F348383

General Info

Members Datasets Scaffolds Average Seq Length
235 138 470 566

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0040202|Ga0453684_0040202_2352_4070
Length 572
Sequence MEKRWNLLRPDEQDVARLQQELGISPILCRILVERGVRTFQDAHQFFRPSLESLHDPFLMKDMTLAVDRIMKAMVQRERILVYGDYDVDGTTAVGCMYRFLCKIYEKDLIDFYIPHRYREGYGVSRQGVDHAINQGYKLVIALDCGIKSQELISYAKEQGVDFIVCDHHLPDELLPPAVAILNPKQKDCPYPYKELCGCGVGLKLITAIVRQSDLPDELWMECLELTATAIAADIVPMTGENRVIAYYGLKRTNENPSVALKALMNVSGMKGKVLIQHLVFMIAPRVNAAGRMDDARKVVNLFIENDFDKAAEYAKELHSDNADRKEADLSITKEALSLIREYETIXKRKSTVVYQPHWHKGVVGIVASRLIEHYYRPTIVLTRSGDVVAGSARSIPGFNIHDGLEQCKDLLLGFGGHYFAAGMTMLPENVEAFSARFNEVVEGLLLEHYFTPEIRIDAEVHLADCNRKFYDIVHQMEPFGPENPQPVLVARGLRDTGHSKVVKDLHLRLVVKQDNSAVMSGIGFNLADKYQIIASGRPFDVVFTLDENEWQGNISLQMKVIDMKAAEKIER

