F348265

General Info

Members Datasets Scaffolds Average Seq Length
235 165 234 331

Family's Representative Sequence

Representative Sequence 3300031247|Ga0265340_10029082|Ga0265340_100290822
Length 366
Sequence VVELEHGYLPATRNLLFPVRSDICRQRDPLYPRGMKAHSSLIAAALFSLGSFGALTGCNKEAAPPLRVAFSDWPGWTAFEIGIQKGWFKEAGVDVKFDWFEYAPSMDAFTAGKVDAVMMTMGDALVTGAPGARSVAILVTDYSAGNDMIVAKKGIPSLKALKGKKVGLEVGLVEHLMLTKALEKNGLKITDVKLVNVPTHETAQTLASGSVDAIGAWQPNAGQALKGAAGSKAIFTSADLPGLIYDLVCVSPQSLATRRADWVNFVKVWNRIVTFVRDPANKDEAVKIMAGRAGVPAAEYATYLPGTRFLTPEEALTRFTPTETLASLLGSGKVADDFNVANKVYAKPQPVASYIDGSLSKEALAK

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
81 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
84 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
85 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
86 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
87 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
88 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
91 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
102 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
103 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
104 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
105 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
106 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
107 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
108 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
110 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
111 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
112 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
162 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
163 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.28
Nodule 0
Rhizoplane 2.55
Rhizosphere 92.34
Stem 0
Stem Tuber 0
Unclassified 3.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1003629 3300001977 Bacteria 2430
2 rootH2_10051144 3300003320 Bacteria 9433
3 rootH2_10186741 3300003320 Bacteria 1679
4 rootH1_10145216 3300003323 Bacteria 2130
5 rootH1_10235033 3300003323 Bacteria 2559
6 Ga0070658_10001753 3300005327 Bacteria 18277
7 Ga0070658_10045219 3300005327 Bacteria 3560
8 Ga0070676_10115637 3300005328 Bacteria 1676
9 Ga0070670_100052769 3300005331 Bacteria 3491
10 Ga0070670_100131062 3300005331 Bacteria 2165
11 Ga0068869_100000005 3300005334 Bacteria 103764
12 Ga0068869_100125483 3300005334 Bacteria 1968
13 Ga0068868_100116892 3300005338 Bacteria 2172
14 Ga0068868_100172863 3300005338 Bacteria 1789
15 Ga0068868_100464413 3300005338 Bacteria 1103
16 Ga0070689_100000001 3300005340 Bacteria 1334580
17 Ga0070689_100150703 3300005340 Bacteria 1875
18 Ga0070661_100003294 3300005344 Bacteria 11147
19 Ga0070668_100112412 3300005347 Unclassified 2169
20 Ga0070669_100018960 3300005353 Bacteria 4917
21 Ga0070675_100152564 3300005354 Bacteria 1982
22 Ga0070675_100181378 3300005354 Bacteria 1821
23 Ga0070659_100218844 3300005366 Bacteria 1571
24 Ga0070709_10194206 3300005434 Bacteria 1434
25 Ga0070713_100026281 3300005436 Bacteria 4568
26 Ga0070710_10009566 3300005437 Bacteria 4746
27 Ga0070710_10015614 3300005437 Bacteria 3848
28 Ga0070681_10287300 3300005458 Bacteria 1555
29 Ga0068867_100000025 3300005459 Bacteria 92038
30 Ga0068867_100000853 3300005459 Bacteria 20577
31 Ga0068853_100002243 3300005539 Bacteria 14443
32 Ga0070672_100057161 3300005543 Bacteria 3062
33 Ga0070686_100001555 3300005544 Bacteria 12887
34 Ga0070664_100008842 3300005564 Bacteria 8160
35 Ga0068857_100185050 3300005577 Bacteria 1896
36 Ga0068856_100000673 3300005614 Bacteria 37096
37 Ga0068856_100313345 3300005614 Bacteria 1587
38 Ga0068852_100100068 3300005616 Bacteria 2615
39 Ga0068866_10104441 3300005718 Bacteria 1569
40 Ga0068861_100034680 3300005719 Bacteria 3732
41 Ga0068863_100482602 3300005841 Bacteria 1219
42 Ga0068860_100000107 3300005843 Bacteria 133502
43 Ga0070717_10000408 3300006028 Bacteria 27493
44 Ga0097621_100006890 3300006237 Bacteria 8085
45 Ga0068871_100138417 3300006358 Bacteria 2069
46 Ga0075428_100441594 3300006844 Unclassified 1394
47 Ga0068865_100005738 3300006881 Bacteria 7544
48 Ga0068865_100020177 3300006881 Bacteria 4321
49 Ga0105240_10000186 3300009093 Bacteria 126271
50 Ga0105240_10009408 3300009093 Bacteria 13838
51 Ga0111539_10202974 3300009094 Bacteria 2311
52 Ga0105243_10000065 3300009148 Bacteria 124947
