F348258

General Info

Members Datasets Scaffolds Average Seq Length
235 157 470 237

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10040427|Ga0265338_100404276
Length 280
Sequence VSSVFWWALDKREQKIGANGRPTHSSRLRPLDNLQNGGRNHSLCPGMTPEFLILGVIWYIVFLFSTTCHEGAHALAAKIGGDTTAFESGQVTLNPLPHIRREPLGMVVVPILSYAFAHWMMGWASAPYDPTWQHRHPRRAAWMALAGPGANFSLVILSGIAIRVGMAAGYFGMPESADYTHITEAVGTGNAGFAATFLSVLFVLNLLLGTFNLLPVPPLDGNTGITLLMSEEKARAFLEWTHRQGLGMLGLFLAWTLYGKIFGYIFRFSLALLYPGSHWG

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
82 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
83 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
85 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
88 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
89 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
97 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
99 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
100 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
131 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
142 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
147 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0.85
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 1.7
Rhizosphere 97.87
Stem 0
Stem Tuber 0
Unclassified 25.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10040427 3300028800 Bacteria 4380
2 Ga0070658_10104358 3300005327 Bacteria 2345
3 Ga0070683_100092254 3300005329 Bacteria 2844
4 Ga0070683_100572727 3300005329 Unclassified 1080
5 Ga0070677_10005682 3300005333 Unclassified 4120
6 Ga0070689_100057595 3300005340 Bacteria 3016
7 Ga0070687_100515020 3300005343 Unclassified 808
8 Ga0070692_10188686 3300005345 Bacteria 1199
9 Ga0070669_100116040 3300005353 Bacteria 2037
10 Ga0070669_100121971 3300005353 Bacteria 1989
11 Ga0070675_100005398 3300005354 Bacteria 9773
12 Ga0070675_100009148 3300005354 Bacteria 7693
13 Ga0070673_100207172 3300005364 Bacteria 1691
14 Ga0070688_100039089 3300005365 Bacteria 2902
15 Ga0070709_10000076 3300005434 Bacteria 74077
16 Ga0070713_100045511 3300005436 Bacteria 3596
17 Ga0070710_10078727 3300005437 Bacteria 1919
18 Ga0070700_100405522 3300005441 Bacteria 1026
19 Ga0070708_100155263 3300005445 Unclassified 2130
20 Ga0070708_100644607 3300005445 Unclassified 998
21 Ga0070662_100017610 3300005457 Bacteria 4821
22 Ga0070662_100387730 3300005457 Bacteria 1151
23 Ga0070685_10007009 3300005466 Bacteria 5753
24 Ga0070685_10012039 3300005466 Bacteria 4536
25 Ga0070706_100011282 3300005467 Bacteria 8300
26 Ga0070707_100000327 3300005468 Bacteria 46790
27 Ga0070707_100000776 3300005468 Bacteria 31562
28 Ga0070698_100367870 3300005471 Bacteria 1370
29 Ga0070699_100241424 3300005518 Bacteria 1613
30 Ga0070684_100224810 3300005535 Bacteria 1713
31 Ga0070697_100049703 3300005536 Bacteria 3403
32 Ga0070697_100353136 3300005536 Unclassified 1270
33 Ga0070672_100193608 3300005543 Bacteria 1698
34 Ga0070686_100501338 3300005544 Unclassified 942
35 Ga0070696_100009078 3300005546 Bacteria 6659
36 Ga0070704_100105590 3300005549 Bacteria 2133
37 Ga0070664_100736099 3300005564 Unclassified 920
38 Ga0068859_100000318 3300005617 Bacteria 48139
