F348725

General Info

Members Datasets Scaffolds Average Seq Length
236 149 231 212

Family's Representative Sequence

Representative Sequence 3300005262|Ga0065165_1002690|Ga0065165_10026906
Length 257
Sequence MAWAWNRRWSACRSKEVKNWPGFGNGPELSHPTPTPPLVVDPYHFGTLNMNRRDFSAQLVGASLGTLALSTSTGALAQGAAPVEGTNYVKFAQPVSPATPGKIEVVEFFWYGCPHCNAFEPALDAWQKKLPADVVFRRVPVAFRDEPFVAHQKIFYALESMGKVEANEHARLDKPDEIAAFMAKNGIDSAKFLEAYNSFSTQTKTKQAAKLAEGYKLDGVPALGINGRYFTSGSLAGTNERMLQVTDFLIQKSRTGG

Samples

Sample ID Description Type Environment
1 2721755523 Delftia sp. HK171 Isolate Unclassified
2 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
3 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
4 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
5 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
75 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
132 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
139 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
140 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
143 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
144 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
145 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
149 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.88
Metatranscriptomes 0
Isolates 2.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.22
Nodule 1.27
Rhizoplane 0.42
Rhizosphere 75.42
Stem 0
Stem Tuber 0
Unclassified 4.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24033J26618_1019738 3300002155 Bacteria 856
2 JGI25152J39213_1003735 3300002773 Bacteria 5091
3 JGI25153J46596_10001928 3300003215 Bacteria 12323
4 rootH1_10017780 3300003316 Bacteria 3394
5 rootL2_10053328 3300003322 Bacteria 3481
6 rootH1_10100316 3300003323 Bacteria 2799
7 Ga0055526_1000632 3300003771 Bacteria 27319
8 Ga0055530_10003372 3300003791 Bacteria 9140
9 Ga0065165_1002690 3300005262 Bacteria 14310
10 Ga0065704_10125718 3300005289 Bacteria 1699
11 Ga0065704_10128151 3300005289 Bacteria 1648
12 Ga0065704_10139762 3300005289 Bacteria 1530
13 Ga0070658_10036933 3300005327 Bacteria 3937
14 Ga0070658_10480084 3300005327 Bacteria 1073
15 Ga0070676_10013481 3300005328 Bacteria 4478
16 Ga0070676_10106484 3300005328 Bacteria 1740
17 Ga0070690_100014007 3300005330 Bacteria 4753
18 Ga0070690_100656983 3300005330 Bacteria 801
19 Ga0070670_100021965 3300005331 Bacteria 5491
20 Ga0070670_100313939 3300005331 Unclassified 1372
21 Ga0070677_10009367 3300005333 Bacteria 3318
22 Ga0068869_100315425 3300005334 Bacteria 1266
23 Ga0070666_10055686 3300005335 Bacteria 2670
24 Ga0070680_100007042 3300005336 Bacteria 8572
25 Ga0068868_100106648 3300005338 Bacteria 2273
26 Ga0070661_100651862 3300005344 Bacteria 855
27 Ga0070675_100035451 3300005354 Bacteria 4054
28 Ga0070671_100009624 3300005355 Bacteria 7763
29 Ga0070674_100020297 3300005356 Bacteria 4241
30 Ga0070674_100026525 3300005356 Bacteria 3786
31 Ga0070674_100039748 3300005356 Bacteria 3178
32 Ga0070673_100008259 3300005364 Bacteria 6914
33 Ga0070673_100249649 3300005364 Bacteria 1546
34 Ga0070673_100711436 3300005364 Bacteria 923
35 Ga0070659_100945332 3300005366 Bacteria 755
36 Ga0070667_100342753 3300005367 Bacteria 1352
37 Ga0070667_100705159 3300005367 Bacteria 934
38 Ga0070663_100181041 3300005455 Bacteria 1635
39 Ga0070663_100272393 3300005455 Bacteria 1346
40 Ga0070678_100045802 3300005456 Bacteria 3131
41 Ga0070678_100187700 3300005456 Bacteria 1697
42 Ga0070662_100004630 3300005457 Bacteria 8716
43 Ga0068867_100008087 3300005459 Bacteria 7432
