F348269

General Info

Members Datasets Scaffolds Average Seq Length
235 127 470 271

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10217773|Ga0265316_102177732
Length 281
Sequence MRAENSILKMRDQLQVVVSGGFDDVKSRDLRFLEEAAKLGELTVLLWPDETLQKVSGKAPKFPLAERRYFLNAVRYVRRVIEADSSANFDTLPRNLRANLWADVEATANAAREKFAAENKIARRVFSADDLKGFPEPPPMPSAPGRKKIVATGCYDWFHSGHVRFTEEVSAYGDLYVIIGHDANIRLLKGEGHPLLPQEERRYVVGSIKFVKQALISSGEGWLDADPEIKKLKPDIYAVNEDGDKGGKREYCRKLGIEYLVLKRTPAPGLPKRSSTDLRGF

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
14 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
33 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
50 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
51 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
52 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
53 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
54 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
55 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
56 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
59 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
60 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
61 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
62 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
63 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
64 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
65 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
66 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
67 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
68 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
69 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
70 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
71 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
72 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
73 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
74 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
75 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
76 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
77 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
78 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
79 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
80 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
81 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
82 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
85 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
94 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
106 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
107 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
110 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
111 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
112 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
113 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
114 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
115 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.72
Stem 0
Stem Tuber 0
Unclassified 24.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10217773 3300031344 Bacteria 1410
2 rootH2_10010433 3300003320 Bacteria 15628
3 Ga0070658_10170196 3300005327 Unclassified 1830
4 Ga0070683_100013242 3300005329 Bacteria 7188
5 Ga0070689_100157147 3300005340 Bacteria 1836
6 Ga0070691_10060909 3300005341 Bacteria 1815
7 Ga0070714_100105619 3300005435 Bacteria 2487
8 Ga0070711_100021533 3300005439 Unclassified 4171
9 Ga0070711_100088609 3300005439 Bacteria 2224
10 Ga0070681_10067544 3300005458 Bacteria 3543
11 Ga0070681_10636467 3300005458 Bacteria 981