39 Ga0068859_100020791 3300005617 Bacteria 6587
40 Ga0068859_100897045 3300005617 Unclassified 971
41 Ga0068864_100218620 3300005618 Bacteria 1757
42 Ga0068858_100580427 3300005842 Bacteria 1086
43 Ga0068862_100314101 3300005844 Bacteria 1445
44 Ga0070717_10059076 3300006028 Bacteria 3172
45 Ga0070716_100002907 3300006173 Bacteria 7979
46 Ga0075428_100223462 3300006844 Unclassified 2033
47 Ga0075431_100065563 3300006847 Bacteria 3750
48 Ga0068865_100287454 3300006881 Bacteria 1311
49 Ga0075436_100000105 3300006914 Bacteria 50007
50 Ga0097620_100000318 3300006931 Bacteria 48139
51 Ga0097620_100020791 3300006931 Bacteria 6587
52 Ga0097620_100897101 3300006931 Unclassified 971
53 Ga0099794_10015291 3300007265 Bacteria 3384
54 Ga0099794_10016121 3300007265 Bacteria 3309
55 Ga0099794_10065102 3300007265 Bacteria 1777
56 Ga0099795_10183564 3300007788 Bacteria 875
57 Ga0105240_10014044 3300009093 Bacteria 10953
58 Ga0105240_10038151 3300009093 Bacteria 6166
59 Ga0105240_10146587 3300009093 Bacteria 2816
60 Ga0105245_10187769 3300009098 Unclassified 1978
61 Ga0114129_10421226 3300009147 Bacteria 1756
62 Ga0105242_10593405 3300009176 Unclassified 1069
63 Ga0105237_10265566 3300009545 Bacteria 1719
64 Ga0157374_10013630 3300013296 Bacteria 7101
65 Ga0157378_10000659 3300013297 Bacteria 32533
66 Ga0157378_10753337 3300013297 Bacteria 997
67 Ga0157375_10057522 3300013308 Bacteria 3844
68 Ga0157375_10159943 3300013308 Bacteria 2394
69 Ga0157380_10217716 3300014326 Bacteria 1706
70 Ga0157377_10062693 3300014745 Bacteria 2127
71 Ga0157377_10341074 3300014745 Bacteria 1002
72 Ga0224572_1015902 3300024225 Bacteria 1443
73 Ga0207692_10207565 3300025898 Unclassified 1155
74 Ga0207699_10000182 3300025906 Bacteria 38240
75 Ga0207699_10039838 3300025906 Bacteria 2703
76 Ga0207699_10187064 3300025906 Unclassified 1395
77 Ga0207643_10002470 3300025908 Bacteria 9979
78 Ga0207684_10032863 3300025910 Bacteria 4412
79 Ga0207695_10050220 3300025913 Unclassified 4389
80 Ga0207695_10472465 3300025913 Unclassified 1136
81 Ga0207693_10072047 3300025915 Bacteria 2705
82 Ga0207646_10000005 3300025922 Bacteria 523896
83 Ga0207646_10000549 3300025922 Bacteria 49403
84 Ga0207681_10007762 3300025923 Bacteria 6570
85 Ga0207681_10401034 3300025923 Unclassified 1108
86 Ga0207659_10001908 3300025926 Bacteria 12367
87 Ga0207659_10145289 3300025926 Bacteria 1846
88 Ga0207700_10141574 3300025928 Bacteria 1977
89 Ga0207644_10045895 3300025931 Bacteria 3110
90 Ga0207690_10270149 3300025932 Bacteria 1321
91 Ga0207686_10576849 3300025934 Unclassified 882
92 Ga0207670_10606199 3300025936 Unclassified 899
93 Ga0207669_10337900 3300025937 Unclassified 1159
94 Ga0207665_10034591 3300025939 Bacteria 3353
95 Ga0207691_10033417 3300025940 Bacteria 4788
96 Ga0207661_10031464 3300025944 Bacteria 4100
97 Ga0207661_10432761 3300025944 Unclassified 1196
98 Ga0207651_10046313 3300025960 Unclassified 2923
99 Ga0207651_10062669 3300025960 Bacteria 2592
100 Ga0207651_10393330 3300025960 Bacteria 1177
101 Ga0207658_10022251 3300025986 Bacteria 4413
102 Ga0207677_10961185 3300026023 Unclassified 773
103 Ga0207676_10399968 3300026095 Bacteria 1283
104 Ga0207674_10024232 3300026116 Bacteria 6487
