F348258
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 235 | 157 | 470 | 237 |
Family's Representative Sequence
| Representative Sequence | 3300028800|Ga0265338_10040427|Ga0265338_100404276 |
| Length | 280 |
| Sequence | VSSVFWWALDKREQKIGANGRPTHSSRLRPLDNLQNGGRNHSLCPGMTPEFLILGVIWYIVFLFSTTCHEGAHALAAKIGGDTTAFESGQVTLNPLPHIRREPLGMVVVPILSYAFAHWMMGWASAPYDPTWQHRHPRRAAWMALAGPGANFSLVILSGIAIRVGMAAGYFGMPESADYTHITEAVGTGNAGFAATFLSVLFVLNLLLGTFNLLPVPPLDGNTGITLLMSEEKARAFLEWTHRQGLGMLGLFLAWTLYGKIFGYIFRFSLALLYPGSHWG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 34 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 37 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 40 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 42 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 43 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 54 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 82 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 83 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 84 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 85 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 86 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 87 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 88 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 89 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 90 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 91 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 92 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 93 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 94 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 95 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 96 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 97 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 98 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 99 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 100 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 101 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 102 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 103 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 104 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 105 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 106 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 107 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 108 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 109 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 110 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 111 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 112 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 113 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 144 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 145 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 157 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.15 |
| Metatranscriptomes | 0.85 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.43 |
| Nodule | 0 |
| Rhizoplane | 1.7 |
| Rhizosphere | 97.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 25.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265338_10040427 | 3300028800 | Bacteria | 4380 |
| 2 | Ga0070658_10104358 | 3300005327 | Bacteria | 2345 |
| 3 | Ga0070683_100092254 | 3300005329 | Bacteria | 2844 |
| 4 | Ga0070683_100572727 | 3300005329 | Unclassified | 1080 |