44 Ga0068867_100012740 3300005459 Bacteria 5950
45 Ga0068867_100081663 3300005459 Bacteria 2437
46 Ga0068867_100084990 3300005459 Bacteria 2392
47 Ga0068867_100096160 3300005459 Bacteria 2255
48 Ga0068867_100116631 3300005459 Bacteria 2058
49 Ga0070672_100006382 3300005543 Bacteria 7921
50 Ga0070672_100018038 3300005543 Bacteria 5094
51 Ga0070672_100030401 3300005543 Bacteria 4057
52 Ga0070672_100484675 3300005543 Bacteria 1068
53 Ga0068855_100075191 3300005563 Bacteria 3923
54 Ga0068854_100495828 3300005578 Bacteria 1028
55 Ga0068856_100063015 3300005614 Bacteria 3663
56 Ga0068856_100254230 3300005614 Bacteria 1772
57 Ga0068852_100086137 3300005616 Bacteria 2800
58 Ga0068852_100123169 3300005616 Bacteria 2377
59 Ga0068852_100156774 3300005616 Bacteria 2122
60 Ga0068852_100248260 3300005616 Bacteria 1704
61 Ga0068859_100579283 3300005617 Bacteria 1216
62 Ga0068864_100111655 3300005618 Bacteria 2435
63 Ga0068866_10004621 3300005718 Bacteria 5645
64 Ga0068861_100001794 3300005719 Bacteria 13819
65 Ga0068861_100036729 3300005719 Bacteria 3638
66 Ga0068861_100160824 3300005719 Bacteria 1852
67 Ga0068860_100000889 3300005843 Bacteria 33171
68 Ga0075363_100234727 3300006048 Bacteria 1053
69 Ga0075364_10062391 3300006051 Bacteria 2445
70 Ga0075362_10011114 3300006177 Bacteria 3539
71 Ga0075362_10038776 3300006177 Bacteria 2093
72 Ga0075362_10047422 3300006177 Bacteria 1914
73 Ga0075367_10007250 3300006178 Bacteria 5668
74 Ga0075367_10219915 3300006178 Bacteria 1188
75 Ga0075369_10063222 3300006186 Bacteria 1619
76 Ga0075366_10003670 3300006195 Bacteria 8140
77 Ga0075366_10011254 3300006195 Bacteria 5049
78 Ga0075366_10022066 3300006195 Bacteria 3702
79 Ga0075366_10067263 3300006195 Bacteria 2132
80 Ga0075366_10071820 3300006195 Bacteria 2062
81 Ga0075366_10102634 3300006195 Bacteria 1717
82 Ga0075366_10146219 3300006195 Bacteria 1430
83 Ga0075366_10299968 3300006195 Bacteria 983
84 Ga0097621_100257283 3300006237 Bacteria 1530
85 Ga0075370_10001175 3300006353 Bacteria 11030
86 Ga0075370_10007940 3300006353 Bacteria 5435
87 Ga0075370_10028289 3300006353 Bacteria 3115
88 Ga0068871_100152227 3300006358 Bacteria 1973
89 Ga0068871_100201675 3300006358 Bacteria 1718
90 Ga0068865_100007032 3300006881 Bacteria 6907
91 Ga0097620_100579210 3300006931 Bacteria 1216
92 Ga0079104_1000483 3300006946 Bacteria 44070
93 Ga0105250_10000703 3300009092 Bacteria 20648
94 Ga0105240_10197792 3300009093 Bacteria 2358
95 Ga0105245_10084182 3300009098 Bacteria 2913
96 Ga0105243_10005607 3300009148 Bacteria 9780
97 Ga0105243_10011063 3300009148 Bacteria 6825
98 Ga0105243_10048349 3300009148 Bacteria 3353
99 Ga0105243_10271226 3300009148 Bacteria 1524
100 Ga0105242_10000840 3300009176 Bacteria 23932
101 Ga0105237_10035752 3300009545 Bacteria 5025
102 Ga0105238_10249948 3300009551 Bacteria 1751
103 Ga0105249_10002111 3300009553 Bacteria 17255
104 Ga0105249_10197276 3300009553 Bacteria 1968
105 Ga0105239_10115079 3300010375 Bacteria 2983
106 Ga0105246_10324487 3300011119 Bacteria 1252
107 Ga0157378_10015558 3300013297 Bacteria 6662
108 Ga0157378_10188760 3300013297 Bacteria 1943
109 Ga0157378_10708738 3300013297 Bacteria 1026
110 Ga0163162_10013321 3300013306 Bacteria 8032
111 Ga0157375_10013930 3300013308 Bacteria 7170
112 Ga0157380_10015039 3300014326 Bacteria 5678
113 Ga0157380_10126621 3300014326 Bacteria 2172
114 Ga0157379_10004464 3300014968 Bacteria 12002
115 Ga0157379_10080250 3300014968 Bacteria 2923
116 Ga0163161_10015099 3300017792 Bacteria 5385
117 Ga0163161_10043549 3300017792 Bacteria 3232