105 Ga0207675_100553857 3300026118 Bacteria 1149
106 Ga0209179_1026706 3300027512 Unclassified 1160
107 Ga0209179_1049863 3300027512 Bacteria 896
108 Ga0209588_1042381 3300027671 Bacteria 1470
109 Ga0268265_10370116 3300028380 Bacteria 1315
110 Ga0265319_1012768 3300028563 Bacteria 3377
111 Ga0265318_10001415 3300028577 Bacteria 14187
112 Ga0265338_10125162 3300028800 Bacteria 2041
113 Ga0265338_10131880 3300028800 Bacteria 1971
114 Ga0265760_10001908 3300031090 Bacteria 6123
115 Ga0265760_10084318 3300031090 Unclassified 988
116 Ga0265332_10014740 3300031238 Bacteria 3455
117 Ga0265328_10096450 3300031239 Bacteria 1093
118 Ga0265325_10011120 3300031241 Bacteria 5181
119 Ga0265325_10024413 3300031241 Bacteria 3290
120 Ga0265325_10072622 3300031241 Bacteria 1724
121 Ga0265325_10145836 3300031241 Bacteria 1123
122 Ga0265329_10000189 3300031242 Bacteria 31671
123 Ga0265339_10033043 3300031249 Bacteria 2916
124 Ga0265331_10000503 3300031250 Bacteria 36817
125 Ga0265331_10007787 3300031250 Bacteria 6150
126 Ga0265316_10001492 3300031344 Bacteria 25083
127 Ga0265316_10023197 3300031344 Bacteria 5217
128 Ga0265316_10170453 3300031344 Unclassified 1624
129 Ga0265316_10300037 3300031344 Bacteria 1170
130 Ga0265316_10414151 3300031344 Unclassified 969
131 Ga0307408_100260409 3300031548 Bacteria 1435
132 Ga0265313_10001371 3300031595 Bacteria 22911
133 Ga0265313_10065225 3300031595 Unclassified 1691
134 Ga0265342_10222609 3300031712 Bacteria 1016
135 Ga0316576_10008501 3300031727 Bacteria 6553
136 Ga0307416_101065929 3300032002 Unclassified 912
137 Ga0373926_0001518 3300035083 Bacteria 7112
138 Ga0373923_0002358 3300035111 Bacteria 5794
139 Ga0373923_0172577 3300035111 Bacteria 991
140 Ga0373954_0105034 3300035118 Bacteria 1364
141 Ga0373961_0000259 3300035241 Bacteria 24616
142 Ga0373924_0059588 3300035410 Unclassified 1595
143 Ga0373935_0015415 3300035692 Unclassified 4620
144 Ga0373927_0011201 3300035695 Bacteria 5972
145 Ga0373947_0005141 3300035725 Bacteria 7664
146 Ga0373937_0003346 3300036401 Bacteria 13458
147 Ga0373937_0120230 3300036401 Bacteria 2448
148 Ga0373937_0176197 3300036401 Bacteria 2007
149 Ga0373937_0529703 3300036401 Unclassified 1119
150 Ga0373937_0654211 3300036401 Bacteria 996
151 Ga0373937_0718209 3300036401 Unclassified 946
152 Ga0316584_0322976 3300036712 Unclassified 1113
153 Ga0451807_1504567 3300041486 Bacteria 2902
154 Ga0451577_0044334 3300042876 Bacteria 3983
155 Ga0453683_0000041 3300044673 Bacteria 219754
156 Ga0453683_0103016 3300044673 Unclassified 1792
157 Ga0453683_0103323 3300044673 Bacteria 1789
158 Ga0453683_0259447 3300044673 Bacteria 1108
159 Ga0453683_0398584 3300044673 Bacteria 887
160 Ga0453684_0007315 3300044712 Bacteria 20420
161 Ga0453684_0148404 3300044712 Bacteria 2790
162 Ga0453684_0211276 3300044712 Unclassified 2255
163 Ga0466959_0120602 3300045049 Bacteria 1865
164 Ga0451576_0149484 3300045051 Unclassified 2436
165 Ga0451576_0639042 3300045051 Unclassified 1118
166 Ga0466958_0322471 3300045836 Bacteria 993
167 Ga0495651_0007498 3300046462 Bacteria 8343
168 Ga0495651_0016898 3300046462 Bacteria 5651
169 Ga0495651_0020206 3300046462 Bacteria 5168