| 5 | Ga0070677_10005682 | 3300005333 | Unclassified | 4120 |
| 6 | Ga0070689_100057595 | 3300005340 | Bacteria | 3016 |
| 7 | Ga0070687_100515020 | 3300005343 | Unclassified | 808 |
| 8 | Ga0070692_10188686 | 3300005345 | Bacteria | 1199 |
| 9 | Ga0070669_100116040 | 3300005353 | Bacteria | 2037 |
| 10 | Ga0070669_100121971 | 3300005353 | Bacteria | 1989 |
| 11 | Ga0070675_100005398 | 3300005354 | Bacteria | 9773 |
| 12 | Ga0070675_100009148 | 3300005354 | Bacteria | 7693 |
| 13 | Ga0070673_100207172 | 3300005364 | Bacteria | 1691 |
| 14 | Ga0070688_100039089 | 3300005365 | Bacteria | 2902 |
| 15 | Ga0070709_10000076 | 3300005434 | Bacteria | 74077 |
| 16 | Ga0070713_100045511 | 3300005436 | Bacteria | 3596 |
| 17 | Ga0070710_10078727 | 3300005437 | Bacteria | 1919 |
| 18 | Ga0070700_100405522 | 3300005441 | Bacteria | 1026 |
| 19 | Ga0070708_100155263 | 3300005445 | Unclassified | 2130 |
| 20 | Ga0070708_100644607 | 3300005445 | Unclassified | 998 |
| 21 | Ga0070662_100017610 | 3300005457 | Bacteria | 4821 |
| 22 | Ga0070662_100387730 | 3300005457 | Bacteria | 1151 |
| 23 | Ga0070685_10007009 | 3300005466 | Bacteria | 5753 |
| 24 | Ga0070685_10012039 | 3300005466 | Bacteria | 4536 |
| 25 | Ga0070706_100011282 | 3300005467 | Bacteria | 8300 |
| 26 | Ga0070707_100000327 | 3300005468 | Bacteria | 46790 |
| 27 | Ga0070707_100000776 | 3300005468 | Bacteria | 31562 |
| 28 | Ga0070698_100367870 | 3300005471 | Bacteria | 1370 |
| 29 | Ga0070699_100241424 | 3300005518 | Bacteria | 1613 |
| 30 | Ga0070684_100224810 | 3300005535 | Bacteria | 1713 |
| 31 | Ga0070697_100049703 | 3300005536 | Bacteria | 3403 |
| 32 | Ga0070697_100353136 | 3300005536 | Unclassified | 1270 |
| 33 | Ga0070672_100193608 | 3300005543 | Bacteria | 1698 |
| 34 | Ga0070686_100501338 | 3300005544 | Unclassified | 942 |
| 35 | Ga0070696_100009078 | 3300005546 | Bacteria | 6659 |
| 36 | Ga0070704_100105590 | 3300005549 | Bacteria | 2133 |
| 37 | Ga0070664_100736099 | 3300005564 | Unclassified | 920 |
| 38 | Ga0068859_100000318 | 3300005617 | Bacteria | 48139 |
| 39 | Ga0068859_100020791 | 3300005617 | Bacteria | 6587 |
| 40 | Ga0068859_100897045 | 3300005617 | Unclassified | 971 |
| 41 | Ga0068864_100218620 | 3300005618 | Bacteria | 1757 |
| 42 | Ga0068858_100580427 | 3300005842 | Bacteria | 1086 |
| 43 | Ga0068862_100314101 | 3300005844 | Bacteria | 1445 |
| 44 | Ga0070717_10059076 | 3300006028 | Bacteria | 3172 |
| 45 | Ga0070716_100002907 | 3300006173 | Bacteria | 7979 |
| 46 | Ga0075428_100223462 | 3300006844 | Unclassified | 2033 |
| 47 | Ga0075431_100065563 | 3300006847 | Bacteria | 3750 |
| 48 | Ga0068865_100287454 | 3300006881 | Bacteria | 1311 |
| 49 | Ga0075436_100000105 | 3300006914 | Bacteria | 50007 |
| 50 | Ga0097620_100000318 | 3300006931 | Bacteria | 48139 |
| 51 | Ga0097620_100020791 | 3300006931 | Bacteria | 6587 |
| 52 | Ga0097620_100897101 | 3300006931 | Unclassified | 971 |
| 53 | Ga0099794_10015291 | 3300007265 | Bacteria | 3384 |
| 54 | Ga0099794_10016121 | 3300007265 | Bacteria | 3309 |
| 55 | Ga0099794_10065102 | 3300007265 | Bacteria | 1777 |
| 56 | Ga0099795_10183564 | 3300007788 | Bacteria | 875 |
| 57 | Ga0105240_10014044 | 3300009093 | Bacteria | 10953 |
| 58 | Ga0105240_10038151 | 3300009093 | Bacteria | 6166 |
| 59 | Ga0105240_10146587 | 3300009093 | Bacteria | 2816 |
| 60 | Ga0105245_10187769 | 3300009098 | Unclassified | 1978 |
