F348635

General Info

Members Datasets Scaffolds Average Seq Length
235 197 470 450

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2874628541|2874632299
Length 463
Sequence DHRNAKAITSVNDSIPAILPRGKGHQFVLYGDSCSGVPGALHEKTFASVNAVVQRLKPQPEFILFPGDEIIGLTPDADALRTQWRYWFDTEMAWLDRAAIPVWHTTGNHTTYDLTSEAVFRTLLDLPKNGPPGQAGLSYFVRRDDLLMVFVNTLWSGLGGEGHVEIDWLEATLRAHRDARHKLVLGHHPVFPINGFTGTYQREIGHEYTRPFWDVLVNENVLAYLCSHILAFDVQAHSGVLQICTAGAGTAHRMPEGVEYLHCVQAALDEQGLRYQVLDIDGAVRERLEWPPLDPHPAQWMQLPRGEAEATFPGPVQSGCRIELRLTGQSATTDVASAQTIFTAFAPGSIAPFWLGLRGPRQTLTAIVGRDPGRSPSYWFGPDFPDGESFDIHILIYPDMGPGGLLYRHHNTPRWSSFHSATARGVEQLSWPRHWAIGHGQGGGEDRPFRGTALNFQIARTEA

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
29 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
32 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
34 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
35 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
36 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
37 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
49 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
50 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
51 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
52 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
53 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
54 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
55 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
56 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
57 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
58 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
59 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
60 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
61 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
62 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
63 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
64 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
65 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
66 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
67 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
68 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
69 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
70 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
71 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
72 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
73 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
74 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
75 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
76 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
77 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
78 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
79 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
80 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
81 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
82 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
83 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
84 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
85 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
86 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
87 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
88 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
89 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
90 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
91 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
92 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
93 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
94 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
95 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
96 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
97 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
98 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
99 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
100 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
101 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
102 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
103 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
104 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
105 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
106 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
107 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