170 Ga0495653_0045478 3300046463 Unclassified 3403
171 Ga0495580_0019791 3300046472 Unclassified 4995
172 Ga0495580_0399432 3300046472 Unclassified 927
173 Ga0495580_0504876 3300046472 Unclassified 807
174 Ga0495664_0012492 3300046477 Unclassified 4810
175 Ga0495608_0006815 3300046511 Bacteria 8100
176 Ga0495608_0062684 3300046511 Unclassified 2442
177 Ga0495628_0140047 3300046516 Bacteria 1846
178 Ga0495630_0008238 3300046517 Bacteria 7486
179 Ga0495630_0034392 3300046517 Bacteria 3784
180 Ga0495630_0065774 3300046517 Unclassified 2724
181 Ga0495652_0082884 3300046529 Unclassified 2641
182 Ga0495665_0005555 3300046531 Bacteria 6794
183 Ga0495665_0278503 3300046531 Unclassified 858
184 Ga0495640_0127836 3300046533 Unclassified 1647
185 Ga0495586_0006073 3300046535 Bacteria 6457
186 Ga0495587_0206731 3300046536 Unclassified 1109
187 Ga0495621_0001258 3300046539 Bacteria 6542
188 Ga0495667_0014183 3300046559 Bacteria 5380
189 Ga0495667_0021896 3300046559 Bacteria 4309
190 Ga0495667_0245533 3300046559 Bacteria 1140
191 Ga0495667_0274750 3300046559 Bacteria 1070
192 Ga0495635_0020180 3300046663 Unclassified 4644
193 Ga0495657_0035752 3300046675 Bacteria 3440
194 Ga0495657_0135976 3300046675 Bacteria 1535
195 Ga0495599_0323201 3300046678 Bacteria 928
196 Ga0495623_0007714 3300046679 Bacteria 6994
197 Ga0495623_0012036 3300046679 Bacteria 5604
198 Ga0495646_0004963 3300046680 Bacteria 8398
199 Ga0495613_0204638 3300046689 Bacteria 1390
200 Ga0495624_0006262 3300046690 Bacteria 8465
201 Ga0495604_0046199 3300047317 Unclassified 3395
202 Ga0495604_0147136 3300047317 Bacteria 1678
203 Ga0495604_0266431 3300047317 Unclassified 1162
204 Ga0495674_0067657 3300047319 Unclassified 3093
205 Ga0495674_0563022 3300047319 Unclassified 906
206 Ga0495680_0000034 3300047322 Bacteria 107708
207 Ga0495675_0011050 3300047444 Bacteria 5660
208 Ga0495675_0027516 3300047444 Bacteria 3624
209 Ga0495675_0118131 3300047444 Bacteria 1652
210 Ga0495684_0000646 3300047471 Bacteria 28009
211 Ga0495684_0003838 3300047471 Bacteria 11706
212 Ga0495684_0031735 3300047471 Unclassified 4058
213 Ga0495593_0034648 3300047673 Unclassified 2744
214 Ga0495602_0035014 3300048088 Bacteria 4687
215 Ga0495602_0073873 3300048088 Unclassified 2900
216 Ga0495614_0004799 3300048089 Bacteria 6104
217 Ga0495615_0007135 3300048090 Bacteria 2106
218 Ga0496101_0756197 3300048904 Bacteria 767
219 Ga0496112_0159907 3300048915 Unclassified 2219
220 Ga0496112_0328258 3300048915 Bacteria 1474
221 Ga0501034_0208350 3300049571 Bacteria 1911
222 Ga0501067_0179706 3300049583 Bacteria 1178
223 Ga0501068_0053416 3300049584 Bacteria 2446
224 Ga0501075_0002843 3300049591 Bacteria 11613
225 Ga0501077_0003615 3300049593 Bacteria 9303
226 Ga0501080_0009776 3300049742 Bacteria 8761
227 Ga0501083_0005177 3300049744 Bacteria 9225
228 nmdc:mga06r32_21961_c1 3300050510 Bacteria 5893
229 nmdc:mga06r32_253410_c1 3300050510 Bacteria 1748
230 nmdc:mga0n895_105429_c1 3300050512 Bacteria 2831
231 nmdc:mga0rr50_66642_c1 3300050513 Bacteria 2732
232 nmdc:mga08x19_353_c1 3300050514 Bacteria 33200
233 Ga0500555_000122 3300053103 Bacteria 37400
234 Ga0501082_0000332 3300060353 Bacteria 41893