12 Ga0068867_100070441 3300005459 Bacteria 2614
13 Ga0070684_100008425 3300005535 Bacteria 8058
14 Ga0068855_100021560 3300005563 Bacteria 7727
15 Ga0068855_100041835 3300005563 Bacteria 5430
16 Ga0068855_100193008 3300005563 Bacteria 2296
17 Ga0068864_100195358 3300005618 Unclassified 1856
18 Ga0068870_10051984 3300005840 Bacteria 2171
19 Ga0068860_100112600 3300005843 Bacteria 2602
20 Ga0068862_100608471 3300005844 Unclassified 1050
21 Ga0097621_100024898 3300006237 Unclassified 4679
22 Ga0068871_100032283 3300006358 Unclassified 4135
23 Ga0105240_10009028 3300009093 Bacteria 14157
24 Ga0105240_10129837 3300009093 Bacteria 3024
25 Ga0105240_10172510 3300009093 Bacteria 2560
26 Ga0105245_10034236 3300009098 Bacteria 4504
27 Ga0105243_10057058 3300009148 Unclassified 3108
28 Ga0105241_10159946 3300009174 Bacteria 1850
29 Ga0105248_10264968 3300009177 Unclassified 1934
30 Ga0105248_10702342 3300009177 Bacteria 1141
31 Ga0105237_10014187 3300009545 Bacteria 8343
32 Ga0105238_10004756 3300009551 Bacteria 13433
33 Ga0105238_10011149 3300009551 Bacteria 9039
34 Ga0105238_10104386 3300009551 Bacteria 2815
35 Ga0105238_10251707 3300009551 Bacteria 1745
36 Ga0105249_10304512 3300009553 Unclassified 1600
37 Ga0105239_10058101 3300010375 Bacteria 4244
38 Ga0157369_10086034 3300013105 Bacteria 3358
39 Ga0157374_10027783 3300013296 Bacteria 5108
40 Ga0157374_10054710 3300013296 Bacteria 3723
41 Ga0157374_10060164 3300013296 Bacteria 3554
42 Ga0157378_10039471 3300013297 Bacteria 4187
43 Ga0157378_10079001 3300013297 Bacteria 2970
44 Ga0157372_10327798 3300013307 Bacteria 1783
45 Ga0157379_10447044 3300014968 Unclassified 1193
46 Ga0207705_10133130 3300025909 Unclassified 1851
47 Ga0207707_10045119 3300025912 Bacteria 3841
48 Ga0207707_10515989 3300025912 Unclassified 1018
49 Ga0207695_10066572 3300025913 Bacteria 3699
50 Ga0207663_10005293 3300025916 Bacteria 6495
51 Ga0207663_10089245 3300025916 Bacteria 2041
52 Ga0207694_10013591 3300025924 Bacteria 6136
53 Ga0207694_10384720 3300025924 Bacteria 1165
54 Ga0207694_10497790 3300025924 Bacteria 1020
55 Ga0207670_10065660 3300025936 Bacteria 2491
56 Ga0207689_10085910 3300025942 Unclassified 2586
57 Ga0207661_10229489 3300025944 Bacteria 1643
58 Ga0207667_10189516 3300025949 Bacteria 2110
59 Ga0207667_10259885 3300025949 Unclassified 1775
60 Ga0207712_10236452 3300025961 Unclassified 1469
61 Ga0207639_10112142 3300026041 Bacteria 2225
62 Ga0207639_10275839 3300026041 Bacteria 1477
63 Ga0207702_10071320 3300026078 Bacteria 2991
64 Ga0207702_10078107 3300026078 Unclassified 2865
65 Ga0207648_10072021 3300026089 Bacteria 3012
66 Ga0207648_10481188 3300026089 Unclassified 1134
67 Ga0207676_10331416 3300026095 Unclassified 1401
68 Ga0207674_10155683 3300026116 Unclassified 2241
69 Ga0268264_10216650 3300028381 Unclassified 1760
70 Ga0265337_1000257 3300028556 Bacteria 28698
71 Ga0265337_1030214 3300028556 Unclassified 1615
72 Ga0265326_10006605 3300028558 Unclassified 3593
73 Ga0265326_10068269 3300028558 Unclassified 1005
74 Ga0265319_1000019 3300028563 Bacteria 154537
75 Ga0265319_1044600 3300028563 Unclassified 1485
76 Ga0265319_1053877 3300028563 Bacteria 1320
77 Ga0265319_1073023 3300028563 Bacteria 1097
78 Ga0265334_10006397 3300028573 Bacteria 5079
79 Ga0265334_10024493 3300028573 Bacteria 2447
80 Ga0265334_10026926 3300028573 Unclassified 2318
81 Ga0265318_10019912 3300028577 Bacteria 2716
82 Ga0265323_10000489 3300028653 Bacteria 22332
83 Ga0265323_10017803 3300028653 Bacteria 2755
84 Ga0265323_10022498 3300028653 Bacteria 2409
85 Ga0265323_10042818 3300028653 Unclassified 1637