| 61 | Ga0114129_10421226 | 3300009147 | Bacteria | 1756 |
| 62 | Ga0105242_10593405 | 3300009176 | Unclassified | 1069 |
| 63 | Ga0105237_10265566 | 3300009545 | Bacteria | 1719 |
| 64 | Ga0157374_10013630 | 3300013296 | Bacteria | 7101 |
| 65 | Ga0157378_10000659 | 3300013297 | Bacteria | 32533 |
| 66 | Ga0157378_10753337 | 3300013297 | Bacteria | 997 |
| 67 | Ga0157375_10057522 | 3300013308 | Bacteria | 3844 |
| 68 | Ga0157375_10159943 | 3300013308 | Bacteria | 2394 |
| 69 | Ga0157380_10217716 | 3300014326 | Bacteria | 1706 |
| 70 | Ga0157377_10062693 | 3300014745 | Bacteria | 2127 |
| 71 | Ga0157377_10341074 | 3300014745 | Bacteria | 1002 |
| 72 | Ga0224572_1015902 | 3300024225 | Bacteria | 1443 |
| 73 | Ga0207692_10207565 | 3300025898 | Unclassified | 1155 |
| 74 | Ga0207699_10000182 | 3300025906 | Bacteria | 38240 |
| 75 | Ga0207699_10039838 | 3300025906 | Bacteria | 2703 |
| 76 | Ga0207699_10187064 | 3300025906 | Unclassified | 1395 |
| 77 | Ga0207643_10002470 | 3300025908 | Bacteria | 9979 |
| 78 | Ga0207684_10032863 | 3300025910 | Bacteria | 4412 |
| 79 | Ga0207695_10050220 | 3300025913 | Unclassified | 4389 |
| 80 | Ga0207695_10472465 | 3300025913 | Unclassified | 1136 |
| 81 | Ga0207693_10072047 | 3300025915 | Bacteria | 2705 |
| 82 | Ga0207646_10000005 | 3300025922 | Bacteria | 523896 |
| 83 | Ga0207646_10000549 | 3300025922 | Bacteria | 49403 |
| 84 | Ga0207681_10007762 | 3300025923 | Bacteria | 6570 |
| 85 | Ga0207681_10401034 | 3300025923 | Unclassified | 1108 |
| 86 | Ga0207659_10001908 | 3300025926 | Bacteria | 12367 |
| 87 | Ga0207659_10145289 | 3300025926 | Bacteria | 1846 |
| 88 | Ga0207700_10141574 | 3300025928 | Bacteria | 1977 |
| 89 | Ga0207644_10045895 | 3300025931 | Bacteria | 3110 |
| 90 | Ga0207690_10270149 | 3300025932 | Bacteria | 1321 |
| 91 | Ga0207686_10576849 | 3300025934 | Unclassified | 882 |
| 92 | Ga0207670_10606199 | 3300025936 | Unclassified | 899 |
| 93 | Ga0207669_10337900 | 3300025937 | Unclassified | 1159 |
| 94 | Ga0207665_10034591 | 3300025939 | Bacteria | 3353 |
| 95 | Ga0207691_10033417 | 3300025940 | Bacteria | 4788 |
| 96 | Ga0207661_10031464 | 3300025944 | Bacteria | 4100 |
| 97 | Ga0207661_10432761 | 3300025944 | Unclassified | 1196 |
| 98 | Ga0207651_10046313 | 3300025960 | Unclassified | 2923 |
| 99 | Ga0207651_10062669 | 3300025960 | Bacteria | 2592 |
| 100 | Ga0207651_10393330 | 3300025960 | Bacteria | 1177 |
| 101 | Ga0207658_10022251 | 3300025986 | Bacteria | 4413 |
| 102 | Ga0207677_10961185 | 3300026023 | Unclassified | 773 |
| 103 | Ga0207676_10399968 | 3300026095 | Bacteria | 1283 |
| 104 | Ga0207674_10024232 | 3300026116 | Bacteria | 6487 |
| 105 | Ga0207675_100553857 | 3300026118 | Bacteria | 1149 |
| 106 | Ga0209179_1026706 | 3300027512 | Unclassified | 1160 |
| 107 | Ga0209179_1049863 | 3300027512 | Bacteria | 896 |
| 108 | Ga0209588_1042381 | 3300027671 | Bacteria | 1470 |
| 109 | Ga0268265_10370116 | 3300028380 | Bacteria | 1315 |
| 110 | Ga0265319_1012768 | 3300028563 | Bacteria | 3377 |
| 111 | Ga0265318_10001415 | 3300028577 | Bacteria | 14187 |
| 112 | Ga0265338_10125162 | 3300028800 | Bacteria | 2041 |
| 113 | Ga0265338_10131880 | 3300028800 | Bacteria | 1971 |
| 114 | Ga0265760_10001908 | 3300031090 | Bacteria | 6123 |
| 115 | Ga0265760_10084318 | 3300031090 | Unclassified | 988 |
| 116 | Ga0265332_10014740 | 3300031238 | Bacteria | 3455 |