108 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
109 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
110 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
111 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
112 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
113 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
114 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
115 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
116 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
117 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
118 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
119 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
120 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
121 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
122 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
123 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
124 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
125 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
126 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
127 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
128 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
129 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
130 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
131 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
132 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
133 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
134 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
135 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
136 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
137 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
138 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
139 2922425934
140 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
141 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
142 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
143 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
144 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
145 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
146 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
147 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
148 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
149 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
150 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
151 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
152 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
153 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
154 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
155 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
156 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
157 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
158 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
159 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
160 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
161 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
162 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
163 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
164 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
165 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
166 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
167 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
168 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
169 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
170 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
171 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
172 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
173 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
174 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
175 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
176 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
177 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
178 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
179 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
180 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
181 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
182 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
183 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
184 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
185 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
186 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
187 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
188 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
189 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
190 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
191 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
192 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
193 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
194 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
195 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
196 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
197 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 57.26
Metatranscriptomes 0
Isolates 42.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.15
Nodule 31.91
Rhizoplane 5.53
Rhizosphere 26.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1001456 3300002987 Bacteria 9759
2 JGI25151J46595_10006297 3300003187 Bacteria 5991
3 JGI25165J46597_1004198 3300003214 Bacteria 3184
4 JGI25153J46596_10027202 3300003215 Bacteria 2009
5 JGI25160J50197_1000047 3300003354 Bacteria 136499
6 JGI25161J50226_1000033 3300003374 Bacteria 136499
7 Ga0055542_1003986 3300003762 Bacteria 3753
8 Ga0055543_1000075 3300004625 Bacteria 87163
9 Ga0065165_1000227 3300005262 Bacteria 98928
10 Ga0065165_1001250 3300005262 Bacteria 28850
11 Ga0070668_100044726 3300005347 Bacteria 3396
12 Ga0070671_100085703 3300005355 Bacteria 2636
13 Ga0070667_100046561 3300005367 Bacteria 3649
14 Ga0068852_100010743 3300005616 Bacteria 6856
15 Ga0068858_100213005 3300005842 Bacteria 1828
16 Ga0081540_1004473 3300005983 Bacteria 10641
17 Ga0075365_10015884 3300006038 Bacteria 4563
18 Ga0075365_10070676 3300006038 Bacteria 2349
19 Ga0075368_10002158 3300006042 Bacteria 6361
20 Ga0075363_100023830 3300006048 Bacteria 3106
21 Ga0075367_10012631 3300006178 Bacteria 4513
22 Ga0075366_10043286 3300006195 Bacteria 2667
23 Ga0075370_10014230 3300006353 Bacteria 4240
24 Ga0075370_10061713 3300006353 Bacteria 2135
25 Ga0105240_10000027 3300009093 Bacteria 348486
26 Ga0105240_10023560 3300009093 Bacteria 8136
27 Ga0105240_10056683 3300009093 Bacteria 4902
28 Ga0105245_10091711 3300009098 Bacteria 2797
29 Ga0105245_10165414 3300009098 Bacteria 2102
30 Ga0105241_10071027 3300009174 Bacteria 2702
31 Ga0105237_10008028 3300009545 Bacteria 11483
32 Ga0105239_10006063 3300010375 Bacteria 14074
33 Ga0105239_10113520 3300010375 Bacteria 3005
34 Ga0105239_10162077 3300010375 Bacteria 2499
35 Ga0157370_10000177 3300013104 Bacteria 79598
36 Ga0182005_1019680 3300015265 Bacteria 1859
37 Ga0209677_100358 3300025253 Bacteria 28237
38 Ga0209677_101693 3300025253 Bacteria 9199
39 Ga0209148_1000493 3300025254 Bacteria 40546
40 Ga0209233_1000064 3300025261 Bacteria 392156
41 Ga0209233_1001867 3300025261 Bacteria 8091
42 Ga0209233_1013791 3300025261 Bacteria 2299
43 Ga0209455_1002901 3300025272 Bacteria 6330
44 Ga0209130_1000038 3300025284 Bacteria 264226
45 Ga0209025_1010990 3300025294 Bacteria 6043
46 Ga0209758_1001724 3300025297 Bacteria 24383
47 Ga0209758_1015035 3300025297 Bacteria 4046
48 Ga0207426_1000081 3300025302 Bacteria 304502
49 Ga0209257_1010568 3300025304 Bacteria 4640
50 Ga0207647_10016004 3300025904 Bacteria 5126
51 Ga0207695_10000006 3300025913 Bacteria 1135309
52 Ga0207695_10000024 3300025913 Bacteria 632311
53 Ga0207695_10220423 3300025913 Bacteria 1804
54 Ga0207671_10001001 3300025914 Bacteria 34722
55 Ga0207671_10008849 3300025914 Bacteria 8478
56 Ga0207687_10072467 3300025927 Bacteria 2464
57 Ga0207706_10144855 3300025933 Bacteria 2090
58 Ga0207668_10067240 3300025972 Bacteria 2544
59 Ga0207640_10023198 3300025981 Bacteria 3727
60 Ga0207658_10025773 3300025986 Bacteria 4118
61 Ga0207703_10207530 3300026035 Bacteria 1744
62 Ga0207702_10140906 3300026078 Bacteria 2182
63 Ga0209389_1000092 3300027296 Bacteria 82555
64 Ga0209589_1000115 3300027357 Bacteria 82537
65 Ga0209489_100340 3300027361 Bacteria 82555
66 Ga0307516_10030546 3300031730 Bacteria 5436
67 Ga0315911_1000007 3300033442 Bacteria 413725
68 Ga0495629_0002161 3300046459 Bacteria 15188
69 Ga0495583_0009688 3300046506 Bacteria 5725
70 Ga0495606_0002036 3300046507 Bacteria 24770
71 Ga0495606_0012043 3300046507 Bacteria 6979
72 Ga0495610_0015872 3300046512 Bacteria 4357
73 Ga0495618_0121633 3300046514 Bacteria 1672