86 Ga0265322_10003080 3300028654 Bacteria 5081
87 Ga0265336_10032335 3300028666 Bacteria 1623
88 Ga0265338_10000593 3300028800 Bacteria 63891
89 Ga0265338_10000942 3300028800 Bacteria 49028
90 Ga0265338_10001055 3300028800 Bacteria 45944
91 Ga0265338_10001593 3300028800 Bacteria 36415
92 Ga0265338_10003093 3300028800 Bacteria 23869
93 Ga0265338_10005663 3300028800 Bacteria 16199
94 Ga0265338_10007463 3300028800 Bacteria 13558
95 Ga0265338_10023411 3300028800 Bacteria 6352
96 Ga0265338_10032856 3300028800 Bacteria 5050
97 Ga0265338_10048252 3300028800 Bacteria 3876
98 Ga0265338_10048793 3300028800 Bacteria 3847
99 Ga0265338_10052151 3300028800 Bacteria 3675
100 Ga0265338_10062923 3300028800 Bacteria 3240
101 Ga0265338_10073472 3300028800 Unclassified 2914
102 Ga0265338_10130625 3300028800 Bacteria 1984
103 Ga0265338_10183253 3300028800 Bacteria 1594
104 Ga0265338_10238105 3300028800 Unclassified 1350
105 Ga0265324_10002489 3300029957 Bacteria 9358
106 Ga0265324_10012120 3300029957 Bacteria 3263
107 Ga0265324_10048687 3300029957 Bacteria 1457
108 Ga0265324_10054894 3300029957 Unclassified 1366
109 Ga0265324_10090422 3300029957 Bacteria 1041
110 Ga0265332_10016306 3300031238 Unclassified 3278
111 Ga0265332_10152177 3300031238 Bacteria 968
112 Ga0265328_10003715 3300031239 Bacteria 6727
113 Ga0265320_10000471 3300031240 Bacteria 31514
114 Ga0265320_10006946 3300031240 Bacteria 7066
115 Ga0265320_10052053 3300031240 Bacteria 1984
116 Ga0265320_10064996 3300031240 Unclassified 1732
117 Ga0265320_10091317 3300031240 Bacteria 1410
118 Ga0265325_10012464 3300031241 Bacteria 4860
119 Ga0265325_10027618 3300031241 Bacteria 3066
120 Ga0265329_10004933 3300031242 Bacteria 5461
121 Ga0265340_10003453 3300031247 Bacteria 8916
122 Ga0265340_10037784 3300031247 Unclassified 2391
123 Ga0265340_10060499 3300031247 Bacteria 1814
124 Ga0265339_10005040 3300031249 Bacteria 8878
125 Ga0265339_10042394 3300031249 Bacteria 2520
126 Ga0265339_10066958 3300031249 Bacteria 1922
127 Ga0265327_10012050 3300031251 Bacteria 5875
128 Ga0265316_10000858 3300031344 Bacteria 33524
129 Ga0265316_10004118 3300031344 Bacteria 14554
130 Ga0265316_10008525 3300031344 Bacteria 9503
131 Ga0265316_10016327 3300031344 Bacteria 6444
132 Ga0265316_10020064 3300031344 Bacteria 5698
133 Ga0265316_10032701 3300031344 Unclassified 4243
134 Ga0265316_10041295 3300031344 Unclassified 3692
135 Ga0265316_10049616 3300031344 Bacteria 3305
136 Ga0265316_10061658 3300031344 Unclassified 2912
137 Ga0265316_10069510 3300031344 Bacteria 2717
138 Ga0265316_10103111 3300031344 Unclassified 2166
139 Ga0265313_10002938 3300031595 Bacteria 14231
140 Ga0265313_10004422 3300031595 Bacteria 10829
141 Ga0265313_10055720 3300031595 Unclassified 1872
142 Ga0265314_10000554 3300031711 Bacteria 47642
143 Ga0265314_10009473 3300031711 Bacteria 8214
144 Ga0265314_10032695 3300031711 Unclassified 3823
145 Ga0265314_10049181 3300031711 Unclassified 2954
146 Ga0265314_10086183 3300031711 Bacteria 2057
147 Ga0265314_10162000 3300031711 Bacteria 1360
148 Ga0265314_10298952 3300031711 Unclassified 904
149 Ga0265342_10031222 3300031712 Bacteria 3295
150 Ga0265342_10062846 3300031712 Bacteria 2184
151 Ga0265342_10206566 3300031712 Unclassified 1064
152 Ga0265342_10207230 3300031712 Unclassified 1062
153 Ga0316576_10348559 3300031727 Bacteria 1102
154 Ga0373930_0004943 3300034816 Unclassified 2194
155 Ga0373948_0018104 3300034817 Unclassified 1320
156 Ga0373950_0001716 3300034818 Unclassified 2902
157 Ga0373926_0023394 3300035083 Bacteria 2146
158 Ga0373928_0000080 3300035084 Bacteria 16471
159 Ga0373929_0000250 3300035085 Bacteria 9928
