F348386

General Info

Members Datasets Scaffolds Average Seq Length
235 117 229 253

Family's Representative Sequence

Representative Sequence 3300044719|Ga0466971_0171896|Ga0466971_0171896_26_910
Length 294
Sequence MNEASERLLAELTIPWLIRAFTRSATLGDVRIATWNVNSVVARLPRLIDWLGIAEPDVVCLQELKSGEFPVDEVAALGYEVAAHTTGRWSGVAILSRVGLTDERAGLRAEPGFLPEGSLLEVTEPRAVAATCAGLRVWSVYVPNGRMPGHPHYEYKLRWLAALRETVVEELPTHARLAVLGDFNIAPTDADVFDPAAFVGLTHVTPPERAALAELRDVGLRDIVPRALKYDTPFTYWDYRAGAFHKNLGMRIDLVYASAPLADAVTDAYVDRDARKGTQPSDHAPVVVDLEVAS

Samples

Sample ID Description Type Environment
1 2582580736 Prauserella sp. Am3 Isolate Unclassified
2 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
3 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
4 2842711865 Duganella sp. R-73148 Isolate Unclassified
5 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
6 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
14 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
15 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
16 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
17 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
18 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
19 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
20 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
25 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
26 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
27 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
28 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
29 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
30 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
31 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
32 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
33 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
34 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
35 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
36 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
37 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
38 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
39 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
40 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
41 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
42 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
43 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
44 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
45 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
46 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
47 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
48 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
49 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
50 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
51 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
52 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
53 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
54 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
55 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
56 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
57 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
58 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
59 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
60 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
61 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
62 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
63 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
64 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
65 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
66 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
67 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
68 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
69 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
70 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
71 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
72 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
73 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
74 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
75 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
