F348685

General Info

Members Datasets Scaffolds Average Seq Length
236 176 472 382

Family's Representative Sequence

Representative Sequence 3300002987|JGI25159J45721_1006751|JGI25159J45721_10067513
Length 381
Sequence MRLKIGITCYPSVGGSGVVGTELGKQLAERGHEIHFITSGVPFRLNKVYPNIYFHEVAVNQYSVFQYPPYDLALASKMAEVAQRENLDILHVHYAIPHAICAYLAKQMIGERIKIVTTLHGTDITVLGSDPSLNNLIRFGIEQSDVVTAVSHSLIEETNELVKPDKEIETVYNFVDERVYFKRDMSQLKKEYGIRENEKVLIHISNFRKVKRVQDVVRSFAEIVKGVDAKLLLVGDGPEFCTILQLVKSLHIEERVLFLGKQDNVAELLAMSDLMLLLSEKESFGLVILEAMACGVPSIGTRVGGIPEVIQHGETGYICEVGDTDGIAKQAIQLLENEELHRNMGERAMKSVYEQFRSEKIVSQYEAIYYDILRDDNNGKI

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
5 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
6 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
7 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
8 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
9 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
10 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
11 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
12 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
13 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
14 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
15 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
16 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
17 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
20 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
21 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
22 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
23 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
24 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
25 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
26 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
27 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
28 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
29 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
30 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
31 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
32 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
33 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
34 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
35 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
36 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
37 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
38 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
39 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
40 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
41 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
42 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
44 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
45 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
46 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
47 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
48 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
49 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
50 2554235283 Bacillus safensis VK Isolate Rhizosphere
51 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
52 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
53 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
54 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
55 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
56 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
57 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
58 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
59 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
60 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
61 2643221729 Bacillus sp. Root11 Isolate Unclassified
62 2643221730 Bacillus sp. Root131 Isolate Unclassified
63 2643221735 Bacillus sp. Root920 Isolate Unclassified
64 2671180694 Paenibacillus sp. A3 Isolate Unclassified
65 2684622632 Bacillus cereus 905 Isolate Unclassified
66 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
67 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
68 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
69 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
70 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
71 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
72 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
73 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
74 2738541358 Bacillus sp. OV752 Isolate Unclassified
75 2738543006 Bacillus sp. OK077 Isolate Unclassified
76 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
77 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
78 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
79 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
80 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
81 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
82 2811994870 Bacillus sp. JB4 Isolate Unclassified
83 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
84 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
85 2818991441 Niallia circulans 3243 Isolate Rhizosphere
86 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
87 2818991459 Paenibacillus sp. 597 Isolate Unclassified
88 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
89 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
90 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
91 2842882022 Bacillus sp. R-71893 Isolate Unclassified
92 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
93 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
94 2857472729 Cohnella sp. R-74144 Isolate Unclassified
95 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
96 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
97 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
98 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
99 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
100 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
101 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
102 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
103 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
104 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
105 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
106 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
107 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
108 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
109 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
110 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
111 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
112 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
113 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
114 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
115 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
116 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
117 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
118 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
119 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
120 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
121 2919726948 Bacillus pumilus 4489 Isolate Unclassified
122 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
123 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
124 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
125 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
126 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
127 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
128 2938917290 Bacillus sp. CR71 Isolate Unclassified
129 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
130 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
131 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
132 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
133 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
134 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
135 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
136 2965761152 Bacillus sp. COPE52 Isolate Unclassified
137 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
138 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
139 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
140 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
141 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
142 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
143 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
144 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
145 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
146 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
147 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
148 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
149 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
150 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
151 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
152 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
153 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
154 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
155 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
156 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
157 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
158 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
159 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
160 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
161 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
162 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
163 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
164 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
165 8022792930 Bacillus sp. Xin Isolate Rhizosphere
166 8023438354 Bacillus sp. BH2 Isolate Unclassified
167 8023444577 Bacillus sp. BH32 Isolate Unclassified
168 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
169 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
170 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
171 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
172 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
173 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
174 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
175 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
176 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 42.37
Metatranscriptomes 1.27
Isolates 56.36