74 Ga0495643_0056709 3300046522 Bacteria 2089
75 Ga0495625_0117385 3300046660 Bacteria 1814
76 Ga0495657_0005554 3300046675 Bacteria 9960
77 Ga0495613_0017679 3300046689 Bacteria 5312
78 Ga0495624_0008680 3300046690 Bacteria 7077
79 Ga0495687_035604 3300047443 Bacteria 2236
80 Ga0495593_0080416 3300047673 Bacteria 1686
81 Ga0495602_0167396 3300048088 Bacteria 1709
82 Ga0496100_0024074 3300048903 Bacteria 3708
83 Ga0496100_0113382 3300048903 Bacteria 1887
84 Ga0496101_0033197 3300048904 Bacteria 3638
85 Ga0496102_0002326 3300048905 Bacteria 16233
86 Ga0496102_0049112 3300048905 Bacteria 3838
87 Ga0496102_0090407 3300048905 Bacteria 2833
88 Ga0496103_0008910 3300048906 Bacteria 5948
89 Ga0496103_0022145 3300048906 Bacteria 3825
90 Ga0496105_0002509 3300048908 Bacteria 13312
91 Ga0496105_0124912 3300048908 Bacteria 2121
92 Ga0496106_0000170 3300048909 Bacteria 47443
93 Ga0496108_0068947 3300048911 Bacteria 2984
94 Ga0496113_0034827 3300048916 Bacteria 3677
95 Ga0496116_0007655 3300048919 Bacteria 9528
96 Ga0496116_0013879 3300048919 Bacteria 6464
97 Ga0496117_0000337 3300048920 Bacteria 82874
98 Ga0496118_0001216 3300048921 Bacteria 39616
99 Ga0496118_0017186 3300048921 Bacteria 6599
100 Ga0496118_0035971 3300048921 Bacteria 4012
101 Ga0496118_0087079 3300048921 Bacteria 2168
102 Ga0496119_0001979 3300048922 Bacteria 23271
103 Ga0496119_0007324 3300048922 Bacteria 9983
104 Ga0496119_0050821 3300048922 Bacteria 2552
105 Ga0496120_0010118 3300048923 Bacteria 6609
106 Ga0496120_0056855 3300048923 Bacteria 2205
107 Ga0496121_0002268 3300048924 Bacteria 29933
108 Ga0496121_0042601 3300048924 Bacteria 3944
109 Ga0496121_0072525 3300048924 Bacteria 2764
110 Ga0496122_0008337 3300048925 Bacteria 11211
111 Ga0496122_0024239 3300048925 Bacteria 5315
112 Ga0496123_0003388 3300048926 Bacteria 17975
113 Ga0496123_0029141 3300048926 Bacteria 4074
114 Ga0496124_0000740 3300048927 Bacteria 53495
115 Ga0496124_0015505 3300048927 Bacteria 7296
116 Ga0496125_0008314 3300048928 Bacteria 10894
117 Ga0496125_0040743 3300048928 Bacteria 3980
118 Ga0496125_0050727 3300048928 Bacteria 3432
119 Ga0496126_0028321 3300048929 Bacteria 5340
120 Ga0501073_0031084 3300049589 Bacteria 3811
121 nmdc:mga03683_10453_c1 3300050489 Bacteria 3328
122 nmdc:mga00v17_29399_c1 3300050491 Bacteria 2853
123 nmdc:mga04h51_13566_c1 3300050495 Bacteria 2310
124 nmdc:mga07m45_11778_c1 3300050496 Bacteria 4603
125 Ga0500578_0044121 3300053086 Bacteria 2862
126 Ga0500578_0098941 3300053086 Bacteria 1847
127 Ga0500569_009619 3300053109 Bacteria 2252
128 Ga0500595_034380 3300053119 Bacteria 1676
129 Ga0500618_007163 3300053125 Bacteria 3208
130 Ga0500590_002906 3300053148 Bacteria 7769
131 Ga0500622_0000335 3300053156 Bacteria 46130
132 Ga0500636_0000915 3300053177 Bacteria 15899
133 Ga0500636_0054117 3300053177 Bacteria 2353
134 Ga0500601_000124 3300053737 Bacteria 15930
135 2874632299 2874628541 Bacteria 8630250
136 2509073495 2508501114 Bacteria 7082538
137 2509080321 2508501114 Bacteria 7082538
138 2511136086 2510917022 Bacteria 6504556
139 2511196559 2510917030 Bacteria 7460662
140 2513861553 2513237137 Bacteria 9558895
141 2517106590 2517093001 Bacteria 9002274
142 2524457834 2524023209 Bacteria 6679728
143 2524536352 2524023228 Bacteria 10118060
144 2528856153 2528768022 Bacteria 10457665
145 2585225548 2582581298 Bacteria 7315509
146 2585275835 2582581307 Bacteria 6597605
147 2585278718 2582581308 Bacteria 7413247
148 2585325667 2582581315 Bacteria 7318924
149 2585535828 2585427527 Bacteria 7273426
150 2585548177 2585427529 Bacteria 7395659
151 2585554091 2585427530 Bacteria 7383882
152 2585559245 2585427531 Bacteria 6992870
153 2585901293 2585427608 Bacteria 6544331
154 2585905380 2585427609 Bacteria 6667127
155 2587979504 2585428125 Bacteria 6662905
156 2616306008 2615840626 Bacteria 7921970
157 2616553746 2615840698 Bacteria 7319877
158 2617386766 2617270742 Bacteria 6808054
159 2776263855 2775506901 Bacteria 9631051
160 2793069174 2791355197 Bacteria 8420563
161 2819639439 2818991453 Bacteria 7181617
162 2821449278 2821443989 Bacteria 7658172
163 2824667321 2824661429 Bacteria 9877870
164 2841948506 2841941048 Bacteria 8688029
165 2841979447 2841974524 Bacteria 8931498
166 2842300551 2842298080 Bacteria 6123127
167 2842358331 2842357229 Bacteria 6485165
168 2842482669 2842482326 Bacteria 7212537
169 2842509528 2842509118 Bacteria 6850950
170 2844535321 2844533157 Bacteria 7517899