76 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
77 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
78 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
79 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
80 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
81 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
82 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
83 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
84 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
85 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
86 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
87 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
88 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
89 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
90 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
91 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
92 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
93 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
94 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
95 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
96 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
97 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
98 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
99 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
100 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
101 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
102 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
103 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
104 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
107 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
115 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
116 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
117 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.45
Metatranscriptomes 0
Isolates 2.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0.43
Rhizoplane 0.43
Rhizosphere 95.32
Stem 0
Stem Tuber 0.43
Unclassified 2.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10079254 3300001990 Bacteria 978
2 JGI25154J39366_1000304 3300002738 Bacteria 29042
3 Ga0070694_100151222 3300005444 Bacteria 1695
4 Ga0070697_100002039 3300005536 Bacteria 15476
5 Ga0068855_100004626 3300005563 Bacteria 16790
6 Ga0068856_100849259 3300005614 Bacteria 932
7 Ga0070717_10160819 3300006028 Bacteria 1948
8 Ga0075430_100406386 3300006846 Bacteria 1124
9 Ga0105237_10090319 3300009545 Bacteria 3053
10 Ga0105237_10199204 3300009545 Bacteria 2002
11 Ga0105239_10953539 3300010375 Bacteria 985
12 Ga0182006_1000290 3300015261 Bacteria 44220
13 Ga0182007_10024152 3300015262 Bacteria 2130
14 Ga0182005_1000005 3300015265 Bacteria 537378
15 Ga0207671_10290125 3300025914 Bacteria 1291
16 Ga0207667_10009171 3300025949 Bacteria 11683
17 Ga0207674_10291432 3300026116 Bacteria 1581
18 Ga0207698_10258586 3300026142 Bacteria 1598
19 Ga0209281_1002187 3300027111 Bacteria 8458
20 Ga0265328_10013275 3300031239 Bacteria 3265
21 Ga0307513_10253628 3300031456 Bacteria 1554
22 Ga0307409_100501825 3300031995 Bacteria 1182
23 Ga0395899_0000240 3300037312 Bacteria 73097
24 Ga0436361_0723034 3300039447 Bacteria 14253
25 Ga0466972_0043273 3300044658 Bacteria 2188
26 Ga0453683_0004145 3300044673 Bacteria 10386
27 Ga0466966_0004655 3300044684 Bacteria 9036
28 Ga0466966_0016655 3300044684 Bacteria 4855
29 Ga0466966_0033750 3300044684 Bacteria 3312
30 Ga0466966_0051545 3300044684 Bacteria 2616
31 Ga0466966_0111764 3300044684 Bacteria 1684
32 Ga0466961_0015361 3300044693 Bacteria 4917
33 Ga0466961_0020019 3300044693 Bacteria 4305
34 Ga0466961_0076998 3300044693 Bacteria 2113
35 Ga0466961_0082578 3300044693 Bacteria 2032
36 Ga0466961_0119399 3300044693 Bacteria 1656
37 Ga0466961_0268558 3300044693 Bacteria 1045
38 Ga0466963_0019194 3300044694 Bacteria 4284
39 Ga0466963_0042043 3300044694 Bacteria 2999
40 Ga0466963_0073457 3300044694 Bacteria 2306
41 Ga0466963_0176580 3300044694 Bacteria 1490
42 Ga0466963_0301008 3300044694 Bacteria 1128
43 Ga0466964_0023575 3300044706 Bacteria 2393
44 Ga0466971_0056500 3300044719 Bacteria 1770