53 Ga0105242_10124724 3300009176 Bacteria 2215
54 Ga0105238_10002345 3300009551 Bacteria 19042
55 Ga0105238_10030479 3300009551 Bacteria 5491
56 Ga0157373_10000100 3300013100 Bacteria 70609
57 Ga0157374_10287227 3300013296 Bacteria 1625
58 Ga0157378_10029630 3300013297 Bacteria 4834
59 Ga0157375_10452416 3300013308 Bacteria 1450
60 Ga0163163_10299251 3300014325 Bacteria 1661
61 Ga0157376_10112584 3300014969 Bacteria 2398
62 Ga0213876_10171590 3300021384 Bacteria 1154
63 Ga0207642_10061307 3300025899 Bacteria 1749
64 Ga0207699_10028756 3300025906 Bacteria 3093
65 Ga0207699_10167203 3300025906 Bacteria 1469
66 Ga0207645_10045527 3300025907 Bacteria 2804
67 Ga0207705_10016999 3300025909 Bacteria 5210
68 Ga0207707_10021636 3300025912 Bacteria 5620
69 Ga0207707_10029159 3300025912 Bacteria 4824
70 Ga0207695_10000281 3300025913 Bacteria 126279
71 Ga0207695_10009874 3300025913 Bacteria 11729
72 Ga0207671_10000245 3300025914 Bacteria 81222
73 Ga0207649_10013478 3300025920 Bacteria 4564
74 Ga0207649_10069763 3300025920 Bacteria 2239
75 Ga0207652_10068079 3300025921 Bacteria 3088
76 Ga0207694_10031434 3300025924 Bacteria 4055
77 Ga0207694_10108342 3300025924 Bacteria 2207
78 Ga0207700_10034211 3300025928 Bacteria 3646
79 Ga0207690_10181699 3300025932 Bacteria 1584
80 Ga0207709_10003761 3300025935 Bacteria 8924
81 Ga0207670_10000036 3300025936 Bacteria 106829
82 Ga0207704_10003458 3300025938 Bacteria 7180
83 Ga0207691_10050658 3300025940 Bacteria 3801
84 Ga0207691_10056667 3300025940 Bacteria 3569
85 Ga0207689_10000629 3300025942 Bacteria 33613
86 Ga0207661_10094681 3300025944 Bacteria 2495
87 Ga0207679_10002240 3300025945 Bacteria 11948
88 Ga0207651_10150379 3300025960 Unclassified 1811
89 Ga0207640_10178031 3300025981 Bacteria 1592
90 Ga0207677_10101341 3300026023 Bacteria 2120
91 Ga0207639_10105109 3300026041 Bacteria 2290
92 Ga0207702_10001250 3300026078 Bacteria 25644
93 Ga0207641_10407734 3300026088 Bacteria 1306
94 Ga0207648_10000702 3300026089 Bacteria 37525
95 Ga0207648_10005750 3300026089 Bacteria 12430
96 Ga0207674_10181582 3300026116 Bacteria 2055
97 Ga0207683_10156243 3300026121 Bacteria 2060
98 Ga0207698_10074450 3300026142 Bacteria 2709
99 Ga0207428_10019461 3300027907 Bacteria 5787
100 Ga0268264_10000807 3300028381 Bacteria 33745
101 Ga0265337_1008664 3300028556 Bacteria 3679
102 Ga0265336_10003159 3300028666 Bacteria 6553
103 Ga0265338_10002420 3300028800 Bacteria 28060
104 Ga0265338_10003754 3300028800 Bacteria 21100
105 Ga0265338_10019415 3300028800 Bacteria 7213
106 Ga0265338_10035606 3300028800 Bacteria 4780
107 Ga0265338_10082604 3300028800 Bacteria 2689
108 Ga0265338_10158519 3300028800 Bacteria 1750
109 Ga0307511_10006467 3300030521 Bacteria 11804
110 Ga0265332_10000953 3300031238 Bacteria 17127
111 Ga0265332_10004781 3300031238 Bacteria 6308
112 Ga0265328_10007557 3300031239 Bacteria 4527
113 Ga0265320_10000036 3300031240 Bacteria 136231
114 Ga0265320_10000759 3300031240 Bacteria 24774
115 Ga0265320_10001334 3300031240 Bacteria 17994
116 Ga0265320_10001470 3300031240 Bacteria 17192
117 Ga0265320_10010339 3300031240 Bacteria 5563
118 Ga0265329_10007206 3300031242 Bacteria 4325
119 Ga0265340_10029082 3300031247 Bacteria 2777
120 Ga0265339_10001668 3300031249 Bacteria 16396
121 Ga0265339_10002817 3300031249 Bacteria 12350
122 Ga0265331_10000045 3300031250 Bacteria 184869
123 Ga0265327_10001627 3300031251 Bacteria 27097
124 Ga0265327_10103754 3300031251 Bacteria 1368
125 Ga0265316_10110989 3300031344 Bacteria 2076
126 Ga0265316_10163524 3300031344 Unclassified 1663
127 Ga0307408_100000007 3300031548 Bacteria 463086
128 Ga0265313_10000306 3300031595 Bacteria 53221
129 Ga0265314_10000369 3300031711 Bacteria 61648
130 Ga0265314_10003221 3300031711 Bacteria 15971
131 Ga0265314_10004881 3300031711 Bacteria 12261
132 Ga0265314_10010362 3300031711 Bacteria 7782
133 Ga0265314_10020097 3300031711 Bacteria 5159
134 Ga0265342_10000071 3300031712 Bacteria 107578
135 Ga0265342_10009084 3300031712 Bacteria 7047
136 Ga0265342_10011343 3300031712 Bacteria 6107
137 Ga0307410_10000030 3300031852 Bacteria 50006
138 Ga0307407_10202691 3300031903 Bacteria 1330
139 Ga0307409_100000061 3300031995 Bacteria 39679
140 Ga0307416_100000073 3300032002 Bacteria 80676
141 Ga0373950_0000029 3300034818 Bacteria 165216
142 Ga0373950_0000031 3300034818 Bacteria 162196
143 Ga0373928_0000262 3300035084 Bacteria 10451