171 2852388863 2852387548 Bacteria 8025568
172 2879100690 2879099564 Bacteria 10442239
173 2881673078 2881665667 Bacteria 8175609
174 2885374892 2885374607 Bacteria 8927485
175 2903754306 2903748898 Bacteria 9972761
176 2919100946 2919100787 Bacteria 7710546
177 2922427398
178 2929615705 2929615660 Bacteria 9193770
179 2929630320 2929624759 Bacteria 9339455
180 2932791852 2932784394 Bacteria 9704911
181 2932796321 2932794094 Bacteria 7915132
182 2932804373 2932801729 Bacteria 7987968
183 2932815593 2932809354 Bacteria 9135765
184 2932819334 2932818245 Bacteria 9955613
185 2932836024 2932828146 Bacteria 9745859
186 2933579008 2933577622 Bacteria 9116884
187 2935624254 2935616580 Bacteria 9032984
188 2935637567 2935630451 Bacteria 8169952
189 2935647774 2935638405 Bacteria 10015038
190 2935674797 2935665750 Bacteria 9571747
191 2935688216 2935684952 Bacteria 9590419
192 2935698879 2935694250 Bacteria 9291695
193 2935708499 2935703347 Bacteria 10242284
194 2935715235 2935713505 Bacteria 9608509
195 2935726200 2935722832 Bacteria 9608746
196 2935734054 2935732158 Bacteria 9706831
197 2935743433 2935741537 Bacteria 9707219
198 2935754529 2935750917 Bacteria 9590372
199 2935768299 2935760218 Bacteria 9817913
200 2935809331 2935801545 Bacteria 9301974
201 2935819453 2935810662 Bacteria 9401221
202 2935837258 2935827899 Bacteria 10038562
203 2935846517 2935837841 Bacteria 9454360
204 2935862712 2935855204 Bacteria 9035059
205 2935871690 2935864058 Bacteria 9784707
206 2935881943 2935873716 Bacteria 9632195
207 2935888784 2935883170 Bacteria 7964738
208 2935998788 2935992306 Bacteria 9802711
209 2936007344 2936002035 Bacteria 9362176
210 2936046298 2936037263 Bacteria 9446081
211 2940560094 2940556831 Bacteria 9590747
212 2941514060 2941507105 Bacteria 8166816
213 2941522021 2941515067 Bacteria 8166720
214 2941529759 2941523033 Bacteria 8169134
215 2941546936 2941538514 Bacteria 9402094
216 3005417665 3005416602 Bacteria 7064308
217 3005477118 3005474847 Bacteria 9259049
218 3005484687 3005483717 Bacteria 7877331
219 3005596085 3005594810 Bacteria 8716512
220 8005315020 8005314921 Bacteria 7072929
221 8005485817 8005484373 Bacteria 6297373
222 8005684790 8005682033 Bacteria 6726518
223 8006938330 8006933436 Bacteria 10410654
224 8006978407 8006973647 Bacteria 10679141
225 8016514472 8016511872 Bacteria 9921665
226 8017061953 8017057580 Bacteria 10023680
227 8019560700 8019555841 Bacteria 9642137
228 8019570784 8019565922 Bacteria 9639779
229 8019581491 8019576017 Bacteria 10049540
230 8019589119 8019586578 Bacteria 10212056
231 8019602114 8019597564 Bacteria 10041141
232 8019616442 8019608314 Bacteria 10042931
233 8046770097 8046767195 Bacteria 7547379
234 8055747353 8055742211 Bacteria 9226248
235 8057579011 8057575449 Bacteria 7367519
236 JGI25159J45721_1001456
237 JGI25151J46595_10006297
238 JGI25165J46597_1004198
239 JGI25153J46596_10027202
240 JGI25160J50197_1000047
241 JGI25161J50226_1000033
242 Ga0055542_1003986
243 Ga0055543_1000075
244 Ga0065165_1000227
245 Ga0065165_1001250
246 Ga0070668_100044726
247 Ga0070671_100085703
248 Ga0070667_100046561
249 Ga0068852_100010743
250 Ga0068858_100213005
251 Ga0081540_1004473
252 Ga0075365_10015884
253 Ga0075365_10070676
254 Ga0075368_10002158
255 Ga0075363_100023830
256 Ga0075367_10012631
257 Ga0075366_10043286
258 Ga0075370_10014230
259 Ga0075370_10061713
260 Ga0105240_10000027
261 Ga0105240_10023560
262 Ga0105240_10056683
263 Ga0105245_10091711
264 Ga0105245_10165414
265 Ga0105241_10071027
266 Ga0105237_10008028
267 Ga0105239_10006063
268 Ga0105239_10113520
269 Ga0105239_10162077
270 Ga0157370_10000177
271 Ga0182005_1019680
272 Ga0209677_100358
273 Ga0209677_101693
274 Ga0209148_1000493
275 Ga0209233_1000064
276 Ga0209233_1001867
277 Ga0209233_1013791
278 Ga0209455_1002901
279 Ga0209130_1000038
280 Ga0209025_1010990
281 Ga0209758_1001724
282 Ga0209758_1015035
283 Ga0207426_1000081
284 Ga0209257_1010568
285 Ga0207647_10016004
286 Ga0207695_10000006
287 Ga0207695_10000024
288 Ga0207695_10220423
289 Ga0207671_10001001
290 Ga0207671_10008849
291 Ga0207687_10072467
292 Ga0207706_10144855
293 Ga0207668_10067240
294 Ga0207640_10023198
295 Ga0207658_10025773
296 Ga0207703_10207530
297 Ga0207702_10140906
298 Ga0209389_1000092
299 Ga0209589_1000115
300 Ga0209489_100340
301 Ga0307516_10030546
302 Ga0315911_1000007
303 Ga0495629_0002161
304 Ga0495583_0009688
305 Ga0495606_0002036