45 Ga0466971_0171896 3300044719 Bacteria 1017
46 Ga0466957_0243083 3300044842 Bacteria 1195
47 Ga0466957_0297921 3300044842 Bacteria 1083
48 Ga0466960_0042727 3300044901 Bacteria 2153
49 Ga0466959_0016803 3300045049 Bacteria 5354
50 Ga0466959_0065440 3300045049 Bacteria 2638
51 Ga0466959_0082399 3300045049 Bacteria 2317
52 Ga0466959_0152113 3300045049 Bacteria 1631
53 Ga0451576_0006977 3300045051 Bacteria 13670
54 Ga0451576_0106525 3300045051 Bacteria 2917
55 Ga0466958_0039110 3300045836 Bacteria 2848
56 Ga0466958_0070714 3300045836 Bacteria 2136
57 Ga0466958_0081065 3300045836 Bacteria 1997
58 Ga0466958_0104951 3300045836 Bacteria 1760
59 Ga0466958_0159724 3300045836 Bacteria 1423
60 Ga0466967_0005244 3300045976 Bacteria 8933
61 Ga0466967_0009588 3300045976 Bacteria 7197
62 Ga0466967_0010498 3300045976 Bacteria 6953
63 Ga0466967_0163567 3300045976 Bacteria 2090
64 Ga0466967_0307762 3300045976 Bacteria 1525
65 Ga0495617_000367 3300046452 Bacteria 24951
66 Ga0495617_004028 3300046452 Bacteria 5396
67 Ga0495603_0053483 3300046455 Bacteria 2395
68 Ga0495603_0066151 3300046455 Bacteria 2129
69 Ga0495590_0000189 3300046457 Bacteria 35045
70 Ga0495629_0012541 3300046459 Bacteria 6138
71 Ga0495629_0024040 3300046459 Bacteria 4339
72 Ga0495638_0000765 3300046460 Bacteria 34151
73 Ga0495638_0034382 3300046460 Bacteria 3235
74 Ga0495638_0037159 3300046460 Bacteria 3099
75 Ga0495638_0053823 3300046460 Bacteria 2504
76 Ga0495638_0055649 3300046460 Bacteria 2456
77 Ga0495650_0000011 3300046471 Bacteria 615329
78 Ga0495650_0001491 3300046471 Bacteria 22322
79 Ga0495650_0004353 3300046471 Bacteria 9757
80 Ga0495650_0116956 3300046471 Bacteria 984
81 Ga0495580_0047743 3300046472 Bacteria 3034
82 Ga0495580_0063155 3300046472 Bacteria 2598
83 Ga0495582_0207278 3300046473 Bacteria 1120
84 Ga0495605_0000612 3300046474 Bacteria 27908
85 Ga0495605_0020310 3300046474 Bacteria 3531
86 Ga0495584_0000007 3300046491 Bacteria 294820
87 Ga0495584_0004691 3300046491 Bacteria 7317
88 Ga0495584_0005394 3300046491 Bacteria 6773
89 Ga0495584_0100061 3300046491 Bacteria 1465
90 Ga0495585_0000802 3300046492 Bacteria 27376
91 Ga0495585_0002050 3300046492 Bacteria 14848
92 Ga0495585_0002293 3300046492 Bacteria 13797
93 Ga0495585_0004827 3300046492 Bacteria 8655
94 Ga0495585_0005844 3300046492 Bacteria 7714
95 Ga0495585_0017188 3300046492 Bacteria 4183
96 Ga0495585_0072271 3300046492 Bacteria 1880
97 Ga0495594_0001819 3300046499 Bacteria 11094
98 Ga0495594_0117028 3300046499 Bacteria 1505
99 Ga0495596_0000996 3300046500 Bacteria 16842
100 Ga0495596_0004185 3300046500 Bacteria 7085
101 Ga0495607_0000871 3300046501 Bacteria 28299
102 Ga0495607_0091620 3300046501 Bacteria 1646
103 Ga0495583_0001333 3300046506 Bacteria 25619
104 Ga0495583_0001516 3300046506 Bacteria 23065
105 Ga0495583_0014520 3300046506 Bacteria 4342
106 Ga0495583_0047715 3300046506 Bacteria 1968
107 Ga0495606_0004462 3300046507 Bacteria 13960
108 Ga0495606_0009381 3300046507 Bacteria 8286
109 Ga0495606_0058132 3300046507 Bacteria 2487
110 Ga0495610_0003826 3300046512 Bacteria 11465
111 Ga0495610_0021525 3300046512 Bacteria 3544
112 Ga0495616_0005664 3300046513 Bacteria 7650
113 Ga0495616_0005980 3300046513 Bacteria 7422
114 Ga0495616_0047822 3300046513 Bacteria 2152
115 Ga0495620_0002957 3300046515 Bacteria 9776
116 Ga0495630_0016553 3300046517 Bacteria 5392
117 Ga0495631_0006235 3300046518 Bacteria 6177
118 Ga0495631_0066963 3300046518 Bacteria 1554
119 Ga0495637_0010016 3300046520 Bacteria 4605
120 Ga0495637_0028260 3300046520 Bacteria 2506
121 Ga0495643_0000576 3300046522 Bacteria 45056
122 Ga0495643_0001479 3300046522 Bacteria 21441
123 Ga0495643_0001689 3300046522 Bacteria 19245
124 Ga0495648_0001292 3300046524 Bacteria 24903
125 Ga0495648_0001432 3300046524 Bacteria 23348
126 Ga0495648_0036112 3300046524 Bacteria 3194
127 Ga0495648_0043414 3300046524 Bacteria 2818
128 Ga0495666_0011490 3300046526 Bacteria 4414
129 Ga0495666_0018196 3300046526 Bacteria 3499
130 Ga0495666_0020999 3300046526 Bacteria 3233
131 Ga0495642_0001415 3300046528 Bacteria 10754
132 Ga0495642_0002435 3300046528 Bacteria 7576
133 Ga0495642_0040567 3300046528 Bacteria 1891
134 Ga0495642_0108184 3300046528 Bacteria 1187