160 Ga0373949_0000873 3300035090 Bacteria 9519
161 Ga0373951_0000759 3300035091 Bacteria 8829
162 Ga0373932_0000001 3300035112 Bacteria 1459067
163 Ga0373945_0004789 3300035116 Bacteria 4308
164 Ga0373954_0019232 3300035118 Bacteria 3079
165 Ga0373946_0025147 3300035171 Bacteria 2340
166 Ga0373946_0089787 3300035171 Unclassified 1360
167 Ga0373955_0064784 3300035172 Unclassified 2027
168 Ga0373962_0000032 3300035242 Bacteria 35295
169 Ga0373924_0162083 3300035410 Bacteria 981
170 Ga0373931_0000008 3300035691 Bacteria 362269
171 Ga0373935_0007553 3300035692 Bacteria 6509
172 Ga0373935_0009016 3300035692 Bacteria 5968
173 Ga0373927_0003491 3300035695 Bacteria 11259
174 Ga0373927_0030950 3300035695 Bacteria 3491
175 Ga0373927_0033677 3300035695 Bacteria 3335
176 Ga0373927_0077753 3300035695 Unclassified 2149
177 Ga0373927_0216155 3300035695 Bacteria 1259
178 Ga0373933_0090569 3300035724 Bacteria 1887
179 Ga0373947_0016379 3300035725 Bacteria 4260
180 Ga0373937_0063785 3300036401 Unclassified 3389
181 Ga0373925_0000451 3300037068 Bacteria 41493
182 Ga0373925_0001089 3300037068 Bacteria 24361
183 Ga0373925_0299563 3300037068 Bacteria 1298
184 Ga0400483_164363 3300039062 Bacteria 1715
185 Ga0400489_68283 3300039093 Unclassified 1618
186 Ga0451577_0005102 3300042876 Bacteria 13535
187 Ga0451577_0100925 3300042876 Bacteria 2578
188 Ga0453683_0234061 3300044673 Bacteria 1169
189 Ga0453684_0005942 3300044712 Bacteria 23675
190 Ga0453684_0015632 3300044712 Bacteria 11969
191 Ga0453684_0135476 3300044712 Bacteria 2950
192 Ga0453684_0211500 3300044712 Bacteria 2254
193 Ga0453684_0287916 3300044712 Bacteria 1871
194 Ga0453684_0668247 3300044712 Unclassified 1132
195 Ga0453684_0925888 3300044712 Unclassified 932
196 Ga0451576_0084458 3300045051 Bacteria 3303
197 Ga0451576_0217062 3300045051 Bacteria 1997
198 Ga0495641_0029868 3300046461 Bacteria 2621
199 Ga0495582_0076664 3300046473 Bacteria 1854
200 Ga0495639_0154166 3300046475 Unclassified 1109
201 Ga0495662_0110694 3300046476 Bacteria 1346
202 Ga0495662_0149681 3300046476 Bacteria 1149
203 Ga0495628_0247654 3300046516 Bacteria 1331
204 Ga0495630_0000085 3300046517 Bacteria 73665
205 Ga0495630_0017079 3300046517 Bacteria 5311
206 Ga0495630_0105841 3300046517 Bacteria 2130
207 Ga0495666_0111232 3300046526 Bacteria 1286
208 Ga0495640_0042994 3300046533 Bacteria 3149
209 Ga0495586_0000012 3300046535 Bacteria 138093
210 Ga0495586_0037862 3300046535 Bacteria 2589
211 Ga0495587_0093783 3300046536 Bacteria 1733
212 Ga0495645_0100976 3300046543 Bacteria 2051
213 Ga0495622_0053865 3300046557 Unclassified 1867
214 Ga0495634_0010721 3300046642 Bacteria 6708
215 Ga0495634_0012884 3300046642 Bacteria 6053
216 Ga0495658_0006537 3300046683 Bacteria 5726
217 Ga0495613_0319623 3300046689 Unclassified 1072
218 Ga0495624_0204120 3300046690 Bacteria 1200
219 Ga0495581_0231165 3300047315 Unclassified 1082
220 Ga0495674_0000442 3300047319 Bacteria 37312
221 Ga0495674_0125580 3300047319 Bacteria 2165
222 Ga0495676_0003605 3300047321 Bacteria 14053
223 Ga0495676_0063747 3300047321 Bacteria 2871
224 Ga0495680_0159848 3300047322 Bacteria 1637
225 Ga0495684_0112047 3300047471 Bacteria 2058
226 Ga0501031_0206431 3300049568 Unclassified 1281
227 Ga0501034_0022654 3300049571 Bacteria 6399
228 Ga0501034_0268165 3300049571 Bacteria 1649
229 Ga0501037_0058996 3300049573 Unclassified 2800
230 Ga0501070_0014337 3300049586 Bacteria 6672
231 Ga0501080_0050110 3300049742 Bacteria 3887
232 Ga0501035_0037481 3300049822 Bacteria 4391
233 Ga0501035_0047879 3300049822 Bacteria 3836
234 Ga0501044_0000288 3300049823 Bacteria 64311