| 117 | Ga0265328_10096450 | 3300031239 | Bacteria | 1093 |
| 118 | Ga0265325_10011120 | 3300031241 | Bacteria | 5181 |
| 119 | Ga0265325_10024413 | 3300031241 | Bacteria | 3290 |
| 120 | Ga0265325_10072622 | 3300031241 | Bacteria | 1724 |
| 121 | Ga0265325_10145836 | 3300031241 | Bacteria | 1123 |
| 122 | Ga0265329_10000189 | 3300031242 | Bacteria | 31671 |
| 123 | Ga0265339_10033043 | 3300031249 | Bacteria | 2916 |
| 124 | Ga0265331_10000503 | 3300031250 | Bacteria | 36817 |
| 125 | Ga0265331_10007787 | 3300031250 | Bacteria | 6150 |
| 126 | Ga0265316_10001492 | 3300031344 | Bacteria | 25083 |
| 127 | Ga0265316_10023197 | 3300031344 | Bacteria | 5217 |
| 128 | Ga0265316_10170453 | 3300031344 | Unclassified | 1624 |
| 129 | Ga0265316_10300037 | 3300031344 | Bacteria | 1170 |
| 130 | Ga0265316_10414151 | 3300031344 | Unclassified | 969 |
| 131 | Ga0307408_100260409 | 3300031548 | Bacteria | 1435 |
| 132 | Ga0265313_10001371 | 3300031595 | Bacteria | 22911 |
| 133 | Ga0265313_10065225 | 3300031595 | Unclassified | 1691 |
| 134 | Ga0265342_10222609 | 3300031712 | Bacteria | 1016 |
| 135 | Ga0316576_10008501 | 3300031727 | Bacteria | 6553 |
| 136 | Ga0307416_101065929 | 3300032002 | Unclassified | 912 |
| 137 | Ga0373926_0001518 | 3300035083 | Bacteria | 7112 |
| 138 | Ga0373923_0002358 | 3300035111 | Bacteria | 5794 |
| 139 | Ga0373923_0172577 | 3300035111 | Bacteria | 991 |
| 140 | Ga0373954_0105034 | 3300035118 | Bacteria | 1364 |
| 141 | Ga0373961_0000259 | 3300035241 | Bacteria | 24616 |
| 142 | Ga0373924_0059588 | 3300035410 | Unclassified | 1595 |
| 143 | Ga0373935_0015415 | 3300035692 | Unclassified | 4620 |
| 144 | Ga0373927_0011201 | 3300035695 | Bacteria | 5972 |
| 145 | Ga0373947_0005141 | 3300035725 | Bacteria | 7664 |
| 146 | Ga0373937_0003346 | 3300036401 | Bacteria | 13458 |
| 147 | Ga0373937_0120230 | 3300036401 | Bacteria | 2448 |
| 148 | Ga0373937_0176197 | 3300036401 | Bacteria | 2007 |
| 149 | Ga0373937_0529703 | 3300036401 | Unclassified | 1119 |
| 150 | Ga0373937_0654211 | 3300036401 | Bacteria | 996 |
| 151 | Ga0373937_0718209 | 3300036401 | Unclassified | 946 |
| 152 | Ga0316584_0322976 | 3300036712 | Unclassified | 1113 |
| 153 | Ga0451807_1504567 | 3300041486 | Bacteria | 2902 |
| 154 | Ga0451577_0044334 | 3300042876 | Bacteria | 3983 |
| 155 | Ga0453683_0000041 | 3300044673 | Bacteria | 219754 |
| 156 | Ga0453683_0103016 | 3300044673 | Unclassified | 1792 |
| 157 | Ga0453683_0103323 | 3300044673 | Bacteria | 1789 |
| 158 | Ga0453683_0259447 | 3300044673 | Bacteria | 1108 |
| 159 | Ga0453683_0398584 | 3300044673 | Bacteria | 887 |
| 160 | Ga0453684_0007315 | 3300044712 | Bacteria | 20420 |
| 161 | Ga0453684_0148404 | 3300044712 | Bacteria | 2790 |
| 162 | Ga0453684_0211276 | 3300044712 | Unclassified | 2255 |
| 163 | Ga0466959_0120602 | 3300045049 | Bacteria | 1865 |
| 164 | Ga0451576_0149484 | 3300045051 | Unclassified | 2436 |
| 165 | Ga0451576_0639042 | 3300045051 | Unclassified | 1118 |
| 166 | Ga0466958_0322471 | 3300045836 | Bacteria | 993 |
| 167 | Ga0495651_0007498 | 3300046462 | Bacteria | 8343 |
| 168 | Ga0495651_0016898 | 3300046462 | Bacteria | 5651 |
| 169 | Ga0495651_0020206 | 3300046462 | Bacteria | 5168 |
| 170 | Ga0495653_0045478 | 3300046463 | Unclassified | 3403 |
| 171 | Ga0495580_0019791 | 3300046472 | Unclassified | 4995 |
| 172 | Ga0495580_0399432 | 3300046472 | Unclassified | 927 |