135 Ga0495652_0022220 3300046529 Bacteria 5631
136 Ga0495665_0009788 3300046531 Bacteria 5189
137 Ga0495665_0016285 3300046531 Bacteria 4005
138 Ga0495665_0027664 3300046531 Bacteria 3042
139 Ga0495587_0004267 3300046536 Bacteria 9441
140 Ga0495609_0028709 3300046538 Bacteria 2538
141 Ga0495609_0028814 3300046538 Bacteria 2532
142 Ga0495597_0001069 3300046542 Bacteria 20901
143 Ga0495597_0002269 3300046542 Bacteria 12498
144 Ga0495597_0006678 3300046542 Bacteria 5940
145 Ga0495597_0116569 3300046542 Bacteria 1116
146 Ga0495622_0019394 3300046557 Bacteria 3166
147 Ga0495633_0000606 3300046558 Bacteria 34316
148 Ga0495633_0001184 3300046558 Bacteria 20944
149 Ga0495633_0005059 3300046558 Bacteria 8212
150 Ga0495633_0011595 3300046558 Bacteria 4743
151 Ga0495633_0012817 3300046558 Bacteria 4442
152 Ga0495633_0013847 3300046558 Bacteria 4233
153 Ga0495633_0026899 3300046558 Bacteria 2816
154 Ga0495633_0076007 3300046558 Bacteria 1564
155 Ga0495633_0107581 3300046558 Bacteria 1293
156 Ga0495668_0006853 3300046616 Bacteria 7385
157 Ga0495668_0015768 3300046616 Bacteria 4405
158 Ga0495668_0016566 3300046616 Bacteria 4283
159 Ga0495634_0031184 3300046642 Bacteria 3673
160 Ga0495611_0006507 3300046648 Bacteria 4978
161 Ga0495611_0018916 3300046648 Bacteria 2956
162 Ga0495611_0235375 3300046648 Bacteria 850
163 Ga0495625_0001154 3300046660 Bacteria 34018
164 Ga0495625_0004399 3300046660 Bacteria 13358
165 Ga0495625_0008795 3300046660 Bacteria 8551
166 Ga0495625_0024391 3300046660 Bacteria 4604
167 Ga0495625_0049303 3300046660 Bacteria 3028
168 Ga0495625_0082519 3300046660 Bacteria 2235
169 Ga0495625_0146485 3300046660 Bacteria 1590
170 Ga0495661_0037626 3300046665 Bacteria 3019
171 Ga0495588_0004845 3300046674 Bacteria 5963
172 Ga0495588_0051754 3300046674 Bacteria 2115
173 Ga0495588_0078047 3300046674 Bacteria 1727
174 Ga0495588_0114723 3300046674 Bacteria 1419
175 Ga0495669_0007101 3300046684 Bacteria 4691
176 Ga0495613_0009611 3300046689 Bacteria 7184
177 Ga0495670_0002431 3300046691 Bacteria 9201
178 Ga0495670_0018710 3300046691 Bacteria 3412
179 Ga0495670_0045542 3300046691 Bacteria 2190
180 Ga0495670_0093250 3300046691 Bacteria 1543
181 Ga0495670_0093507 3300046691 Bacteria 1541
182 Ga0495670_0265007 3300046691 Bacteria 917
183 Ga0495671_0011387 3300046692 Bacteria 4896
184 Ga0495671_0030393 3300046692 Bacteria 2767
185 Ga0495649_0033570 3300046694 Bacteria 2824
186 Ga0495600_0010349 3300046809 Bacteria 5788
187 Ga0495660_0001303 3300046810 Bacteria 17256
188 Ga0495660_0052934 3300046810 Bacteria 2205
189 Ga0495660_0076839 3300046810 Bacteria 1758
190 Ga0495581_0011595 3300047315 Bacteria 5100
191 Ga0495581_0018205 3300047315 Bacteria 4080
192 Ga0495604_0088363 3300047317 Bacteria 2305
193 Ga0495674_0001855 3300047319 Bacteria 20817
194 Ga0495674_0098850 3300047319 Bacteria 2485
195 Ga0495672_0000883 3300047320 Bacteria 31542
196 Ga0495676_0050565 3300047321 Bacteria 3332
197 Ga0495683_0000083 3300047323 Bacteria 93743
198 Ga0495683_0026207 3300047323 Bacteria 2983
199 Ga0495687_003194 3300047443 Bacteria 12165
200 Ga0495687_003802 3300047443 Bacteria 10649
201 Ga0495687_091566 3300047443 Bacteria 1163
202 Ga0495675_0006208 3300047444 Bacteria 7307
203 Ga0495677_0033882 3300047445 Bacteria 1862
204 Ga0495673_0000522 3300047469 Bacteria 40373
205 Ga0495681_0007780 3300047470 Bacteria 6792
206 Ga0495681_0032663 3300047470 Bacteria 2617
207 Ga0495681_0089142 3300047470 Bacteria 1365
208 Ga0495681_0128263 3300047470 Bacteria 1082
209 Ga0495593_0010665 3300047673 Bacteria 5299
210 Ga0495602_0029974 3300048088 Bacteria 5169
211 Ga0495614_0025028 3300048089 Bacteria 2576
212 Ga0495615_0001768 3300048090 Bacteria 3299
213 Ga0495626_0008326 3300048091 Bacteria 5697
214 Ga0495626_0011078 3300048091 Bacteria 4782
215 Ga0496115_0061428 3300048918 Bacteria 3029
216 Ga0496116_0030348 3300048919 Bacteria 3886
217 Ga0495678_000454 3300049459 Bacteria 40665
218 Ga0495678_009286 3300049459 Bacteria 4880
219 Ga0495678_030897 3300049459 Bacteria 2237
220 Ga0501031_0026738 3300049568 Bacteria 3762
221 Ga0501032_0074949 3300049569 Bacteria 2254
222 Ga0501034_0120796 3300049571 Bacteria 2606