144 Ga0373929_0000972 3300035085 Bacteria 5557
145 Ga0373934_0010197 3300035086 Bacteria 3527
146 Ga0373944_0000247 3300035089 Bacteria 11864
147 Ga0373949_0001687 3300035090 Bacteria 6149
148 Ga0373951_0006301 3300035091 Bacteria 2713
149 Ga0373923_0047023 3300035111 Bacteria 1797
150 Ga0373932_0000001 3300035112 Bacteria 1459067
151 Ga0373945_0009637 3300035116 Bacteria 3167
152 Ga0373954_0014894 3300035118 Bacteria 3470
153 Ga0373957_0018441 3300035120 Bacteria 2445
154 Ga0373957_0068330 3300035120 Bacteria 1386
155 Ga0373955_0161405 3300035172 Bacteria 1323
156 Ga0373955_0210548 3300035172 Bacteria 1159
157 Ga0373962_0000036 3300035242 Bacteria 33304
158 Ga0373931_0000002 3300035691 Bacteria 599830
159 Ga0373935_0069596 3300035692 Unclassified 2267
160 Ga0373935_0145755 3300035692 Unclassified 1603
161 Ga0373927_0006000 3300035695 Bacteria 8320
162 Ga0373927_0029765 3300035695 Bacteria 3561
163 Ga0373933_0000576 3300035724 Bacteria 23018
164 Ga0373933_0037633 3300035724 Bacteria 2839
165 Ga0373947_0018894 3300035725 Bacteria 3971
166 Ga0373937_0004406 3300036401 Bacteria 11966
167 Ga0373937_0016680 3300036401 Bacteria 6526
168 Ga0373937_0090583 3300036401 Bacteria 2832
169 Ga0373937_0220417 3300036401 Unclassified 1786
170 Ga0373925_0000121 3300037068 Bacteria 84624
171 Ga0395905_0000016 3300037471 Bacteria 382308
172 Ga0436365_1585269 3300039437 Bacteria 1159
173 Ga0451577_0020277 3300042876 Bacteria 6103
174 Ga0451577_0048245 3300042876 Bacteria 3805
175 Ga0451577_0133492 3300042876 Bacteria 2228
176 Ga0453683_0001903 3300044673 Bacteria 17035
177 Ga0453683_0018888 3300044673 Bacteria 4423
178 Ga0453683_0113590 3300044673 Bacteria 1704
179 Ga0453684_0000019 3300044712 Bacteria 908702
180 Ga0453684_0451333 3300044712 Unclassified 1431
181 Ga0453684_0655744 3300044712 Bacteria 1145
182 Ga0451576_0000379 3300045051 Bacteria 104282
183 Ga0451576_0001598 3300045051 Bacteria 38089
184 Ga0451576_0007449 3300045051 Bacteria 13075
185 Ga0451576_0119010 3300045051 Bacteria 2750
186 Ga0451576_0151213 3300045051 Bacteria 2421
187 Ga0466967_0045603 3300045976 Bacteria 3810
188 Ga0495651_0152652 3300046462 Bacteria 1663
189 Ga0495628_0151552 3300046516 Unclassified 1766
190 Ga0495630_0290856 3300046517 Unclassified 1248
191 Ga0495586_0246395 3300046535 Unclassified 1019
192 Ga0495645_0030974 3300046543 Bacteria 3897
193 Ga0495634_0046544 3300046642 Bacteria 2927
194 Ga0495599_0119112 3300046678 Unclassified 1641
195 Ga0495600_0242313 3300046809 Unclassified 1149
196 Ga0495680_0014400 3300047322 Bacteria 6851
197 Ga0495680_0059477 3300047322 Bacteria 2950
198 Ga0496100_0093517 3300048903 Bacteria 2057
199 Ga0496105_0065882 3300048908 Bacteria 2990
200 Ga0496106_0170853 3300048909 Bacteria 1723
201 Ga0496108_0153083 3300048911 Bacteria 1990
202 Ga0496114_0009174 3300048917 Bacteria 7842
203 Ga0496114_0013747 3300048917 Bacteria 6489
204 Ga0496126_0018925 3300048929 Bacteria 6803
205 Ga0501034_0000019 3300049571 Bacteria 282405
206 Ga0501036_0047229 3300049572 Bacteria 3647
207 Ga0501043_0001239 3300049579 Bacteria 22533
208 Ga0501046_0001737 3300049580 Bacteria 20771
209 Ga0501047_0000007 3300049581 Bacteria 443240
210 Ga0501048_0000943 3300049582 Bacteria 21492
211 Ga0501067_0000087 3300049583 Bacteria 53713
212 Ga0501067_0063057 3300049583 Bacteria 2052
213 Ga0501067_0107119 3300049583 Unclassified 1553
214 Ga0501070_0002364 3300049586 Bacteria 16541
215 Ga0501072_0000026 3300049588 Bacteria 140606
216 Ga0501073_0000273 3300049589 Bacteria 34201
217 Ga0501073_0000740 3300049589 Bacteria 23114
218 Ga0501073_0007657 3300049589 Bacteria 8015
219 Ga0501073_0060426 3300049589 Bacteria 2645
220 Ga0501074_0060376 3300049590 Bacteria 2731
221 Ga0501079_0000166 3300049741 Bacteria 36526
222 Ga0501080_0014407 3300049742 Bacteria 7282
223 Ga0501080_0255217 3300049742 Bacteria 1598
224 Ga0501083_0001192 3300049744 Bacteria 17563
225 Ga0501083_0004622 3300049744 Bacteria 9721
226 Ga0501263_000216 3300049760 Bacteria 3651
227 nmdc:mga00v17_162481_c1 3300050491 Bacteria 1438
228 nmdc:mga08y16_12006_c1 3300050511 Bacteria 9098
229 Ga0495601_0074345 3300053077 Bacteria 2174
230 Ga0500622_0000023 3300053156 Bacteria 251170
231 Ga0500645_044861 3300053730 Unclassified 1300
232 Ga0501084_0000021 3300054114 Bacteria 146118
233 Ga0501084_0182081 3300054114 Bacteria 1774
234 Ga0501082_0002259 3300060353 Bacteria 16870