| 173 | Ga0495580_0504876 | 3300046472 | Unclassified | 807 |
| 174 | Ga0495664_0012492 | 3300046477 | Unclassified | 4810 |
| 175 | Ga0495608_0006815 | 3300046511 | Bacteria | 8100 |
| 176 | Ga0495608_0062684 | 3300046511 | Unclassified | 2442 |
| 177 | Ga0495628_0140047 | 3300046516 | Bacteria | 1846 |
| 178 | Ga0495630_0008238 | 3300046517 | Bacteria | 7486 |
| 179 | Ga0495630_0034392 | 3300046517 | Bacteria | 3784 |
| 180 | Ga0495630_0065774 | 3300046517 | Unclassified | 2724 |
| 181 | Ga0495652_0082884 | 3300046529 | Unclassified | 2641 |
| 182 | Ga0495665_0005555 | 3300046531 | Bacteria | 6794 |
| 183 | Ga0495665_0278503 | 3300046531 | Unclassified | 858 |
| 184 | Ga0495640_0127836 | 3300046533 | Unclassified | 1647 |
| 185 | Ga0495586_0006073 | 3300046535 | Bacteria | 6457 |
| 186 | Ga0495587_0206731 | 3300046536 | Unclassified | 1109 |
| 187 | Ga0495621_0001258 | 3300046539 | Bacteria | 6542 |
| 188 | Ga0495667_0014183 | 3300046559 | Bacteria | 5380 |
| 189 | Ga0495667_0021896 | 3300046559 | Bacteria | 4309 |
| 190 | Ga0495667_0245533 | 3300046559 | Bacteria | 1140 |
| 191 | Ga0495667_0274750 | 3300046559 | Bacteria | 1070 |
| 192 | Ga0495635_0020180 | 3300046663 | Unclassified | 4644 |
| 193 | Ga0495657_0035752 | 3300046675 | Bacteria | 3440 |
| 194 | Ga0495657_0135976 | 3300046675 | Bacteria | 1535 |
| 195 | Ga0495599_0323201 | 3300046678 | Bacteria | 928 |
| 196 | Ga0495623_0007714 | 3300046679 | Bacteria | 6994 |
| 197 | Ga0495623_0012036 | 3300046679 | Bacteria | 5604 |
| 198 | Ga0495646_0004963 | 3300046680 | Bacteria | 8398 |
| 199 | Ga0495613_0204638 | 3300046689 | Bacteria | 1390 |
| 200 | Ga0495624_0006262 | 3300046690 | Bacteria | 8465 |
| 201 | Ga0495604_0046199 | 3300047317 | Unclassified | 3395 |
| 202 | Ga0495604_0147136 | 3300047317 | Bacteria | 1678 |
| 203 | Ga0495604_0266431 | 3300047317 | Unclassified | 1162 |
| 204 | Ga0495674_0067657 | 3300047319 | Unclassified | 3093 |
| 205 | Ga0495674_0563022 | 3300047319 | Unclassified | 906 |
| 206 | Ga0495680_0000034 | 3300047322 | Bacteria | 107708 |
| 207 | Ga0495675_0011050 | 3300047444 | Bacteria | 5660 |
| 208 | Ga0495675_0027516 | 3300047444 | Bacteria | 3624 |
| 209 | Ga0495675_0118131 | 3300047444 | Bacteria | 1652 |
| 210 | Ga0495684_0000646 | 3300047471 | Bacteria | 28009 |
| 211 | Ga0495684_0003838 | 3300047471 | Bacteria | 11706 |
| 212 | Ga0495684_0031735 | 3300047471 | Unclassified | 4058 |
| 213 | Ga0495593_0034648 | 3300047673 | Unclassified | 2744 |
| 214 | Ga0495602_0035014 | 3300048088 | Bacteria | 4687 |
| 215 | Ga0495602_0073873 | 3300048088 | Unclassified | 2900 |
| 216 | Ga0495614_0004799 | 3300048089 | Bacteria | 6104 |
| 217 | Ga0495615_0007135 | 3300048090 | Bacteria | 2106 |
| 218 | Ga0496101_0756197 | 3300048904 | Bacteria | 767 |
| 219 | Ga0496112_0159907 | 3300048915 | Unclassified | 2219 |
| 220 | Ga0496112_0328258 | 3300048915 | Bacteria | 1474 |
| 221 | Ga0501034_0208350 | 3300049571 | Bacteria | 1911 |
| 222 | Ga0501067_0179706 | 3300049583 | Bacteria | 1178 |
| 223 | Ga0501068_0053416 | 3300049584 | Bacteria | 2446 |
| 224 | Ga0501075_0002843 | 3300049591 | Bacteria | 11613 |
| 225 | Ga0501077_0003615 | 3300049593 | Bacteria | 9303 |
| 226 | Ga0501080_0009776 | 3300049742 | Bacteria | 8761 |
| 227 | Ga0501083_0005177 | 3300049744 | Bacteria | 9225 |
| 228 | nmdc:mga06r32_21961_c1 | 3300050510 | Bacteria | 5893 |