306 Ga0495606_0012043
307 Ga0495610_0015872
308 Ga0495618_0121633
309 Ga0495643_0056709
310 Ga0495625_0117385
311 Ga0495657_0005554
312 Ga0495613_0017679
313 Ga0495624_0008680
314 Ga0495687_035604
315 Ga0495593_0080416
316 Ga0495602_0167396
317 Ga0496100_0024074
318 Ga0496100_0113382
319 Ga0496101_0033197
320 Ga0496102_0002326
321 Ga0496102_0049112
322 Ga0496102_0090407
323 Ga0496103_0008910
324 Ga0496103_0022145
325 Ga0496105_0002509
326 Ga0496105_0124912
327 Ga0496106_0000170
328 Ga0496108_0068947
329 Ga0496113_0034827
330 Ga0496116_0007655
331 Ga0496116_0013879
332 Ga0496117_0000337
333 Ga0496118_0001216
334 Ga0496118_0017186
335 Ga0496118_0035971
336 Ga0496118_0087079
337 Ga0496119_0001979
338 Ga0496119_0007324
339 Ga0496119_0050821
340 Ga0496120_0010118
341 Ga0496120_0056855
342 Ga0496121_0002268
343 Ga0496121_0042601
344 Ga0496121_0072525
345 Ga0496122_0008337
346 Ga0496122_0024239
347 Ga0496123_0003388
348 Ga0496123_0029141
349 Ga0496124_0000740
350 Ga0496124_0015505
351 Ga0496125_0008314
352 Ga0496125_0040743
353 Ga0496125_0050727
354 Ga0496126_0028321
355 Ga0501073_0031084
356 nmdc:mga03683_10453_c1
357 nmdc:mga00v17_29399_c1
358 nmdc:mga04h51_13566_c1
359 nmdc:mga07m45_11778_c1
360 Ga0500578_0044121
361 Ga0500578_0098941
362 Ga0500569_009619
363 Ga0500595_034380
364 Ga0500618_007163
365 Ga0500590_002906
366 Ga0500622_0000335
367 Ga0500636_0000915
368 Ga0500636_0054117
369 Ga0500601_000124
370 2874632299
371 2509073495
372 2509080321
373 2511136086
374 2511196559
375 2513861553
376 2517106590
377 2524457834
378 2524536352
379 2528856153
380 2585225548
381 2585275835
382 2585278718
383 2585325667
384 2585535828
385 2585548177
386 2585554091
387 2585559245
388 2585901293
389 2585905380
390 2587979504
391 2616306008
392 2616553746
393 2617386766
394 2776263855
395 2793069174
396 2819639439
397 2821449278
398 2824667321
399 2841948506
400 2841979447
401 2842300551
402 2842358331
403 2842482669
404 2842509528
405 2844535321
406 2852388863
407 2879100690
408 2881673078
409 2885374892
410 2903754306
411 2919100946
412 2922427398
413 2929615705
414 2929630320
415 2932791852
416 2932796321
417 2932804373
418 2932815593
419 2932819334
420 2932836024
421 2933579008
422 2935624254
423 2935637567
424 2935647774
425 2935674797
426 2935688216
427 2935698879
428 2935708499
429 2935715235
430 2935726200
431 2935734054
432 2935743433
433 2935754529
434 2935768299
435 2935809331
436 2935819453
437 2935837258
438 2935846517
439 2935862712
440 2935871690
441 2935881943
442 2935888784
443 2935998788
444 2936007344
445 2936046298
446 2940560094
447 2941514060
448 2941522021
449 2941529759
450 2941546936
451 3005417665
452 3005477118
453 3005484687
454 3005596085
455 8005315020
456 8005485817
457 8005684790
458 8006938330
459 8006978407
460 8016514472
461 8017061953
462 8019560700
463 8019570784
464 8019581491
465 8019589119
466 8019602114
467 8019616442
468 8046770097
469 8055747353
470 8057579011

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hy1-assembly1.cif.gz_A-2 crystal structure of rv0805 0.7667 9 269
2hy1-assembly1.cif.gz_A-2 crystal structure of rv0805 0.7607 9 269
6zsb-assembly1.cif.gz_XP human mitochondrial ribosome in complex with mrna and p-site trna 0.7574 255 280
2hyo-assembly1.cif.gz_A-2 crystal structure of rv0805 n97a mutant 0.7409 9 269
7oic-assembly1.cif.gz_P cryo-em structure of late human 39s mitoribosome assembly intermediates, state 4 0.7352 255 280
ID Description Score Start End Superfamily
af_P77277_21_122_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.8235 257 280 3.90.180.10
2hypA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7957 9 269 3.60.21.10
2hypA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7899 9 269 3.60.21.10
af_Q23155_77_208_3.30.420.80 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.7586 257 284 3.30.420.80
af_Q8IM55_21_293_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7556 16 272 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A6J4VSE4-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.962 4 233 GO:0005737
GO:0016787
AF-A0A2V6YVJ5-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.957 6 452 GO:0005737
GO:0016787
AF-A0A401TUZ4-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.955 4 191 GO:0016787
AF-A0A2V6YVJ5-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9549 6 452 GO:0005737
GO:0016787
AF-A0A7R6Z7P9-F1-model_v4 deleted 0.9532 28 144

Map