235 Ga0495601_0150777 3300053077 Bacteria 1518
236 Ga0265316_10217773
237 rootH2_10010433
238 Ga0070658_10170196
239 Ga0070683_100013242
240 Ga0070689_100157147
241 Ga0070691_10060909
242 Ga0070714_100105619
243 Ga0070711_100021533
244 Ga0070711_100088609
245 Ga0070681_10067544
246 Ga0070681_10636467
247 Ga0068867_100070441
248 Ga0070684_100008425
249 Ga0068855_100021560
250 Ga0068855_100041835
251 Ga0068855_100193008
252 Ga0068864_100195358
253 Ga0068870_10051984
254 Ga0068860_100112600
255 Ga0068862_100608471
256 Ga0097621_100024898
257 Ga0068871_100032283
258 Ga0105240_10009028
259 Ga0105240_10129837
260 Ga0105240_10172510
261 Ga0105245_10034236
262 Ga0105243_10057058
263 Ga0105241_10159946
264 Ga0105248_10264968
265 Ga0105248_10702342
266 Ga0105237_10014187
267 Ga0105238_10004756
268 Ga0105238_10011149
269 Ga0105238_10104386
270 Ga0105238_10251707
271 Ga0105249_10304512
272 Ga0105239_10058101
273 Ga0157369_10086034
274 Ga0157374_10027783
275 Ga0157374_10054710
276 Ga0157374_10060164
277 Ga0157378_10039471
278 Ga0157378_10079001
279 Ga0157372_10327798
280 Ga0157379_10447044
281 Ga0207705_10133130
282 Ga0207707_10045119
283 Ga0207707_10515989
284 Ga0207695_10066572
285 Ga0207663_10005293
286 Ga0207663_10089245
287 Ga0207694_10013591
288 Ga0207694_10384720
289 Ga0207694_10497790
290 Ga0207670_10065660
291 Ga0207689_10085910
292 Ga0207661_10229489
293 Ga0207667_10189516
294 Ga0207667_10259885
295 Ga0207712_10236452
296 Ga0207639_10112142
297 Ga0207639_10275839
298 Ga0207702_10071320
299 Ga0207702_10078107
300 Ga0207648_10072021
301 Ga0207648_10481188
302 Ga0207676_10331416
303 Ga0207674_10155683
304 Ga0268264_10216650
305 Ga0265337_1000257
306 Ga0265337_1030214
307 Ga0265326_10006605
308 Ga0265326_10068269
309 Ga0265319_1000019
310 Ga0265319_1044600
311 Ga0265319_1053877
312 Ga0265319_1073023
313 Ga0265334_10006397
314 Ga0265334_10024493
315 Ga0265334_10026926
316 Ga0265318_10019912
317 Ga0265323_10000489
318 Ga0265323_10017803
319 Ga0265323_10022498
320 Ga0265323_10042818
321 Ga0265322_10003080
322 Ga0265336_10032335
323 Ga0265338_10000593
324 Ga0265338_10000942
325 Ga0265338_10001055
326 Ga0265338_10001593
327 Ga0265338_10003093
328 Ga0265338_10005663
329 Ga0265338_10007463
330 Ga0265338_10023411
331 Ga0265338_10032856
332 Ga0265338_10048252
333 Ga0265338_10048793
334 Ga0265338_10052151
335 Ga0265338_10062923
336 Ga0265338_10073472
337 Ga0265338_10130625
338 Ga0265338_10183253
339 Ga0265338_10238105
340 Ga0265324_10002489
341 Ga0265324_10012120
342 Ga0265324_10048687
343 Ga0265324_10054894
344 Ga0265324_10090422
345 Ga0265332_10016306
346 Ga0265332_10152177
347 Ga0265328_10003715
348 Ga0265320_10000471
349 Ga0265320_10006946
350 Ga0265320_10052053
351 Ga0265320_10064996
352 Ga0265320_10091317
353 Ga0265325_10012464
354 Ga0265325_10027618
355 Ga0265329_10004933
356 Ga0265340_10003453
357 Ga0265340_10037784
358 Ga0265340_10060499
359 Ga0265339_10005040
360 Ga0265339_10042394
361 Ga0265339_10066958
362 Ga0265327_10012050
363 Ga0265316_10000858
364 Ga0265316_10004118
365 Ga0265316_10008525
366 Ga0265316_10016327
367 Ga0265316_10020064
368 Ga0265316_10032701
369 Ga0265316_10041295
370 Ga0265316_10049616
371 Ga0265316_10061658
372 Ga0265316_10069510
373 Ga0265316_10103111
374 Ga0265313_10002938
375 Ga0265313_10004422
376 Ga0265313_10055720
377 Ga0265314_10000554
378 Ga0265314_10009473
379 Ga0265314_10032695
380 Ga0265314_10049181
381 Ga0265314_10086183
382 Ga0265314_10162000
383 Ga0265314_10298952
384 Ga0265342_10031222
385 Ga0265342_10062846
386 Ga0265342_10206566
387 Ga0265342_10207230
388 Ga0316576_10348559