| 229 | nmdc:mga06r32_253410_c1 | 3300050510 | Bacteria | 1748 |
| 230 | nmdc:mga0n895_105429_c1 | 3300050512 | Bacteria | 2831 |
| 231 | nmdc:mga0rr50_66642_c1 | 3300050513 | Bacteria | 2732 |
| 232 | nmdc:mga08x19_353_c1 | 3300050514 | Bacteria | 33200 |
| 233 | Ga0500555_000122 | 3300053103 | Bacteria | 37400 |
| 234 | Ga0501082_0000332 | 3300060353 | Bacteria | 41893 |
| 235 | Ga0501082_0881058 | 3300060353 | Unclassified | 783 |
| 236 | Ga0265338_10040427 | |||
| 237 | Ga0070658_10104358 | |||
| 238 | Ga0070683_100092254 | |||
| 239 | Ga0070683_100572727 | |||
| 240 | Ga0070677_10005682 | |||
| 241 | Ga0070689_100057595 | |||
| 242 | Ga0070687_100515020 | |||
| 243 | Ga0070692_10188686 | |||
| 244 | Ga0070669_100116040 | |||
| 245 | Ga0070669_100121971 | |||
| 246 | Ga0070675_100005398 | |||
| 247 | Ga0070675_100009148 | |||
| 248 | Ga0070673_100207172 | |||
| 249 | Ga0070688_100039089 | |||
| 250 | Ga0070709_10000076 | |||
| 251 | Ga0070713_100045511 | |||
| 252 | Ga0070710_10078727 | |||
| 253 | Ga0070700_100405522 | |||
| 254 | Ga0070708_100155263 | |||
| 255 | Ga0070708_100644607 | |||
| 256 | Ga0070662_100017610 | |||
| 257 | Ga0070662_100387730 | |||
| 258 | Ga0070685_10007009 | |||
| 259 | Ga0070685_10012039 | |||
| 260 | Ga0070706_100011282 | |||
| 261 | Ga0070707_100000327 | |||
| 262 | Ga0070707_100000776 | |||
| 263 | Ga0070698_100367870 | |||
| 264 | Ga0070699_100241424 | |||
| 265 | Ga0070684_100224810 | |||
| 266 | Ga0070697_100049703 | |||
| 267 | Ga0070697_100353136 | |||
| 268 | Ga0070672_100193608 | |||
| 269 | Ga0070686_100501338 | |||
| 270 | Ga0070696_100009078 | |||
| 271 | Ga0070704_100105590 | |||
| 272 | Ga0070664_100736099 | |||
| 273 | Ga0068859_100000318 | |||
| 274 | Ga0068859_100020791 | |||
| 275 | Ga0068859_100897045 | |||
| 276 | Ga0068864_100218620 | |||
| 277 | Ga0068858_100580427 | |||
| 278 | Ga0068862_100314101 | |||
| 279 | Ga0070717_10059076 | |||
| 280 | Ga0070716_100002907 | |||
| 281 | Ga0075428_100223462 | |||
| 282 | Ga0075431_100065563 | |||
| 283 | Ga0068865_100287454 | |||
| 284 | Ga0075436_100000105 | |||
| 285 | Ga0097620_100000318 | |||
| 286 | Ga0097620_100020791 | |||
| 287 | Ga0097620_100897101 | |||
| 288 | Ga0099794_10015291 | |||
| 289 | Ga0099794_10016121 | |||
| 290 | Ga0099794_10065102 | |||
| 291 | Ga0099795_10183564 | |||
| 292 | Ga0105240_10014044 | |||
| 293 | Ga0105240_10038151 | |||
| 294 | Ga0105240_10146587 | |||
| 295 | Ga0105245_10187769 | |||
| 296 | Ga0114129_10421226 | |||
| 297 | Ga0105242_10593405 | |||
| 298 | Ga0105237_10265566 | |||
| 299 | Ga0157374_10013630 | |||
| 300 | Ga0157378_10000659 | |||
| 301 | Ga0157378_10753337 | |||
| 302 | Ga0157375_10057522 | |||
| 303 | Ga0157375_10159943 | |||
| 304 | Ga0157380_10217716 | |||
| 305 | Ga0157377_10062693 | |||
| 306 | Ga0157377_10341074 | |||
| 307 | Ga0224572_1015902 | |||
| 308 | Ga0207692_10207565 | |||
| 309 | Ga0207699_10000182 | |||
| 310 | Ga0207699_10039838 | |||
| 311 | Ga0207699_10187064 | |||
| 312 | Ga0207643_10002470 | |||
| 313 | Ga0207684_10032863 | |||
| 314 | Ga0207695_10050220 | |||
| 315 | Ga0207695_10472465 | |||
| 316 | Ga0207693_10072047 | |||
| 317 | Ga0207646_10000005 | |||
| 318 | Ga0207646_10000549 | |||
| 319 | Ga0207681_10007762 | |||
| 320 | Ga0207681_10401034 | |||
| 321 | Ga0207659_10001908 | |||
| 322 | Ga0207659_10145289 | |||