118 Ga0207425_1000749 3300025245 Bacteria 16859
119 Ga0209129_1000038 3300025258 Bacteria 322778
120 Ga0209673_1004769 3300025273 Bacteria 7127
121 Ga0209564_1000162 3300025295 Bacteria 162265
122 Ga0209758_1000152 3300025297 Bacteria 162418
123 Ga0209050_1000634 3300025298 Bacteria 54624
124 Ga0209256_1034532 3300025299 Bacteria 1344
125 Ga0209051_1016653 3300025303 Bacteria 3313
126 Ga0207697_10019423 3300025315 Bacteria 2783
127 Ga0207696_1000741 3300025711 Bacteria 21824
128 Ga0207682_10001873 3300025893 Bacteria 9585
129 Ga0207682_10047065 3300025893 Bacteria 1774
130 Ga0207642_10003671 3300025899 Bacteria 4875
131 Ga0207645_10007024 3300025907 Bacteria 8017
132 Ga0207645_10120263 3300025907 Bacteria 1705
133 Ga0207643_10191716 3300025908 Bacteria 1241
134 Ga0207695_10021643 3300025913 Bacteria 7330
135 Ga0207671_10173383 3300025914 Bacteria 1676
136 Ga0207650_10001746 3300025925 Bacteria 15447
137 Ga0207650_10298304 3300025925 Unclassified 1316
138 Ga0207659_10101987 3300025926 Bacteria 2165
139 Ga0207687_10322232 3300025927 Bacteria 1251
140 Ga0207690_10131893 3300025932 Bacteria 1830
141 Ga0207706_10013433 3300025933 Bacteria 7441
142 Ga0207686_10002931 3300025934 Bacteria 9191
143 Ga0207709_10000186 3300025935 Bacteria 83013
144 Ga0207709_10030521 3300025935 Bacteria 3136
145 Ga0207709_10169735 3300025935 Bacteria 1530
146 Ga0207709_10774682 3300025935 Bacteria 773
147 Ga0207669_10020555 3300025937 Bacteria 3466
148 Ga0207669_10131095 3300025937 Bacteria 1723
149 Ga0207669_10134410 3300025937 Bacteria 1705
150 Ga0207704_10008035 3300025938 Bacteria 5019
151 Ga0207704_10159721 3300025938 Bacteria 1602
152 Ga0207691_10035068 3300025940 Bacteria 4661
153 Ga0207691_10087011 3300025940 Bacteria 2803
154 Ga0207691_10383522 3300025940 Bacteria 1200
155 Ga0207689_10314649 3300025942 Bacteria 1299
156 Ga0207651_10009097 3300025960 Bacteria 5408
157 Ga0207651_10130528 3300025960 Bacteria 1923
158 Ga0207712_10027304 3300025961 Bacteria 3810
159 Ga0207712_10129910 3300025961 Bacteria 1918
160 Ga0207712_10348986 3300025961 Bacteria 1229
161 Ga0207658_10112021 3300025986 Bacteria 2159
162 Ga0207658_10298230 3300025986 Bacteria 1388
163 Ga0207658_10307861 3300025986 Bacteria 1367
164 Ga0207677_10260574 3300026023 Bacteria 1413
165 Ga0207703_10271813 3300026035 Bacteria 1536
166 Ga0207678_10103785 3300026067 Bacteria 2426
167 Ga0207678_10269860 3300026067 Bacteria 1459
168 Ga0207648_10001750 3300026089 Bacteria 23773
169 Ga0207648_10004729 3300026089 Bacteria 13905
170 Ga0207648_10004934 3300026089 Bacteria 13576
171 Ga0207648_10072018 3300026089 Bacteria 3012
172 Ga0207648_10101384 3300026089 Bacteria 2523
173 Ga0207648_10160293 3300026089 Bacteria 1987
174 Ga0207676_10126600 3300026095 Bacteria 2164
175 Ga0207674_10137006 3300026116 Bacteria 2409
176 Ga0207675_100001573 3300026118 Bacteria 22817
177 Ga0207675_100185887 3300026118 Bacteria 1992
178 Ga0207683_10116354 3300026121 Bacteria 2397
179 Ga0207683_10191617 3300026121 Bacteria 1856
180 Ga0207683_10228253 3300026121 Bacteria 1697
181 Ga0207698_10065771 3300026142 Bacteria 2850
182 Ga0207698_10139510 3300026142 Bacteria 2086
183 Ga0207698_10180147 3300026142 Bacteria 1871
184 Ga0209281_1000002 3300027111 Bacteria 1924012
185 Ga0268265_10003776 3300028380 Bacteria 10745
186 Ga0268265_10027756 3300028380 Bacteria 4044
187 Ga0268264_10002840 3300028381 Bacteria 15112
188 Ga0307509_10054860 3300031507 Bacteria 4240
189 Ga0307516_10001791 3300031730 Bacteria 29495
190 Ga0307405_10002184 3300031731 Bacteria 8547
191 Ga0307413_10397707 3300031824 Bacteria 1078
