | 7575 |
| 203 | Ga0495674_0093892 | 3300047319 | Bacteria | 2560 |
| 204 | Ga0495674_0201492 | 3300047319 | Bacteria | 1651 |
| 205 | Ga0495676_0006224 | 3300047321 | Bacteria | 10981 |
| 206 | Ga0495676_0311681 | 3300047321 | Bacteria | 1059 |
| 207 | Ga0495680_0033867 | 3300047322 | Bacteria | 4132 |
| 208 | Ga0495675_0121405 | 3300047444 | Bacteria | 1627 |
| 209 | Ga0495675_0237722 | 3300047444 | Bacteria | 1097 |
| 210 | Ga0495684_0076775 | 3300047471 | Bacteria | 2537 |
| 211 | Ga0495684_0172883 | 3300047471 | Bacteria | 1605 |
| 212 | Ga0501031_0032938 | 3300049568 | Bacteria | 3379 |
| 213 | Ga0501032_0005152 | 3300049569 | Bacteria | 9747 |
| 214 | Ga0501033_0036884 | 3300049570 | Bacteria | 3661 |
| 215 | Ga0501033_0095320 | 3300049570 | Unclassified | 2175 |
| 216 | Ga0501034_0270022 | 3300049571 | Bacteria | 1642 |
| 217 | Ga0501034_0272003 | 3300049571 | Bacteria | 1635 |
| 218 | Ga0501036_0345504 | 3300049572 | Unclassified | 1243 |
| 219 | Ga0501037_0122566 | 3300049573 | Bacteria | 1868 |
| 220 | Ga0501038_0179930 | 3300049574 | Bacteria | 1707 |
| 221 | Ga0501043_0274592 | 3300049579 | Bacteria | 1293 |
| 222 | Ga0501047_0190745 | 3300049581 | Bacteria | 1913 |
| 223 | Ga0501047_0461920 | 3300049581 | Bacteria | 1098 |
| 224 | Ga0501070_0209785 | 3300049586 | Bacteria | 1599 |
| 225 | Ga0501080_0212767 | 3300049742 | Bacteria | 1771 |
| 226 | Ga0501035_0007978 | 3300049822 | Bacteria | 9872 |
| 227 | Ga0501035_0162951 | 3300049822 | Bacteria | 1929 |
| 228 | Ga0501044_0001072 | 3300049823 | Bacteria | 32802 |
| 229 | Ga0501044_0223893 | 3300049823 | Bacteria | 1831 |
| 230 | nmdc:mga0qj67_118511_c1 | 3300050509 | Bacteria | 2140 |
| 231 | nmdc:mga06r32_175208_c1 | 3300050510 | Bacteria | 2129 |
| 232 | nmdc:mga08y16_119658_c1 | 3300050511 | Bacteria | 2741 |
| 233 | nmdc:mga08y16_282754_c1 | 3300050511 | Bacteria | 1711 |
| 234 | nmdc:mga0n895_156693_c1 | 3300050512 | Bacteria | 2308 |
| 235 | nmdc:mga0n895_274989_c1 | 3300050512 | Bacteria | 1708 |
| 236 | Ga0500650_0055896 | 3300053098 | Unclassified | 1838 |
| 237 | Ga0075428_100007776 | |||
| 238 | Ga0070689_100033156 | |||
| 239 | Ga0070689_100090975 | |||
| 240 | Ga0070669_100289656 | |||
| 241 | Ga0070675_100301388 | |||
| 242 | Ga0070688_100339708 | |||
| 243 | Ga0070701_10019660 | |||
| 244 | Ga0070700_100249053 | |||
| 245 | Ga0070694_100004469 | |||
| 246 | Ga0070686_100007381 | |||
| 247 | Ga0070704_100016724 | |||
| 248 | Ga0068857_100123656 | |||
| 249 | Ga0068856_100192927 | |||
| 250 | Ga0068859_100583693 | |||
| 251 | Ga0068863_100018246 | |||
| 252 | Ga0068863_100025911 | |||
| 253 | Ga0075430_100168042 | |||
| 254 | Ga0075431_100296242 | |||
| 255 | Ga0075431_100587502 | |||
| 256 | Ga0075434_100287120 | |||
| 257 | Ga0075429_100028975 | |||
| 258 | Ga0097620_100583737 | |||
| 259 | Ga0105240_10019053 | |||
| 260 | Ga0105240_10051859 | |||
| 261 | Ga0105240_10298042 | |||