| 323 | Ga0207700_10141574 | |||
| 324 | Ga0207644_10045895 | |||
| 325 | Ga0207690_10270149 | |||
| 326 | Ga0207686_10576849 | |||
| 327 | Ga0207670_10606199 | |||
| 328 | Ga0207669_10337900 | |||
| 329 | Ga0207665_10034591 | |||
| 330 | Ga0207691_10033417 | |||
| 331 | Ga0207661_10031464 | |||
| 332 | Ga0207661_10432761 | |||
| 333 | Ga0207651_10046313 | |||
| 334 | Ga0207651_10062669 | |||
| 335 | Ga0207651_10393330 | |||
| 336 | Ga0207658_10022251 | |||
| 337 | Ga0207677_10961185 | |||
| 338 | Ga0207676_10399968 | |||
| 339 | Ga0207674_10024232 | |||
| 340 | Ga0207675_100553857 | |||
| 341 | Ga0209179_1026706 | |||
| 342 | Ga0209179_1049863 | |||
| 343 | Ga0209588_1042381 | |||
| 344 | Ga0268265_10370116 | |||
| 345 | Ga0265319_1012768 | |||
| 346 | Ga0265318_10001415 | |||
| 347 | Ga0265338_10125162 | |||
| 348 | Ga0265338_10131880 | |||
| 349 | Ga0265760_10001908 | |||
| 350 | Ga0265760_10084318 | |||
| 351 | Ga0265332_10014740 | |||
| 352 | Ga0265328_10096450 | |||
| 353 | Ga0265325_10011120 | |||
| 354 | Ga0265325_10024413 | |||
| 355 | Ga0265325_10072622 | |||
| 356 | Ga0265325_10145836 | |||
| 357 | Ga0265329_10000189 | |||
| 358 | Ga0265339_10033043 | |||
| 359 | Ga0265331_10000503 | |||
| 360 | Ga0265331_10007787 | |||
| 361 | Ga0265316_10001492 | |||
| 362 | Ga0265316_10023197 | |||
| 363 | Ga0265316_10170453 | |||
| 364 | Ga0265316_10300037 | |||
| 365 | Ga0265316_10414151 | |||
| 366 | Ga0307408_100260409 | |||
| 367 | Ga0265313_10001371 | |||
| 368 | Ga0265313_10065225 | |||
| 369 | Ga0265342_10222609 | |||
| 370 | Ga0316576_10008501 | |||
| 371 | Ga0307416_101065929 | |||
| 372 | Ga0373926_0001518 | |||
| 373 | Ga0373923_0002358 | |||
| 374 | Ga0373923_0172577 | |||
| 375 | Ga0373954_0105034 | |||
| 376 | Ga0373961_0000259 | |||
| 377 | Ga0373924_0059588 | |||
| 378 | Ga0373935_0015415 | |||
| 379 | Ga0373927_0011201 | |||
| 380 | Ga0373947_0005141 | |||
| 381 | Ga0373937_0003346 | |||
| 382 | Ga0373937_0120230 | |||
| 383 | Ga0373937_0176197 | |||
| 384 | Ga0373937_0529703 | |||
| 385 | Ga0373937_0654211 | |||
| 386 | Ga0373937_0718209 | |||
| 387 | Ga0316584_0322976 | |||
| 388 | Ga0451807_1504567 | |||
| 389 | Ga0451577_0044334 | |||
| 390 | Ga0453683_0000041 | |||
| 391 | Ga0453683_0103016 | |||
| 392 | Ga0453683_0103323 | |||
| 393 | Ga0453683_0259447 | |||
| 394 | Ga0453683_0398584 | |||
| 395 | Ga0453684_0007315 | |||
| 396 | Ga0453684_0148404 | |||
| 397 | Ga0453684_0211276 | |||
| 398 | Ga0466959_0120602 | |||
| 399 | Ga0451576_0149484 | |||
| 400 | Ga0451576_0639042 | |||
| 401 | Ga0466958_0322471 | |||
| 402 | Ga0495651_0007498 | |||
| 403 | Ga0495651_0016898 | |||
| 404 | Ga0495651_0020206 | |||
| 405 | Ga0495653_0045478 | |||
| 406 | Ga0495580_0019791 | |||
| 407 | Ga0495580_0399432 | |||
| 408 | Ga0495580_0504876 | |||
| 409 | Ga0495664_0012492 | |||
| 410 | Ga0495608_0006815 | |||
| 411 | Ga0495608_0062684 | |||
| 412 | Ga0495628_0140047 | |||
| 413 | Ga0495630_0008238 | |||
| 414 | Ga0495630_0034392 | |||
| 415 | Ga0495630_0065774 | |||
| 416 | Ga0495652_0082884 | |||
| 417 | Ga0495665_0005555 | |||
| 418 | Ga0495665_0278503 | |||
| 419 | Ga0495640_0127836 | |||
| 420 | Ga0495586_0006073 | |||
| 421 | Ga0495587_0206731 | |||
| 422 | Ga0495621_0001258 | |||
| 423 | Ga0495667_0014183 | |||
| 424 | Ga0495667_0021896 | |||
| 425 | Ga0495667_0245533 | |||
| 426 | Ga0495667_0274750 | |||
| 427 | Ga0495635_0020180 | |||