223 Ga0501038_0025395 3300049574 Bacteria 5282
224 Ga0501039_0011335 3300049575 Bacteria 6789
225 Ga0501047_0139437 3300049581 Bacteria 2304
226 Ga0501075_0179868 3300049591 Bacteria 1614
227 nmdc:mga0rr50_485608_c1 3300050513 Bacteria 1049
228 Ga0500594_0127867 3300053118 Bacteria 802
229 Ga0500586_000385 3300053145 Bacteria 8833

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10291432 Ga0207674_102914323 215
2 iso_pu_bacteria 2842711865 2842714941 230
3 3300046660 Ga0495625_0146485 Ga0495625_0146485_805_1569 233
4 3300048090 Ga0495615_0001768 Ga0495615_0001768_1373_2137 233
5 3300015261 Ga0182006_1000290 Ga0182006_100029022 234
6 3300015262 Ga0182007_10024152 Ga0182007_100241523 234
7 3300015265 Ga0182005_1000005 Ga0182005_1000005436 234
8 3300046457 Ga0495590_0000189 Ga0495590_0000189_7245_7955 234
9 3300046460 Ga0495638_0000765 Ga0495638_0000765_11016_11726 234
10 3300046460 Ga0495638_0037159 Ga0495638_0037159_406_1116 234
11 3300046460 Ga0495638_0055649 Ga0495638_0055649_221_931 234
12 3300046471 Ga0495650_0001491 Ga0495650_0001491_10731_11441 234
13 3300046471 Ga0495650_0004353 Ga0495650_0004353_2727_3437 234
14 3300046474 Ga0495605_0000612 Ga0495605_0000612_19690_20400 234
15 3300046506 Ga0495583_0001516 Ga0495583_0001516_11388_12098 234
16 3300046512 Ga0495610_0003826 Ga0495610_0003826_2113_2823 234
17 3300046512 Ga0495610_0021525 Ga0495610_0021525_700_1410 234
18 3300046522 Ga0495643_0000576 Ga0495643_0000576_28516_29226 234
19 3300046522 Ga0495643_0001479 Ga0495643_0001479_6656_7366 234
20 3300046524 Ga0495648_0001432 Ga0495648_0001432_11135_11845 234
21 3300046528 Ga0495642_0002435 Ga0495642_0002435_1784_2494 234
22 3300046538 Ga0495609_0028814 Ga0495609_0028814_1510_2220 234
23 3300046542 Ga0495597_0001069 Ga0495597_0001069_6679_7389 234
24 3300046542 Ga0495597_0002269 Ga0495597_0002269_3657_4367 234
25 3300046558 Ga0495633_0000606 Ga0495633_0000606_22525_23235 234
26 3300046558 Ga0495633_0001184 Ga0495633_0001184_9439_10149 234
27 3300046558 Ga0495633_0011595 Ga0495633_0011595_2220_2930 234
28 3300046558 Ga0495633_0012817 Ga0495633_0012817_2032_2742 234
29 3300046660 Ga0495625_0001154 Ga0495625_0001154_22426_23136 234
30 3300046660 Ga0495625_0004399 Ga0495625_0004399_10660_11370 234
31 3300046660 Ga0495625_0008795 Ga0495625_0008795_38_748 234
32 3300046660 Ga0495625_0049303 Ga0495625_0049303_1893_2603 234
33 3300046692 Ga0495671_0030393 Ga0495671_0030393_1889_2599 234
34 3300046810 Ga0495660_0001303 Ga0495660_0001303_13616_14326 234
35 3300046810 Ga0495660_0052934 Ga0495660_0052934_1300_2010 234
36 3300047320 Ga0495672_0000883 Ga0495672_0000883_21908_22618 234
37 3300047443 Ga0495687_003194 Ga0495687_003194_9448_10158 234
38 3300047443 Ga0495687_003802 Ga0495687_003802_7929_8639 234
39 3300047445 Ga0495677_0033882 Ga0495677_0033882_337_1047 234
40 3300047470 Ga0495681_0007780 Ga0495681_0007780_575_1285 234
41 3300048919 Ga0496116_0030348 Ga0496116_0030348_236_946 234
42 3300049459 Ga0495678_000454 Ga0495678_000454_26361_27071 234
43 3300049459 Ga0495678_030897 Ga0495678_030897_1010_1720 234
44 3300053145 Ga0500586_000385 Ga0500586_000385_2046_2756 234
45 3300046452 Ga0495617_004028 Ga0495617_004028_860_1573 235
46 3300046507 Ga0495606_0004462 Ga0495606_0004462_10871_11584 235
47 3300046520 Ga0495637_0010016 Ga0495637_0010016_1620_2333 235
48 3300046524 Ga0495648_0043414 Ga0495648_0043414_483_1196 235
49 3300046542 Ga0495597_0116569 Ga0495597_0116569_168_932 235
50 3300046691 Ga0495670_0265007 Ga0495670_0265007_48_761 235
51 3300046692 Ga0495671_0011387 Ga0495671_0011387_3332_4045 235
52 3300046694 Ga0495649_0033570 Ga0495649_0033570_1857_2570 235
53 3300047469 Ga0495673_0000522 Ga0495673_0000522_17851_18564 235
54 3300047470 Ga0495681_0128263 Ga0495681_0128263_139_903 235
55 3300048091 Ga0495626_0008326 Ga0495626_0008326_966_1730 235
56 3300053118 Ga0500594_0127867 Ga0500594_0127867_66_779 235
57 3300046691 Ga0495670_0045542 Ga0495670_0045542_1454_2176 238
58 3300046528 Ga0495642_0108184 Ga0495642_0108184_390_1124 242
59 3300046616 Ga0495668_0015768 Ga0495668_0015768_3652_4386 242
60 iso_pu_bacteria 2857576091 2857579353 249
61 3300002738 JGI25154J39366_1000304 JGI25154J39366_100030416 252