| 262 | Ga0111539_10189927 | |||
| 263 | Ga0111539_10935805 | |||
| 264 | Ga0105242_10022674 | |||
| 265 | Ga0105238_10069069 | |||
| 266 | Ga0105238_10094915 | |||
| 267 | Ga0157375_10000017 | |||
| 268 | Ga0157375_10357477 | |||
| 269 | Ga0163163_10000194 | |||
| 270 | Ga0163163_10014910 | |||
| 271 | Ga0163163_10015916 | |||
| 272 | Ga0207707_10237195 | |||
| 273 | Ga0207695_10041569 | |||
| 274 | Ga0207695_10243036 | |||
| 275 | Ga0207663_10001297 | |||
| 276 | Ga0207694_10048711 | |||
| 277 | Ga0207670_10003688 | |||
| 278 | Ga0207670_10039048 | |||
| 279 | Ga0207670_10069467 | |||
| 280 | Ga0207670_10139852 | |||
| 281 | Ga0207667_10097623 | |||
| 282 | Ga0207667_10102894 | |||
| 283 | Ga0207702_10000669 | |||
| 284 | Ga0207641_10005591 | |||
| 285 | Ga0207641_10598384 | |||
| 286 | Ga0207676_10089336 | |||
| 287 | Ga0207674_10006645 | |||
| 288 | Ga0207674_10107758 | |||
| 289 | Ga0265337_1000077 | |||
| 290 | Ga0265337_1001501 | |||
| 291 | Ga0265337_1008122 | |||
| 292 | Ga0265337_1008271 | |||
| 293 | Ga0265326_10014800 | |||
| 294 | Ga0265319_1000004 | |||
| 295 | Ga0265319_1005911 | |||
| 296 | Ga0265319_1017379 | |||
| 297 | Ga0265334_10011816 | |||
| 298 | Ga0265334_10027591 | |||
| 299 | Ga0265318_10010114 | |||
| 300 | Ga0265318_10075614 | |||
| 301 | Ga0265323_10000058 | |||
| 302 | Ga0265323_10027426 | |||
| 303 | Ga0265336_10011067 | |||
| 304 | Ga0265336_10025002 | |||
| 305 | Ga0265336_10038214 | |||
| 306 | Ga0265338_10000038 | |||
| 307 | Ga0265338_10000214 | |||
| 308 | Ga0265338_10000276 | |||
| 309 | Ga0265338_10000439 | |||
| 310 | Ga0265338_10000533 | |||
| 311 | Ga0265338_10001209 | |||
| 312 | Ga0265338_10003168 | |||
| 313 | Ga0265338_10004206 | |||
| 314 | Ga0265338_10005205 | |||
| 315 | Ga0265338_10005909 | |||
| 316 | Ga0265338_10033054 | |||
| 317 | Ga0265338_10038777 | |||
| 318 | Ga0265338_10045690 | |||
| 319 | Ga0265338_10058663 | |||
| 320 | Ga0265338_10072150 | |||
| 321 | Ga0265324_10000237 | |||
| 322 | Ga0265324_10000865 | |||
| 323 | Ga0265324_10009715 | |||
| 324 | Ga0265324_10014393 | |||
| 325 | Ga0265324_10029402 | |||
| 326 | Ga0265324_10039999 | |||
| 327 | Ga0265324_10061628 | |||
| 328 | Ga0265332_10007573 | |||
| 329 | Ga0265332_10063420 | |||
| 330 | Ga0265320_10000242 | |||
| 331 | Ga0265320_10000364 | |||
| 332 | Ga0265320_10010804 | |||
| 333 | Ga0265320_10093600 | |||
| 334 | Ga0265320_10105770 | |||
| 335 | Ga0265325_10028660 | |||
| 336 | Ga0265325_10061953 | |||
| 337 | Ga0265340_10019788 | |||
| 338 | Ga0265340_10121704 | |||
| 339 | Ga0265339_10038448 | |||
| 340 | Ga0265339_10062388 | |||
| 341 | Ga0265327_10011867 | |||
| 342 | Ga0265327_10027884 | |||
| 343 | Ga0265316_10001480 | |||
| 344 | Ga0265316_10007636 | |||
| 345 | Ga0265316_10046077 | |||
| 346 | Ga0265316_10059981 | |||
| 347 | Ga0265316_10117004 | |||
| 348 | Ga0265316_10127068 | |||
| 349 | Ga0265316_10129410 | |||