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031251 Ga0265327_10001627 Ga0265327_100016277 295
2 3300053156 Ga0500622_0000023 Ga0500622_0000023_64810_65802 297
3 3300005327 Ga0070658_10045219 Ga0070658_100452193 298
4 3300025909 Ga0207705_10016999 Ga0207705_100169993 298
5 3300025921 Ga0207652_10068079 Ga0207652_100680792 298
6 3300005458 Ga0070681_10287300 Ga0070681_102873001 299
7 3300006844 Ga0075428_100441594 Ga0075428_1004415942 299
8 3300025912 Ga0207707_10021636 Ga0207707_100216363 299
9 3300027907 Ga0207428_10019461 Ga0207428_100194612 299
10 3300028800 Ga0265338_10035606 Ga0265338_100356063 300
11 3300028800 Ga0265338_10002420 Ga0265338_100024209 303
12 3300031240 Ga0265320_10001470 Ga0265320_100014708 303
13 3300045051 Ga0451576_0151213 Ga0451576_0151213_108_1064 303
14 3300046462 Ga0495651_0152652 Ga0495651_0152652_52_1023 303
15 3300048929 Ga0496126_0018925 Ga0496126_0018925_4511_5539 303
16 3300028800 Ga0265338_10019415 Ga0265338_100194156 304
17 3300009093 Ga0105240_10009408 Ga0105240_100094083 305
18 3300009551 Ga0105238_10002345 Ga0105238_1000234512 305
19 3300025913 Ga0207695_10009874 Ga0207695_100098743 305
20 3300025924 Ga0207694_10108342 Ga0207694_101083422 305
21 3300035118 Ga0373954_0014894 Ga0373954_0014894_1864_2925 305
22 3300036401 Ga0373937_0016680 Ga0373937_0016680_1778_2839 305
23 3300053077 Ga0495601_0074345 Ga0495601_0074345_67_1128 305
24 3300048917 Ga0496114_0009174 Ga0496114_0009174_2033_3097 306
25 3300045051 Ga0451576_0119010 Ga0451576_0119010_971_1930 307
26 3300005331 Ga0070670_100131062 Ga0070670_1001310622 308
27 3300005616 Ga0068852_100100068 Ga0068852_1001000682 308
28 3300026142 Ga0207698_10074450 Ga0207698_100744502 308
29 3300050511 nmdc:mga08y16_12006_c1 nmdc:mga08y16_12006_c1_1462_2538 308
30 3300005543 Ga0070672_100057161 Ga0070672_1000571613 309
31 3300049583 Ga0501067_0107119 Ga0501067_0107119_399_1370 309
32 3300025940 Ga0207691_10056667 Ga0207691_100566673 310
33 3300025960 Ga0207651_10150379 Ga0207651_101503792 310
34 3300047322 Ga0495680_0014400 Ga0495680_0014400_4446_5435 310
35 3300005354 Ga0070675_100152564 Ga0070675_1001525641 311
36 3300042876 Ga0451577_0020277 Ga0451577_0020277_3974_4951 311
37 3300044673 Ga0453683_0113590 Ga0453683_0113590_585_1562 311
38 3300044712 Ga0453684_0655744 Ga0453684_0655744_110_1057 311
39 3300045051 Ga0451576_0001598 Ga0451576_0001598_35742_36719 311
40 3300053730 Ga0500645_044861 Ga0500645_044861_283_1290 311
41 3300035084 Ga0373928_0000262 Ga0373928_0000262_9482_10429 312
42 3300003323 rootH1_10145216 rootH1_101452162 313
43 3300005334 Ga0068869_100000005 Ga0068869_10000000515 313
44 3300005334 Ga0068869_100125483 Ga0068869_1001254832 313
45 3300005338 Ga0068868_100116892 Ga0068868_1001168922 313
46 3300005338 Ga0068868_100464413 Ga0068868_1004644131 313
47 3300005347 Ga0070668_100112412 Ga0070668_1001124121 313
48 3300005366 Ga0070659_100218844 Ga0070659_1002188442 313
49 3300005459 Ga0068867_100000853 Ga0068867_1000008531 313
50 3300005718 Ga0068866_10104441 Ga0068866_101044412 313
51 3300005843 Ga0068860_100000107 Ga0068860_1000001073 313
52 3300006237 Ga0097621_100006890 Ga0097621_1000068905 313
53 3300006358 Ga0068871_100138417 Ga0068871_1001384172 313
54 3300006881 Ga0068865_100005738 Ga0068865_1000057381 313
55 3300025932 Ga0207690_10181699 Ga0207690_101816992 313
56 3300025938 Ga0207704_10003458 Ga0207704_100034582 313
57 3300025942 Ga0207689_10000629 Ga0207689_1000062915 313
58 3300026023 Ga0207677_10101341 Ga0207677_101013412 313
59 3300026089 Ga0207648_10005750 Ga0207648_1000575012 313
60 3300026121 Ga0207683_10156243 Ga0207683_101562432 313