Biome Distribution

Category Percentage (%)
Aerial Root 0.85
Bulb 0
Endosphere 13.56
Nodule 0.85
Rhizoplane 1.27
Rhizosphere 39.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1006751 3300002987 Bacteria 3382
2 JGI25159J45721_1007558 3300002987 Bacteria 3100
3 JGI25159J45721_1010543 3300002987 Bacteria 2344
4 JGI25159J45721_1013288 3300002987 Bacteria 1914
5 JGI25151J46595_10000029 3300003187 Bacteria 205878
6 JGI25151J46595_10015262 3300003187 Bacteria 3392
7 JGI25151J46595_10022188 3300003187 Bacteria 2640
8 Ga0006562J51391_1028260 3300003578 Bacteria 2076
9 Ga0055538_1000136 3300003751 Bacteria 52142
10 Ga0055532_1000216 3300003758 Bacteria 45278
11 Ga0055541_1001499 3300003841 Bacteria 5032
12 Ga0105251_10021481 3300009011 Bacteria 3369
13 Ga0105244_10005648 3300009036 Bacteria 8262
14 Ga0105244_10008495 3300009036 Bacteria 6409
15 Ga0105244_10020931 3300009036 Bacteria 3623
16 Ga0105244_10022537 3300009036 Bacteria 3466
17 Ga0105244_10091162 3300009036 Bacteria 1499
18 Ga0105250_10000349 3300009092 Bacteria 35603
19 Ga0105250_10016555 3300009092 Bacteria 3001
20 Ga0105250_10021619 3300009092 Bacteria 2596
21 Ga0105250_10037429 3300009092 Bacteria 1947
22 Ga0105246_10006251 3300011119 Bacteria 7270
23 Ga0105246_10021534 3300011119 Bacteria 4149
24 Ga0209784_100085 3300025224 Bacteria 122828
25 Ga0209784_102159 3300025224 Bacteria 2107
26 Ga0209566_100015 3300025225 Bacteria 457963
27 Ga0209566_100090 3300025225 Bacteria 141829
28 Ga0209566_100324 3300025225 Bacteria 43123
29 Ga0209566_101118 3300025225 Bacteria 10273
30 Ga0209566_102249 3300025225 Bacteria 3775
31 Ga0209147_100014 3300025229 Bacteria 597841
32 Ga0209147_100042 3300025229 Bacteria 301263
33 Ga0209147_100461 3300025229 Bacteria 25155
34 Ga0209258_100669 3300025242 Bacteria 24339
35 Ga0209130_1001598 3300025284 Bacteria 14164
36 Ga0209130_1004079 3300025284 Bacteria 5763
37 Ga0209130_1004207 3300025284 Bacteria 5608
38 Ga0209025_1000001 3300025294 Bacteria 1888151
39 Ga0209025_1001783 3300025294 Bacteria 25606
40 Ga0209025_1005259 3300025294 Bacteria 10654
41 Ga0209025_1006228 3300025294 Bacteria 9351
42 Ga0209025_1011842 3300025294 Bacteria 5681
43 Ga0209025_1017349 3300025294 Bacteria 4162
44 Ga0209025_1029136 3300025294 Bacteria 2682
45 Ga0209025_1035362 3300025294 Bacteria 2259
46 Ga0207696_1004476 3300025711 Bacteria 6017
47 Ga0207655_1003909 3300025728 Bacteria 10817
48 Ga0207655_1008999 3300025728 Bacteria 6258
49 Ga0237817_10030 3300030083 Bacteria 49360
50 Ga0237817_10092 3300030083 Bacteria 27884
51 Ga0395899_0020265 3300037312 Bacteria 5046
52 Ga0395899_0045675 3300037312 Bacteria 3263
53 Ga0237819_00532 3300038705 Bacteria 12767
54 Ga0237819_01518 3300038705 Bacteria 5909
55 Ga0439439_0001142 3300041406 Bacteria 5095
56 Ga0439449_0000163 3300042007 Bacteria 22802
57 Ga0439449_0052449 3300042007 Bacteria 1508
58 Ga0466969_0001156 3300044656 Bacteria 14186
59 Ga0466961_0100585 3300044693 Bacteria 1821
60 Ga0466968_0004310 3300044735 Bacteria 5313
61 Ga0466968_0005223 3300044735 Bacteria 4863
62 Ga0466959_0011785 3300045049 Bacteria 6294
63 Ga0466959_0018261 3300045049 Bacteria 5149
64 Ga0466967_0000257 3300045976 Bacteria 23336
65 Ga0495590_0010867 3300046457 Bacteria 3412
66 Ga0495660_0024244 3300046810 Bacteria 3456
67 Ga0495660_0066754 3300046810 Bacteria 1918
68 Ga0496116_0001229 3300048919 Bacteria 29859
69 Ga0496116_0021691 3300048919 Bacteria 4834
70 Ga0496116_0029388 3300048919 Bacteria 3963
71 Ga0496116_0032588 3300048919 Bacteria 3712
72 Ga0496116_0075205 3300048919 Bacteria 2121
73 Ga0496116_0119183 3300048919 Bacteria 1531
74 Ga0496117_0013804 3300048920 Bacteria 7014
75 Ga0496118_0018305 3300048921 Bacteria 6324
76 Ga0496119_0000221 3300048922 Bacteria 79912
77 Ga0496119_0015220 3300048922 Bacteria 5947