192 Ga0307410_10081270 3300031852 Bacteria 2276
193 Ga0307406_10049181 3300031901 Bacteria 2667
194 Ga0307407_10177247 3300031903 Bacteria 1409
195 Ga0307412_10005771 3300031911 Bacteria 6961
196 Ga0307409_100007478 3300031995 Bacteria 6539
197 Ga0307409_100759147 3300031995 Unclassified 974
198 Ga0307414_10099903 3300032004 Bacteria 2181
199 Ga0307411_10004570 3300032005 Bacteria 6653
200 Ga0373939_0093459 3300035114 Bacteria 1020
201 Ga0373947_0084699 3300035725 Bacteria 1968
202 Ga0373925_0000765 3300037068 Bacteria 29515
203 Ga0436363_0535482 3300039450 Bacteria 890
204 Ga0436363_1278493 3300039450 Bacteria 1047
205 Ga0451797_0682714 3300041453 Bacteria 1122
206 Ga0450896_013392 3300042133 Bacteria 1167
207 Ga0451577_0000528 3300042876 Bacteria 63593
208 Ga0451577_0038384 3300042876 Bacteria 4308
209 Ga0453683_0002778 3300044673 Bacteria 13313
210 Ga0453684_0001439 3300044712 Bacteria 67960
211 Ga0453684_0024448 3300044712 Bacteria 8828
212 Ga0451576_0002922 3300045051 Bacteria 24326
213 Ga0451576_0431257 3300045051 Bacteria 1383
214 Ga0495586_0010278 3300046535 Bacteria 4978
215 Ga0495598_0008898 3300046537 Bacteria 2352
216 Ga0495621_0078738 3300046539 Bacteria 1226
217 Ga0495597_0019500 3300046542 Bacteria 3173
218 Ga0495625_0023171 3300046660 Bacteria 4745
219 Ga0495687_004677 3300047443 Bacteria 9120
220 Ga0496125_0002144 3300048928 Bacteria 26440
221 nmdc:mga03683_73971_c1 3300050489 Bacteria 1461
222 nmdc:mga00v17_71985_c1 3300050491 Bacteria 2144
223 nmdc:mga0k408_102528_c1 3300050493 Bacteria 1688
224 nmdc:mga0k408_11879_c1 3300050493 Bacteria 4750
225 nmdc:mga0k408_227475_c1 3300050493 Bacteria 1114
226 nmdc:mga0k408_60412_c1 3300050493 Bacteria 2203
227 nmdc:mga06z11_44193_c1 3300050494 Bacteria 2245
228 nmdc:mga07m45_1411_c1 3300050496 Bacteria 11006
229 nmdc:mga07m45_4757_c1 3300050496 Bacteria 6674
230 nmdc:mga07m45_6350_c1 3300050496 Bacteria 5967
231 Ga0500619_000013 3300053154 Bacteria 56987

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025711 Ga0207696_1000741 Ga0207696_100074111 181
2 3300005289 Ga0065704_10128151 Ga0065704_101281512 183
3 3300005614 Ga0068856_100254230 Ga0068856_1002542302 183
4 3300006946 Ga0079104_1000483 Ga0079104_100048334 183
5 3300009092 Ga0105250_10000703 Ga0105250_1000070311 183
6 3300025935 Ga0207709_10000186 Ga0207709_1000018612 183
7 3300027111 Ga0209281_1000002 Ga0209281_100000212 183
8 3300009148 Ga0105243_10011063 Ga0105243_100110635 184
9 3300031730 Ga0307516_10001791 Ga0307516_1000179113 185
10 3300042133 Ga0450896_013392 Ga0450896_013392_539_1123 186
11 3300005289 Ga0065704_10125718 Ga0065704_101257182 190
12 3300048928 Ga0496125_0002144 Ga0496125_0002144_1248_1898 190
13 3300009176 Ga0105242_10000840 Ga0105242_1000084017 193
14 3300011119 Ga0105246_10324487 Ga0105246_103244872 193
15 3300025934 Ga0207686_10002931 Ga0207686_100029318 193
16 3300005289 Ga0065704_10139762 Ga0065704_101397622 196
17 3300045051 Ga0451576_0431257 Ga0451576_0431257_443_1069 199
18 3300046539 Ga0495621_0078738 Ga0495621_0078738_44_730 200
19 3300006195 Ga0075366_10146219 Ga0075366_101462193 202
20 iso_pu_bacteria 2721755523 2722886500 202
21 iso_pu_bacteria 2839138175 2839142851 202
22 iso_pu_bacteria 2894023352 2894023664 202
23 3300042876 Ga0451577_0000528 Ga0451577_0000528_16018_16662 203
24 3300044712 Ga0453684_0001439 Ga0453684_0001439_16015_16659 203
25 3300045051 Ga0451576_0002922 Ga0451576_0002922_14672_15316 203
26 3300005367 Ga0070667_100705159 Ga0070667_1007051592 204
27 3300005456 Ga0070678_100187700 Ga0070678_1001877002 204