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
128 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
133 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
134 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
135 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
136 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
137 2818991444 Filimonas endophytica 3197 Isolate Unclassified
138 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.83
Nodule 0
Rhizoplane 0
Rhizosphere 94.47
Stem 0
Stem Tuber 0
Unclassified 2.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0040202 3300044712 Bacteria 6358
2 JGI24751J29686_10001060 3300002459 Bacteria 5973
3 JGI25160J50197_1001628 3300003354 Bacteria 11022
4 Ga0065712_10017779 3300005290 Bacteria 2094
5 Ga0065712_10069417 3300005290 Bacteria 7342
6 Ga0065712_10072996 3300005290 Bacteria 4538
7 Ga0070676_10005866 3300005328 Bacteria 6556
8 Ga0070676_10005951 3300005328 Bacteria 6509
9 Ga0070683_100014181 3300005329 Bacteria 6962
10 Ga0070683_100051389 3300005329 Bacteria 3816
11 Ga0070690_100066009 3300005330 Bacteria 2341
12 Ga0070670_100013127 3300005331 Bacteria 7096
13 Ga0070670_100018853 3300005331 Bacteria 5917
14 Ga0068869_100006968 3300005334 Bacteria 7194
15 Ga0068869_100034971 3300005334 Bacteria 3558
16 Ga0068869_100074134 3300005334 Unclassified 2525
17 Ga0068868_100096959 3300005338 Bacteria 2382
18 Ga0070689_100007198 3300005340 Bacteria 7758
19 Ga0070689_100012023 3300005340 Bacteria 6222
20 Ga0070661_100001685 3300005344 Bacteria 15290
21 Ga0070668_100038487 3300005347 Bacteria 3655
22 Ga0070668_100052239 3300005347 Bacteria 3150
23 Ga0070669_100002558 3300005353 Bacteria 13155
24 Ga0070669_100008912 3300005353 Bacteria 7156
25 Ga0070669_100035764 3300005353 Bacteria 3599
26 Ga0070675_100007641 3300005354 Bacteria 8365
27 Ga0070675_100013996 3300005354 Bacteria 6316
28 Ga0070675_100016926 3300005354 Bacteria 5790
29 Ga0070675_100040169 3300005354 Bacteria 3818
30 Ga0070675_100042784 3300005354 Bacteria 3702
31 Ga0070671_100025467 3300005355 Bacteria 4854
32 Ga0070673_100010236 3300005364 Bacteria 6338
33 Ga0070673_100017650 3300005364 Bacteria 5080
34 Ga0070673_100110882 3300005364 Bacteria 2275
35 Ga0070688_100023920 3300005365 Bacteria 3598
36 Ga0070688_100071259 3300005365 Bacteria 2224
37 Ga0070659_100039972 3300005366 Bacteria 3664
38 Ga0070701_10030371 3300005438 Bacteria 2673
39 Ga0070701_10038407 3300005438 Bacteria 2423
40 Ga0070662_100017902 3300005457 Bacteria 4782
41 Ga0068867_100027083 3300005459 Bacteria 4118
42 Ga0070685_10002538 3300005466 Bacteria 9358
43 Ga0070685_10003424 3300005466 Bacteria 8067
44 Ga0070698_100002515 3300005471 Bacteria 20194
45 Ga0070698_100007127 3300005471 Bacteria 12109
46 Ga0070684_100001962 3300005535 Bacteria 15111
47 Ga0070684_100003757 3300005535 Bacteria 11456
48 Ga0068853_100002136 3300005539 Bacteria 14716
49 Ga0068853_100027325 3300005539 Bacteria 4794
50 Ga0070672_100111329 3300005543 Bacteria 2232
51 Ga0070686_100011384 3300005544 Bacteria 5045
52 Ga0070686_100023978 3300005544 Bacteria 3653
53 Ga0070665_100213560 3300005548 Bacteria 1930
54 Ga0070664_100001137 3300005564 Bacteria 21035
55 Ga0070664_100003013 3300005564 Bacteria 13617
56 Ga0070664_100012818 3300005564 Bacteria 6819
57 Ga0070664_100025500 3300005564 Bacteria 4901
58 Ga0068857_100001716 3300005577 Bacteria 17629
59 Ga0068857_100097609 3300005577 Bacteria 2634
60 Ga0068854_100012732 3300005578 Bacteria 5509