| 350 | Ga0265314_10000214 | |||
| 351 | Ga0265314_10062952 | |||
| 352 | Ga0316578_10088408 | |||
| 353 | Ga0316577_10024144 | |||
| 354 | Ga0316577_10126749 | |||
| 355 | Ga0307410_10072515 | |||
| 356 | Ga0307406_10208739 | |||
| 357 | Ga0373950_0014892 | |||
| 358 | Ga0373928_0000416 | |||
| 359 | Ga0373929_0002727 | |||
| 360 | Ga0373934_0040866 | |||
| 361 | Ga0373944_0000468 | |||
| 362 | Ga0373944_0008724 | |||
| 363 | Ga0373949_0001180 | |||
| 364 | Ga0373951_0013530 | |||
| 365 | Ga0373932_0000001 | |||
| 366 | Ga0373939_0027171 | |||
| 367 | Ga0373945_0024404 | |||
| 368 | Ga0373945_0058771 | |||
| 369 | Ga0373954_0001248 | |||
| 370 | Ga0373956_0010590 | |||
| 371 | Ga0373955_0249726 | |||
| 372 | Ga0373962_0000071 | |||
| 373 | Ga0373924_0104268 | |||
| 374 | Ga0373931_0000004 | |||
| 375 | Ga0373933_0007348 | |||
| 376 | Ga0373933_0073599 | |||
| 377 | Ga0373947_0092890 | |||
| 378 | Ga0373937_0001257 | |||
| 379 | Ga0316584_0048518 | |||
| 380 | Ga0373925_0001025 | |||
| 381 | Ga0373925_0001940 | |||
| 382 | Ga0373925_0077395 | |||
| 383 | Ga0451577_0001420 | |||
| 384 | Ga0451577_0016497 | |||
| 385 | Ga0451577_0021986 | |||
| 386 | Ga0451577_0105793 | |||
| 387 | Ga0451577_0569533 | |||
| 388 | Ga0453684_0005468 | |||
| 389 | Ga0453684_0013158 | |||
| 390 | Ga0453684_0155737 | |||
| 391 | Ga0453684_0199625 | |||
| 392 | Ga0451576_0093591 | |||
| 393 | Ga0451576_0165999 | |||
| 394 | Ga0451576_0222652 | |||
| 395 | Ga0451576_0261323 | |||
| 396 | Ga0451576_0283022 | |||
| 397 | Ga0451576_0358337 | |||
| 398 | Ga0451576_0444744 | |||
| 399 | Ga0495592_0000101 | |||
| 400 | Ga0495629_0013056 | |||
| 401 | Ga0495582_0020469 | |||
| 402 | Ga0495662_0063018 | |||
| 403 | Ga0495662_0129352 | |||
| 404 | Ga0495618_0001806 | |||
| 405 | Ga0495618_0009320 | |||
| 406 | Ga0495628_0001655 | |||
| 407 | Ga0495628_0142515 | |||
| 408 | Ga0495630_0000073 | |||
| 409 | Ga0495630_0012740 | |||
| 410 | Ga0495630_0027455 | |||
| 411 | Ga0495630_0027987 | |||
| 412 | Ga0495666_0067955 | |||
| 413 | Ga0495652_0215371 | |||
| 414 | Ga0495640_0029652 | |||
| 415 | Ga0495640_0078072 | |||
| 416 | Ga0495586_0000040 | |||
| 417 | Ga0495586_0000348 | |||
| 418 | Ga0495586_0000548 | |||
| 419 | Ga0495586_0218234 | |||
| 420 | Ga0495645_0008072 | |||
| 421 | Ga0495645_0041238 | |||
| 422 | Ga0495622_0033752 | |||
| 423 | Ga0495667_0025781 | |||
| 424 | Ga0495634_0053868 | |||
| 425 | Ga0495634_0113823 | |||
| 426 | Ga0495635_0074856 | |||
| 427 | Ga0495657_0224190 | |||
| 428 | Ga0495599_0009385 | |||
| 429 | Ga0495647_0024491 | |||
| 430 | Ga0495647_0030847 | |||
| 431 | Ga0495658_0066699 | |||
| 432 | Ga0495658_0077211 | |||
| 433 | Ga0495613_0008133 | |||
| 434 | Ga0495613_0096341 | |||
| 435 | Ga0495624_0076878 | |||
| 436 | Ga0495581_0026721 | |||
| 437 | Ga0495674_0002615 | |||
| 438 | Ga0495674_0013832 | |||
| 439 | Ga0495674_0093892 | |||