28 3300005459 Ga0068867_100008087 Ga0068867_1000080876 204
29 3300005459 Ga0068867_100116631 Ga0068867_1001166312 204
30 3300005543 Ga0070672_100018038 Ga0070672_1000180385 204
31 3300005543 Ga0070672_100484675 Ga0070672_1004846752 204
32 3300005616 Ga0068852_100123169 Ga0068852_1001231692 204
33 3300005718 Ga0068866_10004621 Ga0068866_100046214 204
34 3300005719 Ga0068861_100001794 Ga0068861_1000017945 204
35 3300005719 Ga0068861_100160824 Ga0068861_1001608242 204
36 3300005843 Ga0068860_100000889 Ga0068860_10000088915 204
37 3300006177 Ga0075362_10038776 Ga0075362_100387762 204
38 3300006195 Ga0075366_10011254 Ga0075366_100112544 204
39 3300006195 Ga0075366_10022066 Ga0075366_100220663 204
40 3300006358 Ga0068871_100152227 Ga0068871_1001522271 204
41 3300006881 Ga0068865_100007032 Ga0068865_1000070323 204
42 3300009148 Ga0105243_10271226 Ga0105243_102712262 204
43 3300009553 Ga0105249_10002111 Ga0105249_100021112 204
44 3300009553 Ga0105249_10197276 Ga0105249_101972763 204
45 3300013306 Ga0163162_10013321 Ga0163162_100133219 204
46 3300014968 Ga0157379_10080250 Ga0157379_100802503 204
47 3300025899 Ga0207642_10003671 Ga0207642_100036713 204
48 3300025935 Ga0207709_10169735 Ga0207709_101697352 204
49 3300025937 Ga0207669_10020555 Ga0207669_100205553 204
50 3300025938 Ga0207704_10008035 Ga0207704_100080353 204
51 3300025940 Ga0207691_10087011 Ga0207691_100870113 204
52 3300025961 Ga0207712_10129910 Ga0207712_101299102 204
53 3300025961 Ga0207712_10348986 Ga0207712_103489862 204
54 3300025986 Ga0207658_10307861 Ga0207658_103078612 204
55 3300026035 Ga0207703_10271813 Ga0207703_102718131 204
56 3300026089 Ga0207648_10004729 Ga0207648_100047294 204
57 3300026089 Ga0207648_10101384 Ga0207648_101013842 204
58 3300026118 Ga0207675_100001573 Ga0207675_1000015735 204
59 3300026121 Ga0207683_10228253 Ga0207683_102282532 204
60 3300028380 Ga0268265_10003776 Ga0268265_100037765 204
61 3300028380 Ga0268265_10027756 Ga0268265_100277563 204
62 3300028381 Ga0268264_10002840 Ga0268264_100028406 204
63 3300031995 Ga0307409_100759147 Ga0307409_1007591471 204
64 3300037068 Ga0373925_0000765 Ga0373925_0000765_27789_28427 204
65 3300046535 Ga0495586_0010278 Ga0495586_0010278_2157_2795 204
66 3300050489 nmdc:mga03683_73971_c1 nmdc:mga03683_73971_c1_453_1091 204
67 3300050493 nmdc:mga0k408_11879_c1 nmdc:mga0k408_11879_c1_2521_3159 204
68 3300053154 Ga0500619_000013 Ga0500619_000013_30620_31285 204
69 iso_pu_bacteria 2842718218 2842722396 204
70 iso_pu_bacteria 2974320154 2974321029 204
71 3300005327 Ga0070658_10036933 Ga0070658_100369333 205
72 3300005364 Ga0070673_100249649 Ga0070673_1002496492 205
73 3300005543 Ga0070672_100030401 Ga0070672_1000304015 205
74 3300025893 Ga0207682_10047065 Ga0207682_100470652 205
75 3300025937 Ga0207669_10131095 Ga0207669_101310952 205
76 3300025940 Ga0207691_10035068 Ga0207691_100350685 205
77 3300039450 Ga0436363_0535482 Ga0436363_0535482_106_774 205
78 3300039450 Ga0436363_1278493 Ga0436363_1278493_218_892 205
79 3300002773 JGI25152J39213_1003735 JGI25152J39213_10037352 206
80 3300003215 JGI25153J46596_10001928 JGI25153J46596_100019283 206
81 3300003323 rootH1_10100316 rootH1_101003163 206
82 3300003771 Ga0055526_1000632 Ga0055526_10006327 206
83 3300005334 Ga0068869_100315425 Ga0068869_1003154252 206
84 3300005364 Ga0070673_100711436 Ga0070673_1007114361 206
85 3300005366 Ga0070659_100945332 Ga0070659_1009453321 206
86 3300005367 Ga0070667_100342753 Ga0070667_1003427532 206
87 3300005455 Ga0070663_100181041 Ga0070663_1001810412 206
