F348804

General Info

Members Datasets Scaffolds Average Seq Length
236 173 472 316

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100001590|Ga0070668_1000015906
Length 338
Sequence MHAAVCPEYGPPEVIRVEECPVPDAAPGQVGVRVRAAAVNFPDVLLVSNQYQLSVPPPFVPGSEFAGIVDEIGDETTGLAVGDRVTGTGMFGAFAERVVVDAASLAPIPDGVDAPSAAAFGVAHRTAYHTLRSTAQLKPGDELVVLGAGGGVGLAAVQLGVALGANVTAVASSAEKLDVAASYGASRLINVRRAGAERLGDQSSAVELRAELKRALPDGADVVIDPVGGELSEPALRSLRRGGQFVTVGYASGVIPRIPLNLVLVKGIHVIGFQFQDVPVAEFERNETELRELLVSGRVAPHVCATYPLSETATALRRVADGKAIGKVLIDLSGREEQ

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
50 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
84 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
85 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
89 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
90 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
91 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
92 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
104 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
105 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
120 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
121 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
122 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
123 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
147 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
148 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
149 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
150 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
158 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
159 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
160 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
163 2643221733 Bosea sp. Root381 Isolate Unclassified
164 2643221734 Bosea sp. Root670 Isolate Unclassified
165 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
166 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
167 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
168 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
169 2818991467 Bosea vestrisii 3192 Isolate Unclassified
170 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
171 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
172 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
173 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.92
Metatranscriptomes 0
Isolates 5.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.44
Nodule 0.85
Rhizoplane 12.29
Rhizosphere 67.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100001590 3300005347 Bacteria 16444
2 Ga0055526_1000443 3300003771 Bacteria 32967
3 Ga0055540_1000003 3300003792 Bacteria 428375
4 Ga0068869_100134925 3300005334 Bacteria 1901
5 Ga0070668_100078853 3300005347 Bacteria 2577
6 Ga0070669_100009922 3300005353 Bacteria 6781
7 Ga0070667_100000073 3300005367 Bacteria 122757
8 Ga0070667_100102840 3300005367 Bacteria 2469
9 Ga0070667_100110440 3300005367 Bacteria 2384
10 Ga0070714_100316726 3300005435 Bacteria 1458
11 Ga0070701_10048564 3300005438 Bacteria 2191
12 Ga0070711_100006028 3300005439 Bacteria 7279
13 Ga0070711_100369025 3300005439 Bacteria 1158
14 Ga0070678_100034873 3300005456 Bacteria 3508
15 Ga0070685_10101094 3300005466 Bacteria 1761
16 Ga0070685_10230125 3300005466 Bacteria 1219
17 Ga0068853_100066371 3300005539 Bacteria 3133
18 Ga0070686_100112719 3300005544 Bacteria 1855
19 Ga0070665_100552386 3300005548 Bacteria 1164
20 Ga0070704_100239641 3300005549 Bacteria 1484
21 Ga0068854_100173808 3300005578 Bacteria 1678
22 Ga0068863_100000587 3300005841 Bacteria 37032
23 Ga0068863_100013268 3300005841 Bacteria 7949
24 Ga0068863_100130882 3300005841 Bacteria 2396
25 Ga0068860_100000127 3300005843 Bacteria 122766
26 Ga0068860_100108339 3300005843 Bacteria 2655
27 Ga0068862_100000052 3300005844 Bacteria 144622