78 Ga0496119_0060903 3300048922 Bacteria 2257
79 Ga0496120_0000045 3300048923 Bacteria 191663
80 Ga0496120_0030551 3300048923 Bacteria 3272
81 Ga0496121_0094682 3300048924 Bacteria 2323
82 Ga0496122_0013346 3300048925 Bacteria 8048
83 Ga0496122_0015821 3300048925 Bacteria 7186
84 Ga0496122_0025365 3300048925 Bacteria 5150
85 Ga0496122_0027977 3300048925 Bacteria 4801
86 Ga0496122_0050585 3300048925 Bacteria 3168
87 Ga0496122_0106644 3300048925 Bacteria 1854
88 Ga0496122_0111827 3300048925 Bacteria 1790
89 Ga0496123_0002924 3300048926 Bacteria 19985
90 Ga0496123_0027331 3300048926 Bacteria 4252
91 Ga0496124_0000694 3300048927 Bacteria 55198
92 Ga0496124_0001026 3300048927 Bacteria 44181
93 Ga0496124_0034152 3300048927 Bacteria 4468
94 Ga0496124_0064404 3300048927 Bacteria 3060
95 Ga0496124_0152186 3300048927 Bacteria 1813
96 Ga0496125_0001624 3300048928 Bacteria 31668
97 Ga0496125_0005598 3300048928 Bacteria 13875
98 Ga0496125_0051047 3300048928 Bacteria 3416
99 Ga0496126_0002823 3300048929 Bacteria 22771
100 Ga0496126_0020314 3300048929 Bacteria 6517
101 Ga0496126_0059212 3300048929 Bacteria 3449
102 Ga0501315_003941 3300049531 Bacteria 1519
103 Ga0501317_001954 3300049533 Bacteria 1875
104 2511179904 2510917027 Bacteria 5287437
105 2512638610 2512564013 Bacteria 6286191
106 2512732566 2512564039 Bacteria 8739048
107 2524186172 2524023129 Bacteria 6762600
108 2550900738 2548877040 Bacteria 7507281
109 2553391628 2551306519 Bacteria 5465154
110 2555467419 2554235283 Bacteria 3683090
111 2571531793 2571042143 Bacteria 6986194
112 2580933757 2579778775 Bacteria 5360914
113 2587738754 2585428059 Bacteria 8696589
114 2595315515 2593339198 Bacteria 7267884
115 2600198342 2599185353 Bacteria 2219443
116 2600401131 2600254943 Bacteria 2613887
117 2601638753 2600255286 Bacteria 5390125
118 2621276014 2619619294 Bacteria 5575484
119 2643738399 2643221543 Bacteria 6628015
120 2644421671 2643221676 Bacteria 8119172
121 2644704028 2643221729 Bacteria 6621700
122 2644708721 2643221730 Bacteria 6523787
123 2644740593 2643221735 Bacteria 3676263
124 2673823681 2671180694 Bacteria 7506943
125 2685149458 2684622632 Bacteria 5380049
126 2686997245 2684623153 Bacteria 3878815
127 2687498552 2687453109 Bacteria 3860091
128 2698323720 2695420987 Bacteria 6152737
129 2705993505 2703719227 Bacteria 5631989
130 2721504838 2718218445 Bacteria 5113413
131 2723604597 2721755693 Bacteria 6126117
132 2728529529 2728368933 Bacteria 7044283
133 2730135238 2728369359 Bacteria 5621728
134 2739156190 2738541358 Bacteria 5932299
135 2739210871 2738543006 Bacteria 5904091
136 2745168739 2744054657 Bacteria 5016802
137 2753809951 2751185905 Bacteria 6142767
138 2777761330 2775507177 Bacteria 4384303
139 2777839106 2775507192 Bacteria 4622234
140 2793184450 2791355222 Bacteria 5898266
141 2802436859 2802428803 Bacteria 5806948
142 2812316437 2811994870 Bacteria 3776934
143 2817480484 2816332295 Bacteria 4352468
144 2817618309 2816332336 Bacteria 5207640
145 2819569566 2818991441 Bacteria 5062707
146 2819579395 2818991443 Bacteria 6598732
147 2819669189 2818991459 Bacteria 8736032
148 2819723506 2818991468 Bacteria 3723169
149 2821114293 2821111986 Bacteria 6894338
150 2823528418 2823526263 Bacteria 3765752
151 2842887660 2842882022 Bacteria 6158489
152 2857453841 2857453340 Bacteria 8090534
153 2857469862 2857465823 Bacteria 6772595
154 2857474018 2857472729 Bacteria 6568124
155 2857591804 2857591370 Bacteria 6569758
156 2857604301 2857604169 Bacteria 5111450
157 2857610960 2857609550 Bacteria 3753890
158 2864737457 2864733723 Bacteria 6770668
159 2865001870 2864997549 Bacteria 5139696
160 2865003725 2865002811 Bacteria 6333767
161 2881636980 2881636855 Bacteria 5205297
162 2885527749 2885526491 Bacteria 7164189