88 3300005457 Ga0070662_100004630 Ga0070662_1000046307 206
89 3300005459 Ga0068867_100096160 Ga0068867_1000961603 206
90 3300005578 Ga0068854_100495828 Ga0068854_1004958282 206
91 3300005616 Ga0068852_100156774 Ga0068852_1001567743 206
92 3300005617 Ga0068859_100579283 Ga0068859_1005792832 206
93 3300006048 Ga0075363_100234727 Ga0075363_1002347272 206
94 3300006051 Ga0075364_10062391 Ga0075364_100623912 206
95 3300006177 Ga0075362_10011114 Ga0075362_100111143 206
96 3300006177 Ga0075362_10047422 Ga0075362_100474223 206
97 3300006178 Ga0075367_10007250 Ga0075367_100072502 206
98 3300006178 Ga0075367_10219915 Ga0075367_102199151 206
99 3300006186 Ga0075369_10063222 Ga0075369_100632222 206
100 3300006195 Ga0075366_10067263 Ga0075366_100672632 206
101 3300006195 Ga0075366_10071820 Ga0075366_100718203 206
102 3300006195 Ga0075366_10299968 Ga0075366_102999681 206
103 3300006353 Ga0075370_10001175 Ga0075370_100011752 206
104 3300006353 Ga0075370_10028289 Ga0075370_100282893 206
105 3300006931 Ga0097620_100579210 Ga0097620_1005792102 206
106 3300009093 Ga0105240_10197792 Ga0105240_101977923 206
107 3300009098 Ga0105245_10084182 Ga0105245_100841823 206
108 3300009148 Ga0105243_10005607 Ga0105243_1000560711 206
109 3300009148 Ga0105243_10048349 Ga0105243_100483493 206
110 3300009545 Ga0105237_10035752 Ga0105237_100357523 206
111 3300010375 Ga0105239_10115079 Ga0105239_101150793 206
112 3300013297 Ga0157378_10015558 Ga0157378_100155583 206
113 3300013297 Ga0157378_10188760 Ga0157378_101887602 206
114 3300014326 Ga0157380_10015039 Ga0157380_100150392 206
115 3300025245 Ga0207425_1000749 Ga0207425_10007494 206
116 3300025258 Ga0209129_1000038 Ga0209129_1000038284 206
117 3300025295 Ga0209564_1000162 Ga0209564_100016267 206
118 3300025297 Ga0209758_1000152 Ga0209758_100015287 206
119 3300025299 Ga0209256_1034532 Ga0209256_10345322 206
120 3300025913 Ga0207695_10021643 Ga0207695_100216432 206
121 3300025914 Ga0207671_10173383 Ga0207671_101733831 206
122 3300025927 Ga0207687_10322232 Ga0207687_103222321 206
123 3300025933 Ga0207706_10013433 Ga0207706_100134334 206
124 3300025935 Ga0207709_10030521 Ga0207709_100305212 206
125 3300025935 Ga0207709_10774682 Ga0207709_107746821 206
126 3300025942 Ga0207689_10314649 Ga0207689_103146491 206
127 3300025960 Ga0207651_10130528 Ga0207651_101305282 206
128 3300025986 Ga0207658_10112021 Ga0207658_101120211 206
129 3300026067 Ga0207678_10103785 Ga0207678_101037852 206
130 3300026089 Ga0207648_10072018 Ga0207648_100720183 206
131 3300026116 Ga0207674_10137006 Ga0207674_101370061 206
132 3300035725 Ga0373947_0084699 Ga0373947_0084699_1108_1761 206
133 3300041453 Ga0451797_0682714 Ga0451797_0682714_414_1067 206
134 3300046542 Ga0495597_0019500 Ga0495597_0019500_1318_1971 206
135 3300046660 Ga0495625_0023171 Ga0495625_0023171_3135_3782 206
136 3300047443 Ga0495687_004677 Ga0495687_004677_1332_1985 206
137 3300050491 nmdc:mga00v17_71985_c1 nmdc:mga00v17_71985_c1_451_1098 206
138 3300050493 nmdc:mga0k408_227475_c1 nmdc:mga0k408_227475_c1_285_932 206
139 3300050493 nmdc:mga0k408_60412_c1 nmdc:mga0k408_60412_c1_1527_2174 206
140 3300050494 nmdc:mga06z11_44193_c1 nmdc:mga06z11_44193_c1_155_802 206
141 3300050496 nmdc:mga07m45_1411_c1 nmdc:mga07m45_1411_c1_10197_10844 206
142 3300050496 nmdc:mga07m45_4757_c1 nmdc:mga07m45_4757_c1_5434_6081 206
143 3300003316 rootH1_10017780 rootH1_100177803 207
144 3300003322 rootL2_10053328 rootL2_100533283 207
145 3300003791 Ga0055530_10003372 Ga0055530_100033724 207
146 3300005335 Ga0070666_10055686 Ga0070666_100556862 207