28 Ga0068862_100048895 3300005844 Bacteria 3611
29 Ga0068862_100356383 3300005844 Bacteria 1359
30 Ga0081455_10177534 3300005937 Bacteria 1616
31 Ga0081538_10050562 3300005981 Bacteria 2508
32 Ga0075365_10002445 3300006038 Bacteria 9113
33 Ga0075363_100028499 3300006048 Bacteria 2873
34 Ga0075363_100031146 3300006048 Bacteria 2764
35 Ga0075364_10060357 3300006051 Bacteria 2487
36 Ga0070715_10008193 3300006163 Bacteria 3633
37 Ga0070716_100008130 3300006173 Bacteria 5195
38 Ga0070712_100007083 3300006175 Bacteria 6994
39 Ga0075367_10031586 3300006178 Bacteria 3041
40 Ga0075369_10000123 3300006186 Bacteria 21454
41 Ga0075369_10064422 3300006186 Bacteria 1605
42 Ga0075370_10012984 3300006353 Bacteria 4418
43 Ga0075370_10018856 3300006353 Bacteria 3746
44 Ga0075428_100014373 3300006844 Bacteria 8799
45 Ga0075430_100055355 3300006846 Bacteria 3336
46 Ga0075433_10013506 3300006852 Bacteria 6642
47 Ga0068865_100088957 3300006881 Bacteria 2235
48 Ga0075435_100077985 3300007076 Bacteria 2716
49 Ga0111539_10079939 3300009094 Bacteria 3846
50 Ga0105245_10245714 3300009098 Bacteria 1737
51 Ga0105247_10000066 3300009101 Bacteria 121025
52 Ga0105243_10037091 3300009148 Bacteria 3786
53 Ga0105248_10000613 3300009177 Bacteria 40714
54 Ga0105248_10072210 3300009177 Bacteria 3879
55 Ga0105237_10007887 3300009545 Bacteria 11604
56 Ga0105239_10009613 3300010375 Bacteria 10879
57 Ga0105239_10761211 3300010375 Bacteria 1109
58 Ga0171462_1039 3300013250 Bacteria 76960
59 Ga0157378_10054456 3300013297 Bacteria 3562
60 Ga0163162_10318431 3300013306 Bacteria 1688
61 Ga0157375_10117112 3300013308 Bacteria 2769
62 Ga0163163_10302314 3300014325 Bacteria 1652
63 Ga0163161_10252910 3300017792 Bacteria 1374
64 Ga0213874_10026794 3300021377 Bacteria 1635
65 Ga0209564_1000790 3300025295 Bacteria 43638
66 Ga0209256_1000695 3300025299 Bacteria 44756
67 Ga0209051_1000011 3300025303 Bacteria 610828
68 Ga0207692_10096939 3300025898 Bacteria 1611
69 Ga0207642_10217234 3300025899 Bacteria 1066
70 Ga0207710_10000090 3300025900 Bacteria 121405
71 Ga0207671_10008254 3300025914 Bacteria 8861
72 Ga0207693_10002021 3300025915 Bacteria 17803
73 Ga0207663_10011223 3300025916 Bacteria 4804
74 Ga0207681_10011726 3300025923 Bacteria 5389
75 Ga0207644_10148241 3300025931 Bacteria 1813
76 Ga0207706_10013287 3300025933 Bacteria 7490
77 Ga0207706_10451417 3300025933 Bacteria 1112
78 Ga0207669_10058474 3300025937 Bacteria 2352
79 Ga0207704_10130683 3300025938 Bacteria 1738
80 Ga0207665_10006936 3300025939 Bacteria 7495
81 Ga0207711_10000183 3300025941 Bacteria 67270
82 Ga0207689_10482209 3300025942 Bacteria 1038
83 Ga0207668_10000898 3300025972 Bacteria 17980
84 Ga0207658_10000557 3300025986 Bacteria 33829
85 Ga0207658_10033895 3300025986 Bacteria 3645
86 Ga0207658_10112939 3300025986 Bacteria 2151
87 Ga0207703_10037733 3300026035 Bacteria 3851
88 Ga0207639_10161516 3300026041 Bacteria 1888
89 Ga0207708_10033442 3300026075 Bacteria 3906
90 Ga0207641_10003420 3300026088 Bacteria 14062
91 Ga0207641_10011423 3300026088 Bacteria 7289
92 Ga0207641_10034161 3300026088 Bacteria 4229
93 Ga0207648_10086743 3300026089 Bacteria 2731
94 Ga0207683_10023409 3300026121 Bacteria 5313
95 Ga0268266_10015259 3300028379 Bacteria 6593
96 Ga0268265_10000063 3300028380 Bacteria 144643
97 Ga0268264_10000007 3300028381 Bacteria 815790
98 Ga0307512_10022800 3300030522 Bacteria 5613
99 Ga0265327_10002277 3300031251 Bacteria 20626
100 Ga0265327_10020237 3300031251 Bacteria 4061
101 Ga0307413_10137024 3300031824 Bacteria 1685
102 Ga0307518_10026127 3300031838 Bacteria 4214
103 Ga0307409_100042650 3300031995 Bacteria 3400
104 Ga0373931_0069117 3300035691 Bacteria 1924
105 Ga0316582_0055949 3300036647 Bacteria 2516
106 Ga0316584_0100239 3300036712 Bacteria 2169
107 Ga0436365_0024425 3300039437 Bacteria 1356