389 Ga0373930_0004943
390 Ga0373948_0018104
391 Ga0373950_0001716
392 Ga0373926_0023394
393 Ga0373928_0000080
394 Ga0373929_0000250
395 Ga0373949_0000873
396 Ga0373951_0000759
397 Ga0373932_0000001
398 Ga0373945_0004789
399 Ga0373954_0019232
400 Ga0373946_0025147
401 Ga0373946_0089787
402 Ga0373955_0064784
403 Ga0373962_0000032
404 Ga0373924_0162083
405 Ga0373931_0000008
406 Ga0373935_0007553
407 Ga0373935_0009016
408 Ga0373927_0003491
409 Ga0373927_0030950
410 Ga0373927_0033677
411 Ga0373927_0077753
412 Ga0373927_0216155
413 Ga0373933_0090569
414 Ga0373947_0016379
415 Ga0373937_0063785
416 Ga0373925_0000451
417 Ga0373925_0001089
418 Ga0373925_0299563
419 Ga0400483_164363
420 Ga0400489_68283
421 Ga0451577_0005102
422 Ga0451577_0100925
423 Ga0453683_0234061
424 Ga0453684_0005942
425 Ga0453684_0015632
426 Ga0453684_0135476
427 Ga0453684_0211500
428 Ga0453684_0287916
429 Ga0453684_0668247
430 Ga0453684_0925888
431 Ga0451576_0084458
432 Ga0451576_0217062
433 Ga0495641_0029868
434 Ga0495582_0076664
435 Ga0495639_0154166
436 Ga0495662_0110694
437 Ga0495662_0149681
438 Ga0495628_0247654
439 Ga0495630_0000085
440 Ga0495630_0017079
441 Ga0495630_0105841
442 Ga0495666_0111232
443 Ga0495640_0042994
444 Ga0495586_0000012
445 Ga0495586_0037862
446 Ga0495587_0093783
447 Ga0495645_0100976
448 Ga0495622_0053865
449 Ga0495634_0010721
450 Ga0495634_0012884
451 Ga0495658_0006537
452 Ga0495613_0319623
453 Ga0495624_0204120
454 Ga0495581_0231165
455 Ga0495674_0000442
456 Ga0495674_0125580
457 Ga0495676_0003605
458 Ga0495676_0063747
459 Ga0495680_0159848
460 Ga0495684_0112047
461 Ga0501031_0206431
462 Ga0501034_0022654
463 Ga0501034_0268165
464 Ga0501037_0058996
465 Ga0501070_0014337
466 Ga0501080_0050110
467 Ga0501035_0037481
468 Ga0501035_0047879
469 Ga0501044_0000288
470 Ga0495601_0150777

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

150

280

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b7l-assembly2.cif.gz_D crystal structure of ctp:glycerol-3-phosphate cytidylyltransferase from staphylococcus aureus 0.8316 138 255
2b7l-assembly2.cif.gz_D crystal structure of ctp:glycerol-3-phosphate cytidylyltransferase from staphylococcus aureus 0.8184 138 255
5xf2-assembly1.cif.gz_A crystal structure of semet-hldc from burkholderia pseudomallei 0.8027 132 254
3glv-assembly1.cif.gz_B crystal structure of the lipopolysaccharide core biosynthesis protein from thermoplasma volcanium gss1 0.798 136 259
4zct-assembly1.cif.gz_A crystal structure of the c-terminal catalytic domain of plasmodium falciparum ctp:phosphocholine cytidylyltransferase 0.7955 138 256
ID Description Score Start End Superfamily
af_P76658_320_476_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8325 136 260 3.40.50.620
2b7lD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8316 138 255 3.40.50.620
af_A0A0P0W8Q2_275_503_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8302 225 253 3.30.420.10
2b7lD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8184 138 255 3.40.50.620
3glvB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.798 136 259 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7J3XGK4-F1-model_v4 DUF357 domain-containing protein 0.9755 2 71 GO:0009058
GO:0016740
AF-A0A6G3LK04-F1-model_v4 DUF357 domain-containing protein 0.9748 2 71 GO:0009058
GO:0016740
AF-A0A6B0WWG2-F1-model_v4 Adenylyltransferase/cytidyltransferase family protein 0.9733 3 232 GO:0009058
GO:0016779
AF-A0A5C6DRX8-F1-model_v4 Bifunctional protein HldE 0.973 1 272 GO:0003824
GO:0009058
AF-A0A5C6DRX8-F1-model_v4 Bifunctional protein HldE 0.9695 1 272 GO:0003824
GO:0009058

Map