147 3300006195 Ga0075366_10102634 Ga0075366_101026342 207
148 3300014968 Ga0157379_10004464 Ga0157379_100044641 207
149 3300025273 Ga0209673_1004769 Ga0209673_10047695 207
150 3300025298 Ga0209050_1000634 Ga0209050_100063451 207
151 3300025303 Ga0209051_1016653 Ga0209051_10166534 207
152 3300025938 Ga0207704_10159721 Ga0207704_101597212 207
153 3300025940 Ga0207691_10383522 Ga0207691_103835222 207
154 3300025986 Ga0207658_10298230 Ga0207658_102982302 207
155 3300031507 Ga0307509_10054860 Ga0307509_100548603 207
156 3300035114 Ga0373939_0093459 Ga0373939_0093459_283_933 207
157 3300042876 Ga0451577_0038384 Ga0451577_0038384_800_1453 207
158 3300044673 Ga0453683_0002778 Ga0453683_0002778_1428_2081 207
159 3300044712 Ga0453684_0024448 Ga0453684_0024448_894_1547 207
160 3300050493 nmdc:mga0k408_102528_c1 nmdc:mga0k408_102528_c1_681_1331 207
161 3300005344 Ga0070661_100651862 Ga0070661_1006518621 208
162 3300005563 Ga0068855_100075191 Ga0068855_1000751913 208
163 3300005616 Ga0068852_100086137 Ga0068852_1000861373 208
164 3300005616 Ga0068852_100248260 Ga0068852_1002482602 208
165 3300025932 Ga0207690_10131893 Ga0207690_101318932 208
166 3300026142 Ga0207698_10065771 Ga0207698_100657712 208
167 3300026142 Ga0207698_10180147 Ga0207698_101801473 208
168 3300005262 Ga0065165_1002690 Ga0065165_10026906 209
169 3300005327 Ga0070658_10480084 Ga0070658_104800842 209
170 3300005328 Ga0070676_10013481 Ga0070676_100134814 209
171 3300005330 Ga0070690_100014007 Ga0070690_1000140073 209
172 3300005330 Ga0070690_100656983 Ga0070690_1006569831 209
173 3300005336 Ga0070680_100007042 Ga0070680_1000070427 209
174 3300005356 Ga0070674_100026525 Ga0070674_1000265252 209
175 3300005356 Ga0070674_100039748 Ga0070674_1000397482 209
176 3300005455 Ga0070663_100272393 Ga0070663_1002723932 209
177 3300005459 Ga0068867_100081663 Ga0068867_1000816633 209
178 3300005459 Ga0068867_100084990 Ga0068867_1000849902 209
179 3300005614 Ga0068856_100063015 Ga0068856_1000630152 209
180 3300005719 Ga0068861_100036729 Ga0068861_1000367293 209
181 3300006353 Ga0075370_10007940 Ga0075370_100079402 209
182 3300009551 Ga0105238_10249948 Ga0105238_102499482 209
183 3300013297 Ga0157378_10708738 Ga0157378_107087381 209
184 3300014326 Ga0157380_10126621 Ga0157380_101266213 209
185 3300017792 Ga0163161_10043549 Ga0163161_100435493 209
186 3300025907 Ga0207645_10007024 Ga0207645_100070244 209
187 3300025908 Ga0207643_10191716 Ga0207643_101917162 209
188 3300025961 Ga0207712_10027304 Ga0207712_100273042 209
189 3300026023 Ga0207677_10260574 Ga0207677_102605742 209
190 3300026067 Ga0207678_10269860 Ga0207678_102698602 209
191 3300026089 Ga0207648_10004934 Ga0207648_1000493410 209
192 3300026089 Ga0207648_10160293 Ga0207648_101602933 209
193 3300026121 Ga0207683_10191617 Ga0207683_101916172 209
194 3300026142 Ga0207698_10139510 Ga0207698_101395102 209
195 3300031731 Ga0307405_10002184 Ga0307405_100021844 209
196 3300031824 Ga0307413_10397707 Ga0307413_103977072 209
197 3300031852 Ga0307410_10081270 Ga0307410_100812703 209
198 3300031901 Ga0307406_10049181 Ga0307406_100491812 209
199 3300031903 Ga0307407_10177247 Ga0307407_101772471 209
200 3300031911 Ga0307412_10005771 Ga0307412_100057715 209
201 3300031995 Ga0307409_100007478 Ga0307409_1000074784 209
202 3300032004 Ga0307414_10099903 Ga0307414_100999032 209
203 3300032005 Ga0307411_10004570 Ga0307411_100045704 209
204 3300046537 Ga0495598_0008898 Ga0495598_0008898_88_774 209
205 3300050496 nmdc:mga07m45_6350_c1 nmdc:mga07m45_6350_c1_3613_4335 209
206 3300006195 Ga0075366_10003670 Ga0075366_100036706 210