108 Ga0436363_0837872 3300039450 Bacteria 3700
109 Ga0439466_0017879 3300041411 Bacteria 2549
110 Ga0439465_0003391 3300041413 Bacteria 5198
111 Ga0439465_0004789 3300041413 Bacteria 4354
112 Ga0439448_0024396 3300042005 Bacteria 1891
113 Ga0466972_0011984 3300044658 Bacteria 4356
114 Ga0466972_0049310 3300044658 Bacteria 2034
115 Ga0466965_0002253 3300044683 Bacteria 8126
116 Ga0466965_0053074 3300044683 Bacteria 2014
117 Ga0466970_0007871 3300044765 Bacteria 5350
118 Ga0466970_0012474 3300044765 Bacteria 4346
119 Ga0466970_0086935 3300044765 Bacteria 1695
120 Ga0466957_0005041 3300044842 Bacteria 7393
121 Ga0466957_0059471 3300044842 Bacteria 2342
122 Ga0466957_0080809 3300044842 Bacteria 2024
123 Ga0466960_0014952 3300044901 Bacteria 3336
124 Ga0466959_0023702 3300045049 Bacteria 4542
125 Ga0466958_0008480 3300045836 Bacteria 5705
126 Ga0466967_0012092 3300045976 Bacteria 6583
127 Ga0466967_0016978 3300045976 Bacteria 5759
128 Ga0466967_0038704 3300045976 Bacteria 4092
129 Ga0466967_0069449 3300045976 Bacteria 3149
130 Ga0466967_0125787 3300045976 Bacteria 2374
131 Ga0466967_0431060 3300045976 Bacteria 1286
132 Ga0495629_0034909 3300046459 Bacteria 3555
133 Ga0495638_0003048 3300046460 Bacteria 13344
134 Ga0495641_0034770 3300046461 Bacteria 2380
135 Ga0495606_0009524 3300046507 Bacteria 8205
136 Ga0495665_0014113 3300046531 Bacteria 4313
137 Ga0495635_0146898 3300046663 Bacteria 1605
138 Ga0495581_0070065 3300047315 Bacteria 2028
139 Ga0495674_0177308 3300047319 Bacteria 1775
140 Ga0496100_0003116 3300048903 Bacteria 8582
141 Ga0496100_0030767 3300048903 Bacteria 3332
142 Ga0496101_0001592 3300048904 Bacteria 13630
143 Ga0496101_0006113 3300048904 Bacteria 7731
144 Ga0496101_0146717 3300048904 Bacteria 1802
145 Ga0496101_0193760 3300048904 Bacteria 1569
146 Ga0496102_0000168 3300048905 Bacteria 88511
147 Ga0496102_0011520 3300048905 Bacteria 7627
148 Ga0496102_0207210 3300048905 Bacteria 1848
149 Ga0496103_0136874 3300048906 Bacteria 1565
150 Ga0496103_0207198 3300048906 Bacteria 1261
151 Ga0496104_0056949 3300048907 Bacteria 3699
152 Ga0496104_0057752 3300048907 Bacteria 3672
153 Ga0496104_0370046 3300048907 Bacteria 1346
154 Ga0496105_0040945 3300048908 Bacteria 3819
155 Ga0496105_0074490 3300048908 Bacteria 2804
156 Ga0496106_0028115 3300048909 Bacteria 4188
157 Ga0496107_0008002 3300048910 Bacteria 7298
158 Ga0496107_0078596 3300048910 Bacteria 2404
159 Ga0496108_0166636 3300048911 Bacteria 1905
160 Ga0496109_0022608 3300048912 Bacteria 5570
161 Ga0496109_0092225 3300048912 Bacteria 2802
162 Ga0496109_0147921 3300048912 Bacteria 2198
163 Ga0496112_0002081 3300048915 Bacteria 15862
164 Ga0496112_0016687 3300048915 Bacteria 6885
165 Ga0496112_0075892 3300048915 Bacteria 3324
166 Ga0496112_0152171 3300048915 Bacteria 2281
167 Ga0496114_0009189 3300048917 Bacteria 7838
168 Ga0496115_0012636 3300048918 Bacteria 6362
169 Ga0496117_0001651 3300048920 Bacteria 31339
170 Ga0496118_0025580 3300048921 Bacteria 5054
171 Ga0496119_0006054 3300048922 Bacteria 11342
172 Ga0496120_0012132 3300048923 Bacteria 5880
173 Ga0496121_0021577 3300048924 Bacteria 6300
174 Ga0496126_0010496 3300048929 Bacteria 9700
175 Ga0501032_0001749 3300049569 Bacteria 17137
176 Ga0501034_0000806 3300049571 Bacteria 46584
177 Ga0501037_0000677 3300049573 Bacteria 26104
178 Ga0501038_0001664 3300049574 Bacteria 20619
179 Ga0501039_0000157 3300049575 Bacteria 46924
180 Ga0501043_0002124 3300049579 Bacteria 16916
181 Ga0501067_0010588 3300049583 Bacteria 5103
182 Ga0501068_0006602 3300049584 Bacteria 6401
183 Ga0501068_0069917 3300049584 Bacteria 2141
184 Ga0501069_0014154 3300049585 Bacteria 4259
185 Ga0501070_0001412 3300049586 Bacteria 21509
186 Ga0501070_0016480 3300049586 Bacteria 6209
187 Ga0501072_0081336 3300049588 Bacteria 2567
188 Ga0501073_0000790 3300049589 Bacteria 22536