62 3300005536 Ga0070697_100002039 Ga0070697_10000203911 252
63 3300006028 Ga0070717_10160819 Ga0070717_101608192 252
64 3300006846 Ga0075430_100406386 Ga0075430_1004063862 252
65 3300027111 Ga0209281_1002187 Ga0209281_10021877 252
66 3300031239 Ga0265328_10013275 Ga0265328_100132753 252
67 3300031456 Ga0307513_10253628 Ga0307513_102536281 252
68 3300037312 Ga0395899_0000240 Ga0395899_0000240_1772_2536 252
69 3300039447 Ga0436361_0723034 Ga0436361_0723034_2415_3179 252
70 3300044842 Ga0466957_0297921 Ga0466957_0297921_187_951 252
71 3300046455 Ga0495603_0053483 Ga0495603_0053483_22_786 252
72 3300046459 Ga0495629_0012541 Ga0495629_0012541_1417_2181 252
73 3300046459 Ga0495629_0024040 Ga0495629_0024040_2143_2907 252
74 3300046460 Ga0495638_0034382 Ga0495638_0034382_859_1623 252
75 3300046460 Ga0495638_0053823 Ga0495638_0053823_1360_2124 252
76 3300046472 Ga0495580_0047743 Ga0495580_0047743_1247_2011 252
77 3300046473 Ga0495582_0207278 Ga0495582_0207278_339_1103 252
78 3300046474 Ga0495605_0020310 Ga0495605_0020310_1944_2708 252
79 3300046491 Ga0495584_0005394 Ga0495584_0005394_4317_5081 252
80 3300046491 Ga0495584_0100061 Ga0495584_0100061_593_1357 252
81 3300046492 Ga0495585_0000802 Ga0495585_0000802_23783_24547 252
82 3300046492 Ga0495585_0017188 Ga0495585_0017188_346_1110 252
83 3300046492 Ga0495585_0072271 Ga0495585_0072271_675_1439 252
84 3300046499 Ga0495594_0001819 Ga0495594_0001819_6405_7169 252
85 3300046499 Ga0495594_0117028 Ga0495594_0117028_435_1199 252
86 3300046500 Ga0495596_0000996 Ga0495596_0000996_11276_12040 252
87 3300046501 Ga0495607_0091620 Ga0495607_0091620_714_1478 252
88 3300046506 Ga0495583_0014520 Ga0495583_0014520_3495_4259 252
89 3300046513 Ga0495616_0047822 Ga0495616_0047822_1322_2086 252
90 3300046517 Ga0495630_0016553 Ga0495630_0016553_2067_2831 252
91 3300046518 Ga0495631_0006235 Ga0495631_0006235_4061_4825 252
92 3300046522 Ga0495643_0001689 Ga0495643_0001689_6475_7239 252
93 3300046524 Ga0495648_0036112 Ga0495648_0036112_778_1542 252
94 3300046526 Ga0495666_0011490 Ga0495666_0011490_1755_2519 252
95 3300046526 Ga0495666_0018196 Ga0495666_0018196_1979_2743 252
96 3300046526 Ga0495666_0020999 Ga0495666_0020999_298_1062 252
97 3300046528 Ga0495642_0040567 Ga0495642_0040567_557_1321 252
98 3300046529 Ga0495652_0022220 Ga0495652_0022220_2079_2843 252
99 3300046531 Ga0495665_0016285 Ga0495665_0016285_820_1584 252
100 3300046531 Ga0495665_0027664 Ga0495665_0027664_1458_2222 252
101 3300046536 Ga0495587_0004267 Ga0495587_0004267_6376_7140 252
102 3300046542 Ga0495597_0006678 Ga0495597_0006678_2219_2983 252
103 3300046557 Ga0495622_0019394 Ga0495622_0019394_1639_2403 252
104 3300046558 Ga0495633_0076007 Ga0495633_0076007_357_1121 252
105 3300046616 Ga0495668_0016566 Ga0495668_0016566_976_1740 252
106 3300046642 Ga0495634_0031184 Ga0495634_0031184_1987_2751 252
107 3300046648 Ga0495611_0006507 Ga0495611_0006507_3280_4044 252
108 3300046660 Ga0495625_0082519 Ga0495625_0082519_745_1509 252
109 3300046674 Ga0495588_0004845 Ga0495588_0004845_1660_2424 252
110 3300046674 Ga0495588_0051754 Ga0495588_0051754_1012_1776 252
111 3300046674 Ga0495588_0114723 Ga0495588_0114723_332_1096 252
112 3300046684 Ga0495669_0007101 Ga0495669_0007101_3477_4241 252
113 3300046689 Ga0495613_0009611 Ga0495613_0009611_5834_6598 252
114 3300046691 Ga0495670_0093250 Ga0495670_0093250_241_1005 252
115 3300046691 Ga0495670_0093507 Ga0495670_0093507_475_1239 252
116 3300046809 Ga0495600_0010349 Ga0495600_0010349_2827_3591 252
117 3300047315 Ga0495581_0011595 Ga0495581_0011595_3149_3913 252
118 3300047315 Ga0495581_0018205 Ga0495581_0018205_1824_2588 252
119 3300047317 Ga0495604_0088363 Ga0495604_0088363_1127_1891 252
120 3300047319 Ga0495674_0001855 Ga0495674_0001855_18479_19243 252
121 3300047319 Ga0495674_0098850 Ga0495674_0098850_1095_1859 252
122 3300047321 Ga0495676_0050565 Ga0495676_0050565_926_1690 252
123 3300047444 Ga0495675_0006208 Ga0495675_0006208_3394_4158 252
124 3300047470 Ga0495681_0032663 Ga0495681_0032663_1344_2108 252
125 3300047470 Ga0495681_0089142 Ga0495681_0089142_94_858 252
126 3300047673 Ga0495593_0010665 Ga0495593_0010665_3624_4388 252
127 3300048088 Ga0495602_0029974 Ga0495602_0029974_2446_3210 252