163 2888581204 2888578766 Bacteria 6743310
164 2889046400 2889042446 Bacteria 7618936
165 2889050117 2889049205 Bacteria 7524325
166 2889280504 2889276214 Bacteria 5979355
167 2889297136 2889295896 Bacteria 4704906
168 2904115717 2904113452 Bacteria 7796941
169 2904163610 2904162308 Bacteria 7086713
170 2904493303 2904490793 Bacteria 7046938
171 2904595564 2904595352 Bacteria 6124848
172 2904762114 2904755435 Bacteria 7986759
173 2907205184 2907202186 Bacteria 6632024
174 2908668378 2908665501 Bacteria 3678115
175 2915601136 2915597211 Bacteria 6475886
176 2915607384 2915606848 Bacteria 6032732
177 2919096147 2919093281 Bacteria 3660974
178 2919162595 2919160200 Bacteria 6929020
179 2919415211 2919414237 Bacteria 5429133
180 2919431592 2919425241 Bacteria 8055701
181 2919728135 2919726948 Bacteria 3696050
182 2925330925 2925326138 Bacteria 9652120
183 2929186276 2929183550 Bacteria 6377511
184 2929208747 2929206907 Bacteria 5918291
185 2929234733 2929233124 Bacteria 5948380
186 2931389849 2931384279 Bacteria 7299545
187 2938651864 2938649242 Bacteria 7118381
188 2938918907 2938917290 Bacteria 5914775
189 2939680763 2939679117 Bacteria 6921672
190 2939705315 2939702853 Bacteria 5139229
191 2945991460 2945991243 Bacteria 7008369
192 2946054155 2946053406 Bacteria 6978655
193 2947428279 2947426588 Bacteria 5357194
194 2954774067 2954773129 Bacteria 3741715
195 2956898095 2956897341 Bacteria 5447711
196 2965762772 2965761152 Bacteria 5806513
197 2968560712 2968558590 Bacteria 6956864
198 2971407795 2971403814 Bacteria 7370929
199 2971417055 2971410472 Bacteria 8311090
200 2977256832 2977254563 Bacteria 4828420
201 2979085205 2979083700 Bacteria 5894929
202 2980126936 2980125574 Bacteria 5567337
203 2980189675 2980182181 Bacteria 9454109
204 2981285615 2981284811 Bacteria 4641497
205 2981290562 2981289755 Bacteria 4641509
206 2981980815 2981980479 Bacteria 4641628
207 2981985694 2981985349 Bacteria 4641497
208 2984530038 2984527788 Bacteria 5288478
209 2984536143 2984532647 Bacteria 5288506
210 2988231944 2988225383 Bacteria 7221625
211 2990277707 2990275345 Bacteria 4887158
212 2996638220 2996632988 Bacteria 6921523
213 2996710773 2996706504 Bacteria 5757485
214 3001273665 3001272096 Bacteria 4729684
215 3001898025 3001892409 Bacteria 6328293
216 3006827584 3006826541 Bacteria 4678913
217 3006860828 3006858327 Bacteria 4317835
218 3006975629 3006973921 Bacteria 4423788
219 3006981531 3006978542 Bacteria 5328100
220 3006984818 3006984091 Bacteria 4207523
221 3006989163 3006988479 Bacteria 4767936
222 648170640 648028048 Bacteria 5394884
223 8002324242 8002317523 Bacteria 8051857
224 8022622702 8022621104 Bacteria 5241040
225 8022798089 8022792930 Bacteria 5693794
226 8023442413 8023438354 Bacteria 5779374
227 8023447991 8023444577 Bacteria 5661597
228 8046998736 8046991243 Bacteria 8497463
229 8054469529 8054465665 Bacteria 7323556
230 8054798173 8054795415 Bacteria 9785225
231 8055635577 8055632911 Bacteria 5283357
232 8056536533 8056533031 Bacteria 8964429
233 8057478246 8057473075 Bacteria 5892720
234 8057584289 8057582654 Bacteria 5218944
235 8057739457 8057733483 Bacteria 6578323
236 8057978855 8057977335 Bacteria 5694872
237 JGI25159J45721_1006751
238 JGI25159J45721_1007558
239 JGI25159J45721_1010543
240 JGI25159J45721_1013288
241 JGI25151J46595_10000029
242 JGI25151J46595_10015262
243 JGI25151J46595_10022188
244 Ga0006562J51391_1028260
245 Ga0055538_1000136
246 Ga0055532_1000216
247 Ga0055541_1001499
248 Ga0105251_10021481
249 Ga0105244_10005648
250 Ga0105244_10008495
251 Ga0105244_10020931
252 Ga0105244_10022537
253 Ga0105244_10091162
254 Ga0105250_10000349
255 Ga0105250_10016555
256 Ga0105250_10021619
257 Ga0105250_10037429
258 Ga0105246_10006251