189 Ga0501073_0003297 3300049589 Bacteria 12127
190 Ga0501073_0017910 3300049589 Bacteria 5125
191 Ga0501073_0121508 3300049589 Bacteria 1810
192 Ga0501074_0001020 3300049590 Bacteria 18229
193 Ga0501074_0006824 3300049590 Bacteria 8249
194 Ga0501076_0151563 3300049592 Bacteria 1886
195 Ga0501079_0000615 3300049741 Bacteria 23598
196 Ga0501080_0000573 3300049742 Bacteria 29140
197 Ga0501080_0001976 3300049742 Bacteria 17683
198 Ga0501080_0254608 3300049742 Bacteria 1600
199 Ga0501083_0001107 3300049744 Bacteria 18047
200 Ga0501035_0209397 3300049822 Bacteria 1669
201 Ga0501044_0022954 3300049823 Bacteria 6642
202 Ga0501044_0143936 3300049823 Bacteria 2371
203 Ga0501045_0158416 3300049824 Bacteria 1685
204 nmdc:mga03683_101534_c1 3300050489 Bacteria 1264
205 nmdc:mga03n38_125393_c1 3300050490 Bacteria 1267
206 nmdc:mga03n38_17802_c1 3300050490 Bacteria 2790
207 nmdc:mga03n38_3797_c1 3300050490 Bacteria 4905
208 nmdc:mga00v17_67305_c1 3300050491 Bacteria 2213
209 nmdc:mga00v17_90594_c1 3300050491 Bacteria 1920
210 nmdc:mga06z11_126818_c1 3300050494 Bacteria 1429
211 nmdc:mga07m45_37226_c1 3300050496 Bacteria 2713
212 nmdc:mga05p37_2049_c2 3300050507 Bacteria 4685
213 nmdc:mga0qj67_75179_c1 3300050509 Bacteria 2700
214 nmdc:mga06r32_97953_c1 3300050510 Bacteria 2874
215 nmdc:mga08y16_504475_c1 3300050511 Bacteria 1229
216 nmdc:mga0rr50_7711_c1 3300050513 Bacteria 3518
217 nmdc:mga0a205_42761_c1 3300050515 Bacteria 4366
218 nmdc:mga0sz30_21797_c1 3300050516 Bacteria 2596
219 nmdc:mga0sz30_41351_c1 3300050516 Bacteria 1937
220 nmdc:mga0sz30_752_c1 3300050516 Bacteria 11830
221 Ga0500610_0000510 3300053079 Bacteria 11977
222 Ga0495619_0207344 3300053085 Bacteria 1357
223 Ga0500643_001888 3300053087 Bacteria 11388
224 Ga0501084_0009774 3300054114 Bacteria 7931
225 2523382954 2523231044 Bacteria 6434991
226 2644731013 2643221733 Bacteria 5690728
227 2644734675 2643221734 Bacteria 5365412
228 2738666946 2738541264 Bacteria 5935393
229 2738891589 2738541308 Bacteria 7020677
230 2739145790 2738541356 Bacteria 5935017
231 2744954431 2744054611 Bacteria 5611514
232 2819722209 2818991467 Bacteria 5893227
233 2841912534 2841911363 Bacteria 6173697
234 2841918289 2841917233 Bacteria 6173500
235 2917703086 2917699015 Bacteria 7043791
236 2929216781 2929212328 Bacteria 7708288
237 Ga0070668_100001590
238 Ga0055526_1000443
239 Ga0055540_1000003
240 Ga0068869_100134925
241 Ga0070668_100078853
242 Ga0070669_100009922
243 Ga0070667_100000073
244 Ga0070667_100102840
245 Ga0070667_100110440
246 Ga0070714_100316726
247 Ga0070701_10048564
248 Ga0070711_100006028
249 Ga0070711_100369025
250 Ga0070678_100034873
251 Ga0070685_10101094
252 Ga0070685_10230125
253 Ga0068853_100066371
254 Ga0070686_100112719
255 Ga0070665_100552386
256 Ga0070704_100239641
257 Ga0068854_100173808
258 Ga0068863_100000587
259 Ga0068863_100013268
260 Ga0068863_100130882
261 Ga0068860_100000127
262 Ga0068860_100108339
263 Ga0068862_100000052
264 Ga0068862_100048895
265 Ga0068862_100356383
266 Ga0081455_10177534
267 Ga0081538_10050562
268 Ga0075365_10002445
269 Ga0075363_100028499
270 Ga0075363_100031146
271 Ga0075364_10060357
272 Ga0070715_10008193
273 Ga0070716_100008130
274 Ga0070712_100007083
275 Ga0075367_10031586
276 Ga0075369_10000123
277 Ga0075369_10064422
278 Ga0075370_10012984
279 Ga0075370_10018856
280 Ga0075428_100014373
281 Ga0075430_100055355
282 Ga0075433_10013506
283 Ga0068865_100088957
284 Ga0075435_100077985
285 Ga0111539_10079939
286 Ga0105245_10245714
287 Ga0105247_10000066
288 Ga0105243_10037091
289 Ga0105248_10000613
290 Ga0105248_10072210
291 Ga0105237_10007887
292 Ga0105239_10009613
293 Ga0105239_10761211
294 Ga0171462_1039
295 Ga0157378_10054456
296 Ga0163162_10318431
297 Ga0157375_10117112
298 Ga0163163_10302314
299 Ga0163161_10252910
300 Ga0213874_10026794