128 3300048089 Ga0495614_0025028 Ga0495614_0025028_392_1156 252
129 3300048091 Ga0495626_0011078 Ga0495626_0011078_1888_2652 252
130 3300048918 Ga0496115_0061428 Ga0496115_0061428_485_1249 252
131 3300049459 Ga0495678_009286 Ga0495678_009286_3303_4067 252
132 iso_pu_bacteria 2899370129 2899372914 252
133 3300005444 Ga0070694_100151222 Ga0070694_1001512223 253
134 3300044694 Ga0466963_0301008 Ga0466963_0301008_335_1102 253
135 3300045051 Ga0451576_0106525 Ga0451576_0106525_1821_2588 253
136 3300046452 Ga0495617_000367 Ga0495617_000367_22595_23368 253
137 3300046455 Ga0495603_0066151 Ga0495603_0066151_85_855 253
138 3300046471 Ga0495650_0000011 Ga0495650_0000011_447264_448031 253
139 3300046471 Ga0495650_0116956 Ga0495650_0116956_28_804 253
140 3300046491 Ga0495584_0000007 Ga0495584_0000007_189374_190147 253
141 3300046491 Ga0495584_0004691 Ga0495584_0004691_2333_3106 253
142 3300046492 Ga0495585_0002050 Ga0495585_0002050_3891_4664 253
143 3300046492 Ga0495585_0002293 Ga0495585_0002293_3214_3987 253
144 3300046492 Ga0495585_0004827 Ga0495585_0004827_2127_2900 253
145 3300046492 Ga0495585_0005844 Ga0495585_0005844_2125_2898 253
146 3300046500 Ga0495596_0004185 Ga0495596_0004185_4158_4931 253
147 3300046501 Ga0495607_0000871 Ga0495607_0000871_17892_18671 253
148 3300046506 Ga0495583_0001333 Ga0495583_0001333_22471_23244 253
149 3300046506 Ga0495583_0047715 Ga0495583_0047715_296_1069 253
150 3300046507 Ga0495606_0009381 Ga0495606_0009381_5170_5943 253
151 3300046507 Ga0495606_0058132 Ga0495606_0058132_648_1421 253
152 3300046513 Ga0495616_0005664 Ga0495616_0005664_4806_5579 253
153 3300046513 Ga0495616_0005980 Ga0495616_0005980_4377_5150 253
154 3300046515 Ga0495620_0002957 Ga0495620_0002957_2099_2872 253
155 3300046518 Ga0495631_0066963 Ga0495631_0066963_544_1317 253
156 3300046520 Ga0495637_0028260 Ga0495637_0028260_299_1069 253
157 3300046524 Ga0495648_0001292 Ga0495648_0001292_22555_23328 253
158 3300046528 Ga0495642_0001415 Ga0495642_0001415_8738_9511 253
159 3300046531 Ga0495665_0009788 Ga0495665_0009788_1687_2457 253
160 3300046538 Ga0495609_0028709 Ga0495609_0028709_1477_2250 253
161 3300046558 Ga0495633_0005059 Ga0495633_0005059_2057_2830 253
162 3300046558 Ga0495633_0013847 Ga0495633_0013847_1586_2359 253
163 3300046558 Ga0495633_0026899 Ga0495633_0026899_1348_2121 253
164 3300046558 Ga0495633_0107581 Ga0495633_0107581_259_1032 253
165 3300046616 Ga0495668_0006853 Ga0495668_0006853_2039_2812 253
166 3300046648 Ga0495611_0018916 Ga0495611_0018916_77_850 253
167 3300046648 Ga0495611_0235375 Ga0495611_0235375_49_822 253
168 3300046660 Ga0495625_0024391 Ga0495625_0024391_1394_2164 253
169 3300046665 Ga0495661_0037626 Ga0495661_0037626_250_1023 253
170 3300046674 Ga0495588_0078047 Ga0495588_0078047_817_1587 253
171 3300046691 Ga0495670_0002431 Ga0495670_0002431_6249_7022 253
172 3300046691 Ga0495670_0018710 Ga0495670_0018710_2048_2821 253
173 3300046810 Ga0495660_0076839 Ga0495660_0076839_472_1245 253
174 3300047323 Ga0495683_0000083 Ga0495683_0000083_9317_10090 253
175 3300047323 Ga0495683_0026207 Ga0495683_0026207_1857_2630 253
176 3300047443 Ga0495687_091566 Ga0495687_091566_17_790 253
177 3300049568 Ga0501031_0026738 Ga0501031_0026738_2635_3402 253
178 3300049569 Ga0501032_0074949 Ga0501032_0074949_245_1027 253
179 3300049571 Ga0501034_0120796 Ga0501034_0120796_77_859 253
180 3300049574 Ga0501038_0025395 Ga0501038_0025395_4293_5126 253
181 3300049575 Ga0501039_0011335 Ga0501039_0011335_3929_4711 253
182 3300049581 Ga0501047_0139437 Ga0501047_0139437_1096_1866 253
183 3300049591 Ga0501075_0179868 Ga0501075_0179868_117_905 253
184 iso_pu_bacteria 2582580736 2583151158 253
185 iso_pu_bacteria 2799112218 2799183043 253
186 3300046472 Ga0495580_0063155 Ga0495580_0063155_528_1337 255
187 3300031995 Ga0307409_100501825 Ga0307409_1005018252 256
188 iso_pu_bacteria 2731639228 2731906420 258
189 3300044673 Ga0453683_0004145 Ga0453683_0004145_1144_1932 259
190 3300044693 Ga0466961_0119399 Ga0466961_0119399_396_1238 259
191 3300045051 Ga0451576_0006977 Ga0451576_0006977_631_1419 259
192 3300005614 Ga0068856_100849259 Ga0068856_1008492591 260
193 3300044684 Ga0466966_0004655 Ga0466966_0004655_6866_7666 260