235 Ga0501082_0881058 3300060353 Unclassified 783
236 Ga0265338_10040427
237 Ga0070658_10104358
238 Ga0070683_100092254
239 Ga0070683_100572727
240 Ga0070677_10005682
241 Ga0070689_100057595
242 Ga0070687_100515020
243 Ga0070692_10188686
244 Ga0070669_100116040
245 Ga0070669_100121971
246 Ga0070675_100005398
247 Ga0070675_100009148
248 Ga0070673_100207172
249 Ga0070688_100039089
250 Ga0070709_10000076
251 Ga0070713_100045511
252 Ga0070710_10078727
253 Ga0070700_100405522
254 Ga0070708_100155263
255 Ga0070708_100644607
256 Ga0070662_100017610
257 Ga0070662_100387730
258 Ga0070685_10007009
259 Ga0070685_10012039
260 Ga0070706_100011282
261 Ga0070707_100000327
262 Ga0070707_100000776
263 Ga0070698_100367870
264 Ga0070699_100241424
265 Ga0070684_100224810
266 Ga0070697_100049703
267 Ga0070697_100353136
268 Ga0070672_100193608
269 Ga0070686_100501338
270 Ga0070696_100009078
271 Ga0070704_100105590
272 Ga0070664_100736099
273 Ga0068859_100000318
274 Ga0068859_100020791
275 Ga0068859_100897045
276 Ga0068864_100218620
277 Ga0068858_100580427
278 Ga0068862_100314101
279 Ga0070717_10059076
280 Ga0070716_100002907
281 Ga0075428_100223462
282 Ga0075431_100065563
283 Ga0068865_100287454
284 Ga0075436_100000105
285 Ga0097620_100000318
286 Ga0097620_100020791
287 Ga0097620_100897101
288 Ga0099794_10015291
289 Ga0099794_10016121
290 Ga0099794_10065102
291 Ga0099795_10183564
292 Ga0105240_10014044
293 Ga0105240_10038151
294 Ga0105240_10146587
295 Ga0105245_10187769
296 Ga0114129_10421226
297 Ga0105242_10593405
298 Ga0105237_10265566
299 Ga0157374_10013630
300 Ga0157378_10000659
301 Ga0157378_10753337
302 Ga0157375_10057522
303 Ga0157375_10159943
304 Ga0157380_10217716
305 Ga0157377_10062693
306 Ga0157377_10341074
307 Ga0224572_1015902
308 Ga0207692_10207565
309 Ga0207699_10000182
310 Ga0207699_10039838
311 Ga0207699_10187064
312 Ga0207643_10002470
313 Ga0207684_10032863
314 Ga0207695_10050220
315 Ga0207695_10472465
316 Ga0207693_10072047
317 Ga0207646_10000005
318 Ga0207646_10000549
319 Ga0207681_10007762
320 Ga0207681_10401034
321 Ga0207659_10001908
322 Ga0207659_10145289
323 Ga0207700_10141574
324 Ga0207644_10045895
325 Ga0207690_10270149
326 Ga0207686_10576849
327 Ga0207670_10606199
328 Ga0207669_10337900
329 Ga0207665_10034591
330 Ga0207691_10033417
331 Ga0207661_10031464
332 Ga0207661_10432761
333 Ga0207651_10046313
334 Ga0207651_10062669
335 Ga0207651_10393330
336 Ga0207658_10022251
337 Ga0207677_10961185
338 Ga0207676_10399968
339 Ga0207674_10024232
340 Ga0207675_100553857
341 Ga0209179_1026706
342 Ga0209179_1049863
343 Ga0209588_1042381
344 Ga0268265_10370116
345 Ga0265319_1012768
346 Ga0265318_10001415
347 Ga0265338_10125162
348 Ga0265338_10131880
349 Ga0265760_10001908
350 Ga0265760_10084318
351 Ga0265332_10014740
352 Ga0265328_10096450
353 Ga0265325_10011120
354 Ga0265325_10024413
355 Ga0265325_10072622
356 Ga0265325_10145836
357 Ga0265329_10000189
358 Ga0265339_10033043
359 Ga0265331_10000503
360 Ga0265331_10007787
361 Ga0265316_10001492
362 Ga0265316_10023197
363 Ga0265316_10170453
364 Ga0265316_10300037
365 Ga0265316_10414151
366 Ga0307408_100260409
367 Ga0265313_10001371