259 Ga0105246_10021534
260 Ga0209784_100085
261 Ga0209784_102159
262 Ga0209566_100015
263 Ga0209566_100090
264 Ga0209566_100324
265 Ga0209566_101118
266 Ga0209566_102249
267 Ga0209147_100014
268 Ga0209147_100042
269 Ga0209147_100461
270 Ga0209258_100669
271 Ga0209130_1001598
272 Ga0209130_1004079
273 Ga0209130_1004207
274 Ga0209025_1000001
275 Ga0209025_1001783
276 Ga0209025_1005259
277 Ga0209025_1006228
278 Ga0209025_1011842
279 Ga0209025_1017349
280 Ga0209025_1029136
281 Ga0209025_1035362
282 Ga0207696_1004476
283 Ga0207655_1003909
284 Ga0207655_1008999
285 Ga0237817_10030
286 Ga0237817_10092
287 Ga0395899_0020265
288 Ga0395899_0045675
289 Ga0237819_00532
290 Ga0237819_01518
291 Ga0439439_0001142
292 Ga0439449_0000163
293 Ga0439449_0052449
294 Ga0466969_0001156
295 Ga0466961_0100585
296 Ga0466968_0004310
297 Ga0466968_0005223
298 Ga0466959_0011785
299 Ga0466959_0018261
300 Ga0466967_0000257
301 Ga0495590_0010867
302 Ga0495660_0024244
303 Ga0495660_0066754
304 Ga0496116_0001229
305 Ga0496116_0021691
306 Ga0496116_0029388
307 Ga0496116_0032588
308 Ga0496116_0075205
309 Ga0496116_0119183
310 Ga0496117_0013804
311 Ga0496118_0018305
312 Ga0496119_0000221
313 Ga0496119_0015220
314 Ga0496119_0060903
315 Ga0496120_0000045
316 Ga0496120_0030551
317 Ga0496121_0094682
318 Ga0496122_0013346
319 Ga0496122_0015821
320 Ga0496122_0025365
321 Ga0496122_0027977
322 Ga0496122_0050585
323 Ga0496122_0106644
324 Ga0496122_0111827
325 Ga0496123_0002924
326 Ga0496123_0027331
327 Ga0496124_0000694
328 Ga0496124_0001026
329 Ga0496124_0034152
330 Ga0496124_0064404
331 Ga0496124_0152186
332 Ga0496125_0001624
333 Ga0496125_0005598
334 Ga0496125_0051047
335 Ga0496126_0002823
336 Ga0496126_0020314
337 Ga0496126_0059212
338 Ga0501315_003941
339 Ga0501317_001954
340 2511179904
341 2512638610
342 2512732566
343 2524186172
344 2550900738
345 2553391628
346 2555467419
347 2571531793
348 2580933757
349 2587738754
350 2595315515
351 2600198342
352 2600401131
353 2601638753
354 2621276014
355 2643738399
356 2644421671
357 2644704028
358 2644708721
359 2644740593
360 2673823681
361 2685149458
362 2686997245
363 2687498552
364 2698323720
365 2705993505
366 2721504838
367 2723604597
368 2728529529
369 2730135238
370 2739156190
371 2739210871
372 2745168739
373 2753809951
374 2777761330
375 2777839106
376 2793184450
377 2802436859
378 2812316437
379 2817480484
380 2817618309
381 2819569566
382 2819579395
383 2819669189
384 2819723506
385 2821114293
386 2823528418
387 2842887660
388 2857453841
389 2857469862
390 2857474018
391 2857591804
392 2857604301
393 2857610960
394 2864737457
395 2865001870
396 2865003725
397 2881636980
398 2885527749
399 2888581204
400 2889046400
401 2889050117
402 2889280504
403 2889297136
404 2904115717
405 2904163610
406 2904493303
407 2904595564
408 2904762114
409 2907205184
410 2908668378
411 2915601136
412 2915607384
413 2919096147
414 2919162595
415 2919415211
416 2919431592
417 2919728135
418 2925330925
419 2929186276
420 2929208747
421 2929234733
422 2931389849
423 2938651864
424 2938918907
425 2939680763
426 2939705315
427 2945991460
428 2946054155
429 2947428279
430 2954774067
431 2956898095
432 2965762772
433 2968560712
434 2971407795
435 2971417055
436 2977256832
437 2979085205
438 2980126936
439 2980189675
440 2981285615
441 2981290562
442 2981980815
443 2981985694
444 2984530038
445 2984536143
446 2988231944
447 2990277707
448 2996638220
449 2996710773
450 3001273665
451 3001898025
452 3006827584
453 3006860828
454 3006975629
455 3006981531
456 3006984818
457 3006989163
458 648170640
459 8002324242
460 8022622702
461 8022798089
462 8023442413
463 8023447991
464 8046998736
465 8054469529
466 8054798173
467 8055635577
468 8056536533
469 8057478246
470 8057584289
471 8057739457
472 8057978855