61 3300028381 Ga0268264_10000807 Ga0268264_1000080728 313
62 3300030521 Ga0307511_10006467 Ga0307511_100064671 313
63 3300031247 Ga0265340_10029082 Ga0265340_100290822 313
64 3300031548 Ga0307408_100000007 Ga0307408_100000007324 313
65 3300031852 Ga0307410_10000030 Ga0307410_1000003037 313
66 3300031903 Ga0307407_10202691 Ga0307407_102026911 313
67 3300031995 Ga0307409_100000061 Ga0307409_1000000619 313
68 3300032002 Ga0307416_100000073 Ga0307416_10000007326 313
69 3300034818 Ga0373950_0000031 Ga0373950_0000031_73582_74592 313
70 3300035120 Ga0373957_0018441 Ga0373957_0018441_1263_2369 313
71 3300035692 Ga0373935_0069596 Ga0373935_0069596_1070_2176 313
72 3300035724 Ga0373933_0037633 Ga0373933_0037633_1776_2807 313
73 3300036401 Ga0373937_0004406 Ga0373937_0004406_10250_11356 313
74 3300047322 Ga0495680_0059477 Ga0495680_0059477_1664_2770 313
75 3300048908 Ga0496105_0065882 Ga0496105_0065882_1804_2847 313
76 3300048917 Ga0496114_0013747 Ga0496114_0013747_763_1806 313
77 3300049571 Ga0501034_0000019 Ga0501034_0000019_209512_210522 313
78 3300049572 Ga0501036_0047229 Ga0501036_0047229_190_1146 313
79 3300049579 Ga0501043_0001239 Ga0501043_0001239_2339_3349 313
80 3300049580 Ga0501046_0001737 Ga0501046_0001737_3145_4155 313
81 3300049581 Ga0501047_0000007 Ga0501047_0000007_232463_233473 313
82 3300049582 Ga0501048_0000943 Ga0501048_0000943_9324_10334 313
83 3300049586 Ga0501070_0002364 Ga0501070_0002364_6983_7993 313
84 3300049588 Ga0501072_0000026 Ga0501072_0000026_67033_68043 313
85 3300049590 Ga0501074_0060376 Ga0501074_0060376_1100_2110 313
86 3300049741 Ga0501079_0000166 Ga0501079_0000166_16171_17181 313
87 3300049744 Ga0501083_0001192 Ga0501083_0001192_15776_16786 313
88 3300050491 nmdc:mga00v17_162481_c1 nmdc:mga00v17_162481_c1_23_1084 313
89 3300054114 Ga0501084_0000021 Ga0501084_0000021_35308_36318 313
90 3300060353 Ga0501082_0002259 Ga0501082_0002259_3273_4283 313
91 3300003320 rootH2_10051144 rootH2_100511449 314
92 3300003323 rootH1_10235033 rootH1_102350332 314
93 3300005328 Ga0070676_10115637 Ga0070676_101156372 314
94 3300005331 Ga0070670_100052769 Ga0070670_1000527693 314
95 3300005340 Ga0070689_100150703 Ga0070689_1001507032 314
96 3300005353 Ga0070669_100018960 Ga0070669_1000189602 314
97 3300005354 Ga0070675_100181378 Ga0070675_1001813782 314
98 3300005437 Ga0070710_10015614 Ga0070710_100156144 314
99 3300005544 Ga0070686_100001555 Ga0070686_10000155511 314
100 3300005577 Ga0068857_100185050 Ga0068857_1001850502 314
101 3300005614 Ga0068856_100000673 Ga0068856_1000006738 314
102 3300005719 Ga0068861_100034680 Ga0068861_1000346802 314
103 3300005841 Ga0068863_100482602 Ga0068863_1004826021 314
104 3300006028 Ga0070717_10000408 Ga0070717_1000040825 314
105 3300006881 Ga0068865_100020177 Ga0068865_1000201773 314
106 3300009093 Ga0105240_10000186 Ga0105240_1000018660 314
107 3300009551 Ga0105238_10030479 Ga0105238_100304794 314
108 3300013297 Ga0157378_10029630 Ga0157378_100296305 314
109 3300021384 Ga0213876_10171590 Ga0213876_101715902 314
110 3300025899 Ga0207642_10061307 Ga0207642_100613071 314
111 3300025913 Ga0207695_10000281 Ga0207695_1000028126 314
112 3300025924 Ga0207694_10031434 Ga0207694_100314341 314
113 3300025940 Ga0207691_10050658 Ga0207691_100506583 314
114 3300025981 Ga0207640_10178031 Ga0207640_101780312 314
115 3300026078 Ga0207702_10001250 Ga0207702_1000125012 314
116 3300026088 Ga0207641_10407734 Ga0207641_104077341 314
117 3300026116 Ga0207674_10181582 Ga0207674_101815822 314
118 3300028800 Ga0265338_10003754 Ga0265338_100037546 314
119 3300028800 Ga0265338_10082604 Ga0265338_100826041 314