| 428 | Ga0495657_0035752 | |||
| 429 | Ga0495657_0135976 | |||
| 430 | Ga0495599_0323201 | |||
| 431 | Ga0495623_0007714 | |||
| 432 | Ga0495623_0012036 | |||
| 433 | Ga0495646_0004963 | |||
| 434 | Ga0495613_0204638 | |||
| 435 | Ga0495624_0006262 | |||
| 436 | Ga0495604_0046199 | |||
| 437 | Ga0495604_0147136 | |||
| 438 | Ga0495604_0266431 | |||
| 439 | Ga0495674_0067657 | |||
| 440 | Ga0495674_0563022 | |||
| 441 | Ga0495680_0000034 | |||
| 442 | Ga0495675_0011050 | |||
| 443 | Ga0495675_0027516 | |||
| 444 | Ga0495675_0118131 | |||
| 445 | Ga0495684_0000646 | |||
| 446 | Ga0495684_0003838 | |||
| 447 | Ga0495684_0031735 | |||
| 448 | Ga0495593_0034648 | |||
| 449 | Ga0495602_0035014 | |||
| 450 | Ga0495602_0073873 | |||
| 451 | Ga0495614_0004799 | |||
| 452 | Ga0495615_0007135 | |||
| 453 | Ga0496101_0756197 | |||
| 454 | Ga0496112_0159907 | |||
| 455 | Ga0496112_0328258 | |||
| 456 | Ga0501034_0208350 | |||
| 457 | Ga0501067_0179706 | |||
| 458 | Ga0501068_0053416 | |||
| 459 | Ga0501075_0002843 | |||
| 460 | Ga0501077_0003615 | |||
| 461 | Ga0501080_0009776 | |||
| 462 | Ga0501083_0005177 | |||
| 463 | nmdc:mga06r32_21961_c1 | |||
| 464 | nmdc:mga06r32_253410_c1 | |||
| 465 | nmdc:mga0n895_105429_c1 | |||
| 466 | nmdc:mga0rr50_66642_c1 | |||
| 467 | nmdc:mga08x19_353_c1 | |||
| 468 | Ga0500555_000122 | |||
| 469 | Ga0501082_0000332 | |||
| 470 | Ga0501082_0881058 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8sqr-assembly1.cif.gz_A | crystal structure of bacterioferritin (bfr) from brucella abortus (iron bound, f16l mutant) | 0.4337 | 4 | 189 |
| 5zji-assembly1.cif.gz_L | structure of photosystem i supercomplex with light-harvesting complexes i and ii | 0.431 | 95 | 156 |
| 3uno-assembly1.cif.gz_D | mycobacterium tuberculosis ferritin homolog, bfrb | 0.43 | 6 | 193 |
| 3qd8-assembly1.cif.gz_B | crystal structure of mycobacterium tuberculosis bfrb | 0.4297 | 6 | 193 |
| 8sqp-assembly1.cif.gz_A | crystal structure of bacterioferritin (bfr) from brucella abortus (apo, f16l mutant) | 0.4275 | 4 | 189 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q7G2G3_1_94_1.20.58.80 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit | 0.5393 | 81 | 176 | 1.20.58.80 |
| af_A0A2R8QS32_13_259_1.20.1440.80 | Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);Gap junction channel protein cysteine-rich domain | 0.4885 | 91 | 176 | 1.20.1440.80 |
| af_Q9XV13_19_284_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.487 | 82 | 227 | 1.20.1070.10 |
| af_F1R9K7_67_295_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.4729 | 82 | 225 | 1.20.1270.60 |
| af_Q94K88_191_391_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.4364 | 82 | 196 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3A4WDH1-F1-model_v4 | Site-2 protease family protein | 0.9776 | 9 | 232 |
GO:0005886
GO:0006508 GO:0008237 GO:0046872 |
| AF-A0A081CAS7-F1-model_v4 | M50 family peptidase | 0.9716 | 1 | 232 |
GO:0005886
GO:0006508 GO:0008237 GO:0046872 |
| AF-A0A523KAT1-F1-model_v4 | Site-2 protease family protein | 0.964 | 3 | 227 |
GO:0005886
GO:0006508 GO:0008237 GO:0046872 |
| AF-A0A2V9H4D6-F1-model_v4 | Site-2 protease family protein | 0.9619 | 1 | 101 |
GO:0005886
GO:0006508 GO:0008237 GO:0046872 |
| AF-A0A7C2YS75-F1-model_v4 | Site-2 protease family protein | 0.9606 | 1 | 232 |
GO:0005886
GO:0006508 GO:0008237 GO:0046872 |