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

184

351

0.97

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

13

179

0.95

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

198

337

0.94

PF13524

Glyco_trans_1_2

Glycosyl transferases group 1

220

367

0.88

PF13477

Glyco_trans_4_2

Glycosyl transferase 4-like

9

151

0.84

PF13579

Glyco_trans_4_4

Glycosyl transferase 4-like domain

14

173

0.79

PF20706

GT4-conflict

Family 4 Glycosyltransferase in conflict systems

141

357

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jjm-assembly1.cif.gz_B crystal structure of a family gt4 glycosyltransferase from bacillus anthracis orf ba1558. 0.9877 2 372
2jjm-assembly1.cif.gz_B crystal structure of a family gt4 glycosyltransferase from bacillus anthracis orf ba1558. 0.9823 2 372
3mbo-assembly3.cif.gz_E crystal structure of the glycosyltransferase babsha bound with udp and l-malate 0.982 2 376
3mbo-assembly2.cif.gz_C crystal structure of the glycosyltransferase babsha bound with udp and l-malate 0.9808 2 376
3mbo-assembly4.cif.gz_H crystal structure of the glycosyltransferase babsha bound with udp and l-malate 0.9804 2 376
ID Description Score Start End Superfamily
af_Q2G255_3_172_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9887 6 174 3.40.50.2000
5d00A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9793 183 356 3.40.50.2000
af_Q2G255_3_172_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9773 6 174 3.40.50.2000
5d00A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9684 183 356 3.40.50.2000
af_Q2G0L2_318_480_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9607 195 354 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A2S7SSF2-F1-model_v4 N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA 0.9771 3 375 GO:0016757
GO:0071793
AF-A0A7C6ETM0-F1-model_v4 N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA 0.9725 3 376 GO:0016757
GO:0071793
AF-A0A7C6ETM0-F1-model_v4 N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA 0.97 3 376 GO:0016757
GO:0071793
AF-A0A2S7SSF2-F1-model_v4 N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA 0.9618 3 375 GO:0016757
GO:0071793
AF-A0A3C2AM11-F1-model_v4 N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA 0.9605 144 375 GO:0016757
GO:0071793

Map