120 3300031238 Ga0265332_10004781 Ga0265332_100047816 314
121 3300031240 Ga0265320_10001334 Ga0265320_1000133415 314
122 3300031249 Ga0265339_10001668 Ga0265339_1000166810 314
123 3300031249 Ga0265339_10002817 Ga0265339_100028177 314
124 3300031344 Ga0265316_10110989 Ga0265316_101109892 314
125 3300031711 Ga0265314_10003221 Ga0265314_100032214 314
126 3300031711 Ga0265314_10010362 Ga0265314_100103628 314
127 3300031712 Ga0265342_10009084 Ga0265342_100090843 314
128 3300034818 Ga0373950_0000029 Ga0373950_0000029_142633_143634 314
129 3300035085 Ga0373929_0000972 Ga0373929_0000972_1548_2519 314
130 3300035086 Ga0373934_0010197 Ga0373934_0010197_20_1024 314
131 3300035089 Ga0373944_0000247 Ga0373944_0000247_2045_3016 314
132 3300035090 Ga0373949_0001687 Ga0373949_0001687_3237_4208 314
133 3300035091 Ga0373951_0006301 Ga0373951_0006301_1467_2438 314
134 3300035111 Ga0373923_0047023 Ga0373923_0047023_542_1546 314
135 3300035112 Ga0373932_0000001 Ga0373932_0000001_1416820_1417791 314
136 3300035116 Ga0373945_0009637 Ga0373945_0009637_1560_2531 314
137 3300035120 Ga0373957_0068330 Ga0373957_0068330_297_1301 314
138 3300035172 Ga0373955_0161405 Ga0373955_0161405_241_1197 314
139 3300035242 Ga0373962_0000036 Ga0373962_0000036_24642_25613 314
140 3300035691 Ga0373931_0000002 Ga0373931_0000002_77607_78578 314
141 3300035692 Ga0373935_0145755 Ga0373935_0145755_188_1159 314
142 3300035695 Ga0373927_0006000 Ga0373927_0006000_3651_4622 314
143 3300035695 Ga0373927_0029765 Ga0373927_0029765_2513_3484 314
144 3300035724 Ga0373933_0000576 Ga0373933_0000576_1885_2889 314
145 3300035725 Ga0373947_0018894 Ga0373947_0018894_2564_3535 314
146 3300036401 Ga0373937_0090583 Ga0373937_0090583_1680_2684 314
147 3300037068 Ga0373925_0000121 Ga0373925_0000121_11367_12338 314
148 3300037471 Ga0395905_0000016 Ga0395905_0000016_349513_350484 314
149 3300039437 Ga0436365_1585269 Ga0436365_1585269_45_1010 314
150 3300044673 Ga0453683_0001903 Ga0453683_0001903_12982_13962 314
151 3300044673 Ga0453683_0018888 Ga0453683_0018888_789_1769 314
152 3300045051 Ga0451576_0007449 Ga0451576_0007449_8333_9313 314
153 3300045976 Ga0466967_0045603 Ga0466967_0045603_2041_3018 314
154 3300046516 Ga0495628_0151552 Ga0495628_0151552_459_1430 314
155 3300046517 Ga0495630_0290856 Ga0495630_0290856_249_1220 314
156 3300046535 Ga0495586_0246395 Ga0495586_0246395_25_996 314
157 3300046543 Ga0495645_0030974 Ga0495645_0030974_416_1387 314
158 3300046642 Ga0495634_0046544 Ga0495634_0046544_1468_2439 314
159 3300046678 Ga0495599_0119112 Ga0495599_0119112_317_1288 314
160 3300046809 Ga0495600_0242313 Ga0495600_0242313_132_1103 314
161 3300048911 Ga0496108_0153083 Ga0496108_0153083_168_1187 314
162 3300049583 Ga0501067_0000087 Ga0501067_0000087_40384_41385 314
163 3300049589 Ga0501073_0000273 Ga0501073_0000273_20598_21593 314
164 3300049589 Ga0501073_0000740 Ga0501073_0000740_11816_12817 314
165 3300049742 Ga0501080_0255217 Ga0501080_0255217_75_1142 314
166 3300005434 Ga0070709_10194206 Ga0070709_101942061 315
167 3300005539 Ga0068853_100002243 Ga0068853_10000224312 315
168 3300013296 Ga0157374_10287227 Ga0157374_102872273 315
169 3300025906 Ga0207699_10028756 Ga0207699_100287561 315
170 3300025912 Ga0207707_10029159 Ga0207707_100291593 315
171 3300025944 Ga0207661_10094681 Ga0207661_100946813 315
172 3300026041 Ga0207639_10105109 Ga0207639_101051092 315
173 3300042876 Ga0451577_0133492 Ga0451577_0133492_229_1224 315
174 3300044712 Ga0453684_0000019 Ga0453684_0000019_796932_797927 315
175 3300049589 Ga0501073_0007657 Ga0501073_0007657_5385_6464 315
176 3300049589 Ga0501073_0060426 Ga0501073_0060426_166_1134 315