301 Ga0209564_1000790
302 Ga0209256_1000695
303 Ga0209051_1000011
304 Ga0207692_10096939
305 Ga0207642_10217234
306 Ga0207710_10000090
307 Ga0207671_10008254
308 Ga0207693_10002021
309 Ga0207663_10011223
310 Ga0207681_10011726
311 Ga0207644_10148241
312 Ga0207706_10013287
313 Ga0207706_10451417
314 Ga0207669_10058474
315 Ga0207704_10130683
316 Ga0207665_10006936
317 Ga0207711_10000183
318 Ga0207689_10482209
319 Ga0207668_10000898
320 Ga0207658_10000557
321 Ga0207658_10033895
322 Ga0207658_10112939
323 Ga0207703_10037733
324 Ga0207639_10161516
325 Ga0207708_10033442
326 Ga0207641_10003420
327 Ga0207641_10011423
328 Ga0207641_10034161
329 Ga0207648_10086743
330 Ga0207683_10023409
331 Ga0268266_10015259
332 Ga0268265_10000063
333 Ga0268264_10000007
334 Ga0307512_10022800
335 Ga0265327_10002277
336 Ga0265327_10020237
337 Ga0307413_10137024
338 Ga0307518_10026127
339 Ga0307409_100042650
340 Ga0373931_0069117
341 Ga0316582_0055949
342 Ga0316584_0100239
343 Ga0436365_0024425
344 Ga0436363_0837872
345 Ga0439466_0017879
346 Ga0439465_0003391
347 Ga0439465_0004789
348 Ga0439448_0024396
349 Ga0466972_0011984
350 Ga0466972_0049310
351 Ga0466965_0002253
352 Ga0466965_0053074
353 Ga0466970_0007871
354 Ga0466970_0012474
355 Ga0466970_0086935
356 Ga0466957_0005041
357 Ga0466957_0059471
358 Ga0466957_0080809
359 Ga0466960_0014952
360 Ga0466959_0023702
361 Ga0466958_0008480
362 Ga0466967_0012092
363 Ga0466967_0016978
364 Ga0466967_0038704
365 Ga0466967_0069449
366 Ga0466967_0125787
367 Ga0466967_0431060
368 Ga0495629_0034909
369 Ga0495638_0003048
370 Ga0495641_0034770
371 Ga0495606_0009524
372 Ga0495665_0014113
373 Ga0495635_0146898
374 Ga0495581_0070065
375 Ga0495674_0177308
376 Ga0496100_0003116
377 Ga0496100_0030767
378 Ga0496101_0001592
379 Ga0496101_0006113
380 Ga0496101_0146717
381 Ga0496101_0193760
382 Ga0496102_0000168
383 Ga0496102_0011520
384 Ga0496102_0207210
385 Ga0496103_0136874
386 Ga0496103_0207198
387 Ga0496104_0056949
388 Ga0496104_0057752
389 Ga0496104_0370046
390 Ga0496105_0040945
391 Ga0496105_0074490
392 Ga0496106_0028115
393 Ga0496107_0008002
394 Ga0496107_0078596
395 Ga0496108_0166636
396 Ga0496109_0022608
397 Ga0496109_0092225
398 Ga0496109_0147921
399 Ga0496112_0002081
400 Ga0496112_0016687
401 Ga0496112_0075892
402 Ga0496112_0152171
403 Ga0496114_0009189
404 Ga0496115_0012636
405 Ga0496117_0001651
406 Ga0496118_0025580
407 Ga0496119_0006054
408 Ga0496120_0012132
409 Ga0496121_0021577
410 Ga0496126_0010496
411 Ga0501032_0001749
412 Ga0501034_0000806
413 Ga0501037_0000677
414 Ga0501038_0001664
415 Ga0501039_0000157
416 Ga0501043_0002124
417 Ga0501067_0010588
418 Ga0501068_0006602
419 Ga0501068_0069917
420 Ga0501069_0014154
421 Ga0501070_0001412
422 Ga0501070_0016480
423 Ga0501072_0081336
424 Ga0501073_0000790
425 Ga0501073_0003297
426 Ga0501073_0017910
427 Ga0501073_0121508
428 Ga0501074_0001020
429 Ga0501074_0006824
430 Ga0501076_0151563
431 Ga0501079_0000615
432 Ga0501080_0000573
433 Ga0501080_0001976
434 Ga0501080_0254608
435 Ga0501083_0001107
436 Ga0501035_0209397
437 Ga0501044_0022954
438 Ga0501044_0143936
439 Ga0501045_0158416
440 nmdc:mga03683_101534_c1
441 nmdc:mga03n38_125393_c1
442 nmdc:mga03n38_17802_c1
443 nmdc:mga03n38_3797_c1
444 nmdc:mga00v17_67305_c1
445 nmdc:mga00v17_90594_c1
446 nmdc:mga06z11_126818_c1
447 nmdc:mga07m45_37226_c1
448 nmdc:mga05p37_2049_c2
449 nmdc:mga0qj67_75179_c1
450 nmdc:mga06r32_97953_c1
451 nmdc:mga08y16_504475_c1
452 nmdc:mga0rr50_7711_c1
453 nmdc:mga0a205_42761_c1
454 nmdc:mga0sz30_21797_c1
455 nmdc:mga0sz30_41351_c1
456 nmdc:mga0sz30_752_c1
457 Ga0500610_0000510
458 Ga0495619_0207344
459 Ga0500643_001888
460 Ga0501084_0009774
461 2523382954
462 2644731013
463 2644734675
464 2738666946
465 2738891589
466 2739145790
467 2744954431
468 2819722209
469 2841912534
470 2841918289
471 2917703086
472 2929216781