61 Ga0070702_100001348 3300005615 Bacteria 9999
62 Ga0068852_100009539 3300005616 Bacteria 7214
63 Ga0068852_100016873 3300005616 Bacteria 5711
64 Ga0068852_100142394 3300005616 Unclassified 2220
65 Ga0068859_100016441 3300005617 Bacteria 7431
66 Ga0068859_100056549 3300005617 Bacteria 3949
67 Ga0068859_100065027 3300005617 Bacteria 3681
68 Ga0068866_10008075 3300005718 Bacteria 4423
69 Ga0068861_100023894 3300005719 Bacteria 4413
70 Ga0068861_100045619 3300005719 Bacteria 3302
71 Ga0068861_100083308 3300005719 Bacteria 2508
72 Ga0068870_10008993 3300005840 Bacteria 4519
73 Ga0068870_10011260 3300005840 Bacteria 4140
74 Ga0068863_100119539 3300005841 Bacteria 2512
75 Ga0068858_100055288 3300005842 Bacteria 3669
76 Ga0068858_100101744 3300005842 Bacteria 2680
77 Ga0068860_100000777 3300005843 Bacteria 35916
78 Ga0068860_100042991 3300005843 Bacteria 4312
79 Ga0068862_100076357 3300005844 Bacteria 2899
80 Ga0068862_100077428 3300005844 Bacteria 2880
81 Ga0075366_10003483 3300006195 Bacteria 8315
82 Ga0097621_100011987 3300006237 Bacteria 6415
83 Ga0068871_100007281 3300006358 Bacteria 7893
84 Ga0068871_100094455 3300006358 Bacteria 2496
85 Ga0075428_100050487 3300006844 Bacteria 4561
86 Ga0075428_100080994 3300006844 Bacteria 3544
87 Ga0075430_100019746 3300006846 Bacteria 5733
88 Ga0075429_100000947 3300006880 Bacteria 22975
89 Ga0097620_100016441 3300006931 Bacteria 7431
90 Ga0097620_100056556 3300006931 Bacteria 3949
91 Ga0097620_100065023 3300006931 Bacteria 3681
92 Ga0111539_10001397 3300009094 Bacteria 32129
93 Ga0111539_10182454 3300009094 Bacteria 2451
94 Ga0105247_10004404 3300009101 Bacteria 8986
95 Ga0105242_10002114 3300009176 Bacteria 15663
96 Ga0105242_10033557 3300009176 Bacteria 4110
97 Ga0105242_10051079 3300009176 Bacteria 3368
98 Ga0105237_10019152 3300009545 Bacteria 7072
99 Ga0105237_10072328 3300009545 Bacteria 3442
100 Ga0105249_10000762 3300009553 Bacteria 28926
101 Ga0105249_10002189 3300009553 Bacteria 16912
102 Ga0105249_10005156 3300009553 Bacteria 11273
103 Ga0105249_10070155 3300009553 Bacteria 3234
104 Ga0105249_10142151 3300009553 Bacteria 2302
105 Ga0105239_10015804 3300010375 Bacteria 8352
106 Ga0157373_10000199 3300013100 Bacteria 49515
107 Ga0157371_10002520 3300013102 Bacteria 17411
108 Ga0157371_10015329 3300013102 Bacteria 5753
109 Ga0157369_10008293 3300013105 Bacteria 11910
110 Ga0157369_10033874 3300013105 Bacteria 5609
111 Ga0157374_10027172 3300013296 Bacteria 5158
112 Ga0157374_10028975 3300013296 Bacteria 5006
113 Ga0157374_10213219 3300013296 Bacteria 1894
114 Ga0157378_10000709 3300013297 Bacteria 31237
115 Ga0157378_10024574 3300013297 Bacteria 5304
116 Ga0157378_10091839 3300013297 Bacteria 2761
117 Ga0163162_10006844 3300013306 Bacteria 11062
118 Ga0163162_10007652 3300013306 Bacteria 10523
119 Ga0163162_10052497 3300013306 Bacteria 4095
120 Ga0163162_10105300 3300013306 Bacteria 2915
121 Ga0157372_10027589 3300013307 Bacteria 6187
122 Ga0157372_10044094 3300013307 Bacteria 4941
123 Ga0157372_10061844 3300013307 Bacteria 4193
124 Ga0157372_10067961 3300013307 Bacteria 4006
125 Ga0157372_10072526 3300013307 Bacteria 3880
126 Ga0157372_10105605 3300013307 Bacteria 3221
127 Ga0157372_10167475 3300013307 Bacteria 2541
128 Ga0157375_10020664 3300013308 Bacteria 6019
129 Ga0157375_10055764 3300013308 Bacteria 3898
130 Ga0157375_10075406 3300013308 Bacteria 3397
131 Ga0163163_10001556 3300014325 Bacteria 19351
132 Ga0163163_10086740 3300014325 Bacteria 3139