177 3300049742 Ga0501080_0014407 Ga0501080_0014407_488_1567 315
178 3300049744 Ga0501083_0004622 Ga0501083_0004622_2416_3495 315
179 3300005340 Ga0070689_100000001 Ga0070689_10000000137 316
180 3300005614 Ga0068856_100313345 Ga0068856_1003133452 316
181 3300009094 Ga0111539_10202974 Ga0111539_102029741 316
182 3300014325 Ga0163163_10299251 Ga0163163_102992512 316
183 3300025914 Ga0207671_10000245 Ga0207671_1000024536 316
184 3300025936 Ga0207670_10000036 Ga0207670_1000003637 316
185 3300031238 Ga0265332_10000953 Ga0265332_1000095311 316
186 3300031239 Ga0265328_10007557 Ga0265328_100075574 316
187 3300031240 Ga0265320_10000036 Ga0265320_1000003621 316
188 3300031242 Ga0265329_10007206 Ga0265329_100072065 316
189 3300031250 Ga0265331_10000045 Ga0265331_1000004517 316
190 3300031251 Ga0265327_10103754 Ga0265327_101037541 316
191 3300031344 Ga0265316_10163524 Ga0265316_101635241 316
192 3300031595 Ga0265313_10000306 Ga0265313_1000030612 316
193 3300031711 Ga0265314_10000369 Ga0265314_1000036921 316
194 3300031712 Ga0265342_10011343 Ga0265342_100113434 316
195 3300035172 Ga0373955_0210548 Ga0373955_0210548_76_1131 316
196 3300036401 Ga0373937_0220417 Ga0373937_0220417_175_1260 316
197 3300042876 Ga0451577_0048245 Ga0451577_0048245_1511_2515 316
198 3300044712 Ga0453684_0451333 Ga0453684_0451333_203_1195 316
199 3300048903 Ga0496100_0093517 Ga0496100_0093517_779_1810 316
200 3300048909 Ga0496106_0170853 Ga0496106_0170853_531_1562 316
201 3300049583 Ga0501067_0063057 Ga0501067_0063057_850_1863 316
202 3300054114 Ga0501084_0182081 Ga0501084_0182081_427_1500 316
203 3300003320 rootH2_10186741 rootH2_101867412 317
204 3300005327 Ga0070658_10001753 Ga0070658_100017538 317
205 3300013100 Ga0157373_10000100 Ga0157373_1000010055 317
206 3300025920 Ga0207649_10069763 Ga0207649_100697632 317
207 3300028556 Ga0265337_1008664 Ga0265337_10086643 318
208 3300028666 Ga0265336_10003159 Ga0265336_100031597 318
209 3300028800 Ga0265338_10158519 Ga0265338_101585192 318
210 3300031240 Ga0265320_10000759 Ga0265320_1000075912 318
211 3300031240 Ga0265320_10010339 Ga0265320_100103396 318
212 3300031711 Ga0265314_10004881 Ga0265314_100048814 318
213 3300031711 Ga0265314_10020097 Ga0265314_100200973 318
214 3300031712 Ga0265342_10000071 Ga0265342_100000717 318
215 3300045051 Ga0451576_0000379 Ga0451576_0000379_98859_99857 318
216 iso_pu_bacteria 2786546940 2788434854 318
217 3300001977 JGI24746J21847_1003629 JGI24746J21847_10036292 319
218 3300005338 Ga0068868_100172863 Ga0068868_1001728631 319
219 3300005344 Ga0070661_100003294 Ga0070661_1000032948 319
220 3300005436 Ga0070713_100026281 Ga0070713_1000262813 319
221 3300005437 Ga0070710_10009566 Ga0070710_100095664 319
222 3300005459 Ga0068867_100000025 Ga0068867_1000000256 319
223 3300005564 Ga0070664_100008842 Ga0070664_1000088422 319
224 3300009148 Ga0105243_10000065 Ga0105243_1000006553 319
225 3300009176 Ga0105242_10124724 Ga0105242_101247242 319
226 3300013308 Ga0157375_10452416 Ga0157375_104524162 319
227 3300014969 Ga0157376_10112584 Ga0157376_101125841 319
228 3300025906 Ga0207699_10167203 Ga0207699_101672032 319
229 3300025907 Ga0207645_10045527 Ga0207645_100455273 319
230 3300025920 Ga0207649_10013478 Ga0207649_100134788 319
231 3300025928 Ga0207700_10034211 Ga0207700_100342112 319
232 3300025935 Ga0207709_10003761 Ga0207709_100037616 319
233 3300025945 Ga0207679_10002240 Ga0207679_1000224011 319
234 3300026089 Ga0207648_10000702 Ga0207648_1000070240 319
235 3300049760 Ga0501263_000216 Ga0501263_000216_1198_2244 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13379