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

26

110

0.94

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

151

293

0.88

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

183

330

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qor-assembly1.cif.gz_B crystal structure of escherichia coli quinone oxidoreductase complexed with nadph 0.9195 1 315
2j8z-assembly1.cif.gz_A-2 crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) 0.9188 1 315
4rvu-assembly2.cif.gz_C the native structure of mycobacterial rv1454c complexed with nadph 0.9182 1 315
1qor-assembly1.cif.gz_B crystal structure of escherichia coli quinone oxidoreductase complexed with nadph 0.9168 1 315
2j8z-assembly1.cif.gz_A-2 crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) 0.916 1 315
ID Description Score Start End Superfamily
af_Q3UNZ8_155_284_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.965 123 249 3.40.50.720
af_B0BNC9_26_350_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9642 2 314 3.90.180.10
af_A0A0P0WKK9_27_127_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9593 23 117 3.90.180.10
af_Q9LXZ4_3_339_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9582 3 315 3.90.180.10
af_B0BNC9_147_315_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9559 115 280 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7S1KWJ0-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9797 28 224 GO:0016491
AF-A0A2A4AT29-F1-model_v4 deleted 0.9731 1 315
AF-A0A7S1EK51-F1-model_v4 Alcohol dehydrogenase-like C-terminal domain-containing protein 0.9705 146 247 GO:0016491
AF-A0A2A4AT29-F1-model_v4 deleted 0.97 1 315
AF-A0A1D2TP49-F1-model_v4 deleted 0.9694 1 315

Map