133 Ga0157380_10010105 3300014326 Bacteria 6778
134 Ga0157377_10005648 3300014745 Bacteria 5895
135 Ga0157377_10008569 3300014745 Bacteria 4991
136 Ga0157379_10068647 3300014968 Bacteria 3169
137 Ga0157376_10014112 3300014969 Bacteria 5984
138 Ga0157376_10083249 3300014969 Bacteria 2752
139 Ga0163161_10024857 3300017792 Bacteria 4235
140 Ga0213876_10012025 3300021384 Unclassified 4609
141 Ga0207426_1000104 3300025302 Bacteria 249464
142 Ga0207642_10004146 3300025899 Bacteria 4653
143 Ga0207647_10000491 3300025904 Bacteria 31654
144 Ga0207645_10009721 3300025907 Bacteria 6644
145 Ga0207643_10003438 3300025908 Bacteria 8518
146 Ga0207705_10018038 3300025909 Bacteria 5046
147 Ga0207662_10058275 3300025918 Bacteria 2311
148 Ga0207649_10062692 3300025920 Bacteria 2344
149 Ga0207681_10016644 3300025923 Unclassified 4604
150 Ga0207650_10092823 3300025925 Bacteria 2310
151 Ga0207659_10006734 3300025926 Bacteria 7060
152 Ga0207644_10011349 3300025931 Bacteria 5894
153 Ga0207644_10032667 3300025931 Bacteria 3633
154 Ga0207690_10018682 3300025932 Bacteria 4254
155 Ga0207706_10027015 3300025933 Bacteria 5134
156 Ga0207706_10030989 3300025933 Bacteria 4766
157 Ga0207706_10031432 3300025933 Bacteria 4730
158 Ga0207686_10001023 3300025934 Bacteria 16552
159 Ga0207670_10002872 3300025936 Bacteria 9089
160 Ga0207704_10009475 3300025938 Bacteria 4700
161 Ga0207691_10008415 3300025940 Bacteria 9913
162 Ga0207691_10014903 3300025940 Bacteria 7408
163 Ga0207691_10083925 3300025940 Bacteria 2860
164 Ga0207691_10133171 3300025940 Bacteria 2194
165 Ga0207689_10017893 3300025942 Bacteria 5985
166 Ga0207689_10025610 3300025942 Bacteria 4943
167 Ga0207689_10061309 3300025942 Bacteria 3093
168 Ga0207661_10017740 3300025944 Bacteria 5274
169 Ga0207679_10000777 3300025945 Bacteria 20886
170 Ga0207651_10014463 3300025960 Bacteria 4559
171 Ga0207651_10020492 3300025960 Bacteria 3992
172 Ga0207651_10056154 3300025960 Bacteria 2708
173 Ga0207651_10112573 3300025960 Bacteria 2046
174 Ga0207712_10000883 3300025961 Bacteria 21786
175 Ga0207712_10005652 3300025961 Bacteria 7888
176 Ga0207640_10008037 3300025981 Bacteria 5831
177 Ga0207658_10019680 3300025986 Bacteria 4669
178 Ga0207703_10054372 3300026035 Bacteria 3256
179 Ga0207639_10026983 3300026041 Bacteria 4178
180 Ga0207678_10116136 3300026067 Bacteria 2283
181 Ga0207708_10034135 3300026075 Bacteria 3868
182 Ga0207708_10047493 3300026075 Unclassified 3268
183 Ga0207641_10001211 3300026088 Bacteria 25807
184 Ga0207648_10003652 3300026089 Bacteria 16108
185 Ga0207648_10027695 3300026089 Bacteria 5029
186 Ga0207648_10083838 3300026089 Unclassified 2780
187 Ga0207676_10024768 3300026095 Bacteria 4444
188 Ga0207676_10040991 3300026095 Bacteria 3552
189 Ga0207676_10137138 3300026095 Bacteria 2089
190 Ga0207674_10003303 3300026116 Bacteria 19833
191 Ga0207674_10010027 3300026116 Bacteria 10780
192 Ga0207674_10116937 3300026116 Bacteria 2637
193 Ga0207675_100008354 3300026118 Bacteria 9755
194 Ga0207675_100016834 3300026118 Bacteria 6830
195 Ga0207683_10006924 3300026121 Bacteria 9708
196 Ga0207683_10011596 3300026121 Bacteria 7526
197 Ga0207698_10004661 3300026142 Bacteria 8377
198 Ga0207698_10010210 3300026142 Bacteria 6019
199 Ga0268264_10001090 3300028381 Bacteria 26846
200 Ga0265327_10000974 3300031251 Bacteria 40908
201 Ga0395900_0195158 3300037418 Bacteria 2051
202 Ga0436365_0212609 3300039437 Bacteria 25185
203 Ga0450894_003256 3300042131 Bacteria 2130
204 Ga0453684_0023157 3300044712 Bacteria 9166