NMT1_2

NMT1-like family

59

290

0.87

PF09084

NMT1

NMT1/THI5 like

73

281

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.822 14 304
2x26-assembly1.cif.gz_A crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.8134 14 319
3uif-assembly1.cif.gz_A crystal structure of putative sulfonate abc transporter, periplasmic sulfonate-binding protein ssua from methylobacillus flagellatus kt 0.7976 14 311
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.794 14 304
6st1-assembly2.cif.gz_B taurine abc transporter substrate binding protein taua from e. coli in complex with 2-(n-morpholino)ethanesulfonic acid (mes) 0.7858 15 309
ID Description Score Start End Superfamily
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8773 92 186 3.40.190.10
3qslB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8603 97 184 3.40.190.10
3uifA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8585 97 191 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8284 92 186 3.40.190.10
af_Q2G1L7_145_252_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8161 97 185 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7X0H5L5-F1-model_v4 NitT/TauT family transport system substrate-binding protein 0.9467 1 310
AF-A0A6P0X382-F1-model_v4 ABC transporter substrate-binding protein 0.9456 16 312 GO:0016020
GO:0042626
AF-A0A2T3JIL2-F1-model_v4 SsuA/THI5-like domain-containing protein 0.9391 15 312
AF-A0A6P2NFR3-F1-model_v4 ABC transporter substrate-binding protein 0.9348 1 311
AF-A0A2M8LDY4-F1-model_v4 SsuA/THI5-like domain-containing protein 0.9301 16 312

Feature Viewer

pLDDT pTM Quality
94.44 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map