194 3300044684 Ga0466966_0016655 Ga0466966_0016655_923_1720 260
195 3300044693 Ga0466961_0015361 Ga0466961_0015361_3176_3976 260
196 3300044693 Ga0466961_0082578 Ga0466961_0082578_827_1624 260
197 3300044842 Ga0466957_0243083 Ga0466957_0243083_121_918 260
198 3300045049 Ga0466959_0082399 Ga0466959_0082399_875_1672 260
199 3300045836 Ga0466958_0070714 Ga0466958_0070714_606_1403 260
200 3300005563 Ga0068855_100004626 Ga0068855_1000046265 261
201 3300009545 Ga0105237_10090319 Ga0105237_100903192 261
202 3300009545 Ga0105237_10199204 Ga0105237_101992041 261
203 3300010375 Ga0105239_10953539 Ga0105239_109535391 261
204 3300025914 Ga0207671_10290125 Ga0207671_102901251 261
205 3300025949 Ga0207667_10009171 Ga0207667_100091712 261
206 3300026142 Ga0207698_10258586 Ga0207698_102585862 261
207 3300044658 Ga0466972_0043273 Ga0466972_0043273_1162_1953 261
208 3300044684 Ga0466966_0051545 Ga0466966_0051545_188_979 261
209 3300044693 Ga0466961_0020019 Ga0466961_0020019_1232_2023 261
210 3300044693 Ga0466961_0076998 Ga0466961_0076998_1258_2049 261
211 3300044693 Ga0466961_0268558 Ga0466961_0268558_26_817 261
212 3300044694 Ga0466963_0019194 Ga0466963_0019194_1535_2329 261
213 3300044694 Ga0466963_0042043 Ga0466963_0042043_2095_2904 261
214 3300044694 Ga0466963_0073457 Ga0466963_0073457_790_1587 261
215 3300044706 Ga0466964_0023575 Ga0466964_0023575_773_1573 261
216 3300044719 Ga0466971_0056500 Ga0466971_0056500_570_1361 261
217 3300044719 Ga0466971_0171896 Ga0466971_0171896_26_910 261
218 3300044901 Ga0466960_0042727 Ga0466960_0042727_532_1329 261
219 3300045049 Ga0466959_0152113 Ga0466959_0152113_565_1356 261
220 3300045836 Ga0466958_0039110 Ga0466958_0039110_1562_2353 261
221 3300045836 Ga0466958_0081065 Ga0466958_0081065_691_1488 261
222 3300045836 Ga0466958_0104951 Ga0466958_0104951_402_1199 261
223 3300045976 Ga0466967_0005244 Ga0466967_0005244_2231_3025 261
224 3300045976 Ga0466967_0009588 Ga0466967_0009588_3104_3901 261
225 3300045976 Ga0466967_0010498 Ga0466967_0010498_3747_4544 261
226 3300045976 Ga0466967_0163567 Ga0466967_0163567_1161_1958 261
227 3300045976 Ga0466967_0307762 Ga0466967_0307762_524_1315 261
228 3300050513 nmdc:mga0rr50_485608_c1 nmdc:mga0rr50_485608_c1_179_1027 261
229 3300044684 Ga0466966_0033750 Ga0466966_0033750_1668_2516 262
230 3300044684 Ga0466966_0111764 Ga0466966_0111764_77_958 262
231 3300045049 Ga0466959_0016803 Ga0466959_0016803_407_1255 262
232 3300045049 Ga0466959_0065440 Ga0466959_0065440_376_1257 262
233 3300001990 JGI24737J22298_10079254 JGI24737J22298_100792541 263
234 3300044694 Ga0466963_0176580 Ga0466963_0176580_561_1361 263
235 3300045836 Ga0466958_0159724 Ga0466958_0159724_327_1127 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

33

283

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.9302 2 262
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.9181 1 262
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.9162 2 262
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.9112 1 262
2voa-assembly1.cif.gz_B structure of an ap endonuclease from archaeoglobus fulgidus 0.9096 1 261
ID Description Score Start End Superfamily
af_P96273_24_289_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9375 1 261 3.60.10.10
af_P96273_24_289_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9272 1 261 3.60.10.10
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.923 2 262 3.60.10.10
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9091 2 262 3.60.10.10
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9008 1 261 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A2V8GL27-F1-model_v4 Exodeoxyribonuclease III 0.9898 1 72 GO:0003677
GO:0004519
GO:0006281
GO:0008311
AF-A0A7Z9FA89-F1-model_v4 Exodeoxyribonuclease III 0.9869 1 77 GO:0003677
GO:0004519
GO:0006281
GO:0008311
AF-A0A523JTZ4-F1-model_v4 Exodeoxyribonuclease III 0.985 1 70 GO:0003677
GO:0004519
GO:0006281
GO:0008311
AF-A0A3S1FJ84-F1-model_v4 Exodeoxyribonuclease III 0.9811 1 75 GO:0006281
GO:0008311
AF-A0A519Z8C0-F1-model_v4 Exodeoxyribonuclease III 0.979 3 70 GO:0006281
GO:0008311

Feature Viewer

pLDDT pTM Quality
91.41 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map