| 440 | Ga0495674_0201492 | |||
| 441 | Ga0495676_0006224 | |||
| 442 | Ga0495676_0311681 | |||
| 443 | Ga0495680_0033867 | |||
| 444 | Ga0495675_0121405 | |||
| 445 | Ga0495675_0237722 | |||
| 446 | Ga0495684_0076775 | |||
| 447 | Ga0495684_0172883 | |||
| 448 | Ga0501031_0032938 | |||
| 449 | Ga0501032_0005152 | |||
| 450 | Ga0501033_0036884 | |||
| 451 | Ga0501033_0095320 | |||
| 452 | Ga0501034_0270022 | |||
| 453 | Ga0501034_0272003 | |||
| 454 | Ga0501036_0345504 | |||
| 455 | Ga0501037_0122566 | |||
| 456 | Ga0501038_0179930 | |||
| 457 | Ga0501043_0274592 | |||
| 458 | Ga0501047_0190745 | |||
| 459 | Ga0501047_0461920 | |||
| 460 | Ga0501070_0209785 | |||
| 461 | Ga0501080_0212767 | |||
| 462 | Ga0501035_0007978 | |||
| 463 | Ga0501035_0162951 | |||
| 464 | Ga0501044_0001072 | |||
| 465 | Ga0501044_0223893 | |||
| 466 | nmdc:mga0qj67_118511_c1 | |||
| 467 | nmdc:mga06r32_175208_c1 | |||
| 468 | nmdc:mga08y16_119658_c1 | |||
| 469 | nmdc:mga08y16_282754_c1 | |||
| 470 | nmdc:mga0n895_156693_c1 | |||
| 471 | nmdc:mga0n895_274989_c1 | |||
| 472 | Ga0500650_0055896 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wg8-assembly2.cif.gz_B | crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. | 0.9204 | 1 | 301 |
| 1n2x-assembly1.cif.gz_A | crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam | 0.9172 | 1 | 302 |
| 1n2x-assembly2.cif.gz_B | crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam | 0.9096 | 1 | 300 |
| 1n2x-assembly1.cif.gz_A | crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam | 0.9019 | 1 | 302 |
| 3tka-assembly1.cif.gz_A-2 | crystal structure and solution saxs of methyltransferase rsmh from e.coli | 0.8957 | 4 | 301 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tkaA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9671 | 104 | 204 | 1.10.150.170 |
| 1wg8B02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9588 | 103 | 205 | 1.10.150.170 |
| 1wg8B02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9495 | 103 | 205 | 1.10.150.170 |
| af_Q9VGY5_27_186_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9405 | 2 | 149 | 3.40.50.150 |
| 3tkaA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9386 | 104 | 204 | 1.10.150.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N6Q409-F1-model_v4 | 16S rRNA (Cytosine(1402)-N(4))-methyltransferase RsmH | 0.9831 | 2 | 234 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A355VG75-F1-model_v4 | deleted | 0.9605 | 2 | 234 |
|
| AF-A0A645CKM3-F1-model_v4 | Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) | 0.9577 | 118 | 241 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A2M8L4B4-F1-model_v4 | 16S rRNA (Cytosine(1402)-N(4))-methyltransferase | 0.957 | 1 | 232 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A2W4Z2A8-F1-model_v4 | 16S rRNA (Cytosine(1402)-N(4))-methyltransferase | 0.9561 | 2 | 243 |
GO:0005737
GO:0070475 GO:0071424 |