368 Ga0265313_10065225
369 Ga0265342_10222609
370 Ga0316576_10008501
371 Ga0307416_101065929
372 Ga0373926_0001518
373 Ga0373923_0002358
374 Ga0373923_0172577
375 Ga0373954_0105034
376 Ga0373961_0000259
377 Ga0373924_0059588
378 Ga0373935_0015415
379 Ga0373927_0011201
380 Ga0373947_0005141
381 Ga0373937_0003346
382 Ga0373937_0120230
383 Ga0373937_0176197
384 Ga0373937_0529703
385 Ga0373937_0654211
386 Ga0373937_0718209
387 Ga0316584_0322976
388 Ga0451807_1504567
389 Ga0451577_0044334
390 Ga0453683_0000041
391 Ga0453683_0103016
392 Ga0453683_0103323
393 Ga0453683_0259447
394 Ga0453683_0398584
395 Ga0453684_0007315
396 Ga0453684_0148404
397 Ga0453684_0211276
398 Ga0466959_0120602
399 Ga0451576_0149484
400 Ga0451576_0639042
401 Ga0466958_0322471
402 Ga0495651_0007498
403 Ga0495651_0016898
404 Ga0495651_0020206
405 Ga0495653_0045478
406 Ga0495580_0019791
407 Ga0495580_0399432
408 Ga0495580_0504876
409 Ga0495664_0012492
410 Ga0495608_0006815
411 Ga0495608_0062684
412 Ga0495628_0140047
413 Ga0495630_0008238
414 Ga0495630_0034392
415 Ga0495630_0065774
416 Ga0495652_0082884
417 Ga0495665_0005555
418 Ga0495665_0278503
419 Ga0495640_0127836
420 Ga0495586_0006073
421 Ga0495587_0206731
422 Ga0495621_0001258
423 Ga0495667_0014183
424 Ga0495667_0021896
425 Ga0495667_0245533
426 Ga0495667_0274750
427 Ga0495635_0020180
428 Ga0495657_0035752
429 Ga0495657_0135976
430 Ga0495599_0323201
431 Ga0495623_0007714
432 Ga0495623_0012036
433 Ga0495646_0004963
434 Ga0495613_0204638
435 Ga0495624_0006262
436 Ga0495604_0046199
437 Ga0495604_0147136
438 Ga0495604_0266431
439 Ga0495674_0067657
440 Ga0495674_0563022
441 Ga0495680_0000034
442 Ga0495675_0011050
443 Ga0495675_0027516
444 Ga0495675_0118131
445 Ga0495684_0000646
446 Ga0495684_0003838
447 Ga0495684_0031735
448 Ga0495593_0034648
449 Ga0495602_0035014
450 Ga0495602_0073873
451 Ga0495614_0004799
452 Ga0495615_0007135
453 Ga0496101_0756197
454 Ga0496112_0159907
455 Ga0496112_0328258
456 Ga0501034_0208350
457 Ga0501067_0179706
458 Ga0501068_0053416
459 Ga0501075_0002843
460 Ga0501077_0003615
461 Ga0501080_0009776
462 Ga0501083_0005177
463 nmdc:mga06r32_21961_c1
464 nmdc:mga06r32_253410_c1
465 nmdc:mga0n895_105429_c1
466 nmdc:mga0rr50_66642_c1
467 nmdc:mga08x19_353_c1
468 Ga0500555_000122
469 Ga0501082_0000332
470 Ga0501082_0881058

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02163

Peptidase_M50

Peptidase family M50

57

257

0.61

Structural Annotation

Top 5 Hits

ID Description Score Start End
8sqr-assembly1.cif.gz_A crystal structure of bacterioferritin (bfr) from brucella abortus (iron bound, f16l mutant) 0.4337 4 189
5zji-assembly1.cif.gz_L structure of photosystem i supercomplex with light-harvesting complexes i and ii 0.431 95 156
3uno-assembly1.cif.gz_D mycobacterium tuberculosis ferritin homolog, bfrb 0.43 6 193
3qd8-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis bfrb 0.4297 6 193
8sqp-assembly1.cif.gz_A crystal structure of bacterioferritin (bfr) from brucella abortus (apo, f16l mutant) 0.4275 4 189
ID Description Score Start End Superfamily
af_Q7G2G3_1_94_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.5393 81 176 1.20.58.80
af_A0A2R8QS32_13_259_1.20