205 Ga0495630_0004081 3300046517 Bacteria 10226
206 Ga0495668_0000212 3300046616 Bacteria 84542
207 Ga0495672_0047528 3300047320 Bacteria 2551
208 Ga0495686_0010470 3300047472 Bacteria 6593
209 Ga0501034_0007696 3300049571 Bacteria 11462
210 Ga0501036_0008875 3300049572 Bacteria 8256
211 Ga0501037_0013848 3300049573 Bacteria 5943
212 Ga0501038_0014503 3300049574 Bacteria 7182
213 Ga0501039_0006695 3300049575 Bacteria 8762
214 Ga0501039_0029121 3300049575 Bacteria 4253
215 Ga0501043_0003681 3300049579 Bacteria 12590
216 Ga0501046_0003394 3300049580 Bacteria 14611
217 Ga0501067_0006884 3300049583 Bacteria 6308
218 Ga0501070_0009462 3300049586 Bacteria 8237
219 Ga0501074_0002265 3300049590 Bacteria 13385
220 Ga0501080_0016638 3300049742 Bacteria 6792
221 Ga0501083_0010295 3300049744 Bacteria 6589
222 Ga0501035_0093657 3300049822 Bacteria 2643
223 Ga0501044_0016285 3300049823 Bacteria 7988
224 Ga0501044_0020439 3300049823 Bacteria 7070
225 Ga0501044_0028605 3300049823 Bacteria 5883
226 Ga0501044_0034366 3300049823 Bacteria 5317
227 nmdc:mga0k408_17861_c1 3300050493 Bacteria 3954
228 nmdc:mga09592_30892_c1 3300050508 Bacteria 4460
229 Ga0500644_0010482 3300053088 Bacteria 2511
230 Ga0500646_0006570 3300053090 Bacteria 2958
231 Ga0500562_000073 3300053108 Bacteria 47462
232 Ga0500568_0001078 3300053139 Bacteria 18433
233 Ga0500661_001277 3300055283 Bacteria 4701
234 2819588088 2818991444 Bacteria 6968812
235 2929157917 2929154850 Bacteria 6753285
236 Ga0453684_0040202
237 JGI24751J29686_10001060
238 JGI25160J50197_1001628
239 Ga0065712_10017779
240 Ga0065712_10069417
241 Ga0065712_10072996
242 Ga0070676_10005866
243 Ga0070676_10005951
244 Ga0070683_100014181
245 Ga0070683_100051389
246 Ga0070690_100066009
247 Ga0070670_100013127
248 Ga0070670_100018853
249 Ga0068869_100006968
250 Ga0068869_100034971
251 Ga0068869_100074134
252 Ga0068868_100096959
253 Ga0070689_100007198
254 Ga0070689_100012023
255 Ga0070661_100001685
256 Ga0070668_100038487
257 Ga0070668_100052239
258 Ga0070669_100002558
259 Ga0070669_100008912
260 Ga0070669_100035764
261 Ga0070675_100007641
262 Ga0070675_100013996
263 Ga0070675_100016926
264 Ga0070675_100040169
265 Ga0070675_100042784
266 Ga0070671_100025467
267 Ga0070673_100010236
268 Ga0070673_100017650
269 Ga0070673_100110882
270 Ga0070688_100023920
271 Ga0070688_100071259
272 Ga0070659_100039972
273 Ga0070701_10030371
274 Ga0070701_10038407
275 Ga0070662_100017902
276 Ga0068867_100027083
277 Ga0070685_10002538
278 Ga0070685_10003424
279 Ga0070698_100002515
280 Ga0070698_100007127
281 Ga0070684_100001962
282 Ga0070684_100003757
283 Ga0068853_100002136
284 Ga0068853_100027325
285 Ga0070672_100111329
286 Ga0070686_100011384
287 Ga0070686_100023978
288 Ga0070665_100213560
289 Ga0070664_100001137
290 Ga0070664_100003013
291 Ga0070664_100012818
292 Ga0070664_100025500
293 Ga0068857_100001716
294 Ga0068857_100097609
295 Ga0068854_100012732
296 Ga0070702_100001348
297 Ga0068852_100009539
298 Ga0068852_100016873
299 Ga0068852_100142394
300 Ga0068859_100016441
301 Ga0068859_100056549
302 Ga0068859_100065027
303 Ga0068866_10008075
304 Ga0068861_100023894
305 Ga0068861_100045619
306 Ga0068861_100083308
307 Ga0068870_10008993
308 Ga0068870_10011260
309 Ga0068863_100119539
310 Ga0068858_100055288
311 Ga0068858_100101744
312 Ga0068860_100000777
313 Ga0068860_100042991
314 Ga0068862_100076357
315 Ga0068862_100077428
316 Ga0075366_10003483
317 Ga0097621_100011987
318 Ga0068871_100007281