207 3300005331 Ga0070670_100313939 Ga0070670_1003139392 211
208 3300025925 Ga0207650_10298304 Ga0207650_102983042 211
209 3300002155 JGI24033J26618_1019738 JGI24033J26618_10197381 213
210 3300005328 Ga0070676_10106484 Ga0070676_101064842 213
211 3300005331 Ga0070670_100021965 Ga0070670_1000219652 213
212 3300005333 Ga0070677_10009367 Ga0070677_100093674 213
213 3300005338 Ga0068868_100106648 Ga0068868_1001066482 213
214 3300005354 Ga0070675_100035451 Ga0070675_1000354513 213
215 3300005355 Ga0070671_100009624 Ga0070671_1000096243 213
216 3300005356 Ga0070674_100020297 Ga0070674_1000202973 213
217 3300005364 Ga0070673_100008259 Ga0070673_1000082592 213
218 3300005456 Ga0070678_100045802 Ga0070678_1000458022 213
219 3300005459 Ga0068867_100012740 Ga0068867_1000127406 213
220 3300005543 Ga0070672_100006382 Ga0070672_1000063822 213
221 3300005618 Ga0068864_100111655 Ga0068864_1001116553 213
222 3300006237 Ga0097621_100257283 Ga0097621_1002572832 213
223 3300006358 Ga0068871_100201675 Ga0068871_1002016752 213
224 3300013308 Ga0157375_10013930 Ga0157375_100139303 213
225 3300017792 Ga0163161_10015099 Ga0163161_100150996 213
226 3300025315 Ga0207697_10019423 Ga0207697_100194233 213
227 3300025893 Ga0207682_10001873 Ga0207682_1000187310 213
228 3300025907 Ga0207645_10120263 Ga0207645_101202632 213
229 3300025925 Ga0207650_10001746 Ga0207650_100017462 213
230 3300025926 Ga0207659_10101987 Ga0207659_101019872 213
231 3300025937 Ga0207669_10134410 Ga0207669_101344102 213
232 3300025960 Ga0207651_10009097 Ga0207651_100090972 213
233 3300026089 Ga0207648_10001750 Ga0207648_100017502 213
234 3300026095 Ga0207676_10126600 Ga0207676_101266002 213
235 3300026118 Ga0207675_100185887 Ga0207675_1001858873 213
236 3300026121 Ga0207683_10116354 Ga0207683_101163542 213

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

163

243

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zl7-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa dsba e82i: crystal i 0.9418 37 212
7luj-assembly3.cif.gz_C burkholderia pseudomallei disulfide bond forming protein a (dsba) liganded with fragment 4-methoxy-n-phenylbenzenesulfonamide 0.9411 36 211
5vyo-assembly4.cif.gz_D the complex structure of burkholderia pseudomallei dsba bound to a peptide 0.9409 36 211
2rem-assembly2.cif.gz_B crystal structure of oxidoreductase dsba from xylella fastidiosa 0.9074 35 212
3h93-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa dsba 0.9063 39 211
ID Description Score Start End Superfamily
5vyoC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9397 34 211 3.40.30.10
2remB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9074 35 212 3.40.30.10
4p3yB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.898 39 212 3.40.30.10
3hd5C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8944 49 183 3.40.30.10
4jrrC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8936 37 209 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A536VN16-F1-model_v4 Thiol:disulfide interchange protein DsbA 0.9735 56 213 GO:0015036
GO:0042597
AF-A0A2N3VRS0-F1-model_v4 Thiol:disulfide interchange protein DsbA 0.9518 36 210 GO:0016491
AF-A0A139DB57-F1-model_v4 Thiol:disulfide interchange protein DsbA 0.9498 37 211 GO:0016491
GO:0042597
AF-A0A1D2X768-F1-model_v4 Thiol:disulfide interchange protein 0.948 33 211 GO:0016491
GO:0042597
AF-A0A7Y4XZ10-F1-model_v4 Thiol:disulfide interchange protein 0.947 38 210 GO:0015036
GO:0042597

Feature Viewer

pLDDT pTM Quality
86.43 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map