319 Ga0068871_100094455
320 Ga0075428_100050487
321 Ga0075428_100080994
322 Ga0075430_100019746
323 Ga0075429_100000947
324 Ga0097620_100016441
325 Ga0097620_100056556
326 Ga0097620_100065023
327 Ga0111539_10001397
328 Ga0111539_10182454
329 Ga0105247_10004404
330 Ga0105242_10002114
331 Ga0105242_10033557
332 Ga0105242_10051079
333 Ga0105237_10019152
334 Ga0105237_10072328
335 Ga0105249_10000762
336 Ga0105249_10002189
337 Ga0105249_10005156
338 Ga0105249_10070155
339 Ga0105249_10142151
340 Ga0105239_10015804
341 Ga0157373_10000199
342 Ga0157371_10002520
343 Ga0157371_10015329
344 Ga0157369_10008293
345 Ga0157369_10033874
346 Ga0157374_10027172
347 Ga0157374_10028975
348 Ga0157374_10213219
349 Ga0157378_10000709
350 Ga0157378_10024574
351 Ga0157378_10091839
352 Ga0163162_10006844
353 Ga0163162_10007652
354 Ga0163162_10052497
355 Ga0163162_10105300
356 Ga0157372_10027589
357 Ga0157372_10044094
358 Ga0157372_10061844
359 Ga0157372_10067961
360 Ga0157372_10072526
361 Ga0157372_10105605
362 Ga0157372_10167475
363 Ga0157375_10020664
364 Ga0157375_10055764
365 Ga0157375_10075406
366 Ga0163163_10001556
367 Ga0163163_10086740
368 Ga0157380_10010105
369 Ga0157377_10005648
370 Ga0157377_10008569
371 Ga0157379_10068647
372 Ga0157376_10014112
373 Ga0157376_10083249
374 Ga0163161_10024857
375 Ga0213876_10012025
376 Ga0207426_1000104
377 Ga0207642_10004146
378 Ga0207647_10000491
379 Ga0207645_10009721
380 Ga0207643_10003438
381 Ga0207705_10018038
382 Ga0207662_10058275
383 Ga0207649_10062692
384 Ga0207681_10016644
385 Ga0207650_10092823
386 Ga0207659_10006734
387 Ga0207644_10011349
388 Ga0207644_10032667
389 Ga0207690_10018682
390 Ga0207706_10027015
391 Ga0207706_10030989
392 Ga0207706_10031432
393 Ga0207686_10001023
394 Ga0207670_10002872
395 Ga0207704_10009475
396 Ga0207691_10008415
397 Ga0207691_10014903
398 Ga0207691_10083925
399 Ga0207691_10133171
400 Ga0207689_10017893
401 Ga0207689_10025610
402 Ga0207689_10061309
403 Ga0207661_10017740
404 Ga0207679_10000777
405 Ga0207651_10014463
406 Ga0207651_10020492
407 Ga0207651_10056154
408 Ga0207651_10112573
409 Ga0207712_10000883
410 Ga0207712_10005652
411 Ga0207640_10008037
412 Ga0207658_10019680
413 Ga0207703_10054372
414 Ga0207639_10026983
415 Ga0207678_10116136
416 Ga0207708_10034135
417 Ga0207708_10047493
418 Ga0207641_10001211
419 Ga0207648_10003652
420 Ga0207648_10027695
421 Ga0207648_10083838
422 Ga0207676_10024768
423 Ga0207676_10040991
424 Ga0207676_10137138
425 Ga0207674_10003303
426 Ga0207674_10010027
427 Ga0207674_10116937
428 Ga0207675_100008354
429 Ga0207675_100016834
430 Ga0207683_10006924
431 Ga0207683_10011596
432 Ga0207698_10004661
433 Ga0207698_10010210
434 Ga0268264_10001090
435 Ga0265327_10000974
436 Ga0395900_0195158
437 Ga0436365_0212609
438 Ga0450894_003256
439 Ga0453684_0023157
440 Ga0495630_0004081
441 Ga0495668_0000212
442 Ga0495672_0047528
443 Ga0495686_0010470
444 Ga0501034_0007696
445 Ga0501036_0008875
446 Ga0501037_0013848
447 Ga0501038_0014503
448 Ga0501039_0006695
449 Ga0501039_0029121
450 Ga0501043_0003681
451 Ga0501046_0003394
452 Ga0501067_0006884
453 Ga0501070_0009462
454 Ga0501074_0002265
455 Ga0501080_0016638
456 Ga0501083_0010295
457 Ga0501035_0093657
458 Ga0501044_0016285
459 Ga0501044_0020439
460 Ga0501044_0028605
461 Ga0501044_0034366
462 nmdc:mga0k408_17861_c1
463 nmdc:mga09592_30892_c1
464 Ga0500644_0010482
465 Ga0500646_0006570
466 Ga0500562_000073
467 Ga0500568_0001078
468 Ga0500661_001277
469 2819588088
470 2929157917

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17768

RecJ_OB

RecJ OB domain

457

563

0.94

PF01368

DHH

DHH family

79

231

0.93

PF02272

DHHA1

DHHA1 domain

315

442

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zxr-assembly1.cif.gz_A crystal structure of recj in complex with mg2+ from thermus thermophilus hb8 0.898 10 559
2zxp-assembly1.cif.gz_A crystal structure of recj in complex with mn2+ from thermus thermophilus hb8 0.8869 10 559
5f54-assembly1.cif.gz_A structure of recj complexed with dtmp 0.8395 8 556
6lrd-assembly1.cif.gz_A structure of recj complexed with a 5'-p-dspacer-modified ssdna 0.837 9 559
5f56-assembly1.cif.gz_A structure of recj complexed with dna and ssb-ct 0.821 6 559
ID Description Score Start End Superfamily
af_P21893_50_326_3.90.1640.30 Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core); 0.9137 62 311 3.90.1640.30
af_P21893_327_456_3.10.310.30 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.9092 316 435 3.10.310.30
af_Q2FXT9_57_316_3.90.1640.30 Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core); 0.9087 60 309 3.90.1640.30
af_Q2FXT9_317_441_3.10.310.30 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.9004 315 435 3.10.310.30
5f56A02 Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core); 0.8919 66 310 3.90.1640.30
ID Description Score Start End GO Terms
AF-A0A4Q3RHM7-F1-model_v4 Single-stranded-DNA-specific exonuclease RecJ 0.9698 285 557 GO:0003676
GO:0004527
AF-A0A5C9CDG9-F1-model_v4 Single-stranded-DNA-specific exonuclease RecJ 0.9642 7 557 GO:0003676
GO:0006281
GO:0006310
GO:0008409
AF-A0A4Q3RHM7-F1-model_v4 Single-stranded-DNA-specific exonuclease RecJ 0.9629 285 557 GO:0003676
GO:0004527
AF-A0A7C1GAB8-F1-model_v4 Single-stranded-DNA-specific exonuclease RecJ 0.9595 7 557 GO:0003676
GO:0006281
GO:0006310
GO:0008409
AF-A0A2G4I0H2-F1-model_v4 Single-stranded-DNA-specific exonuclease RecJ 0.9568 7 559 GO:0003676
GO:0006281
GO:0006310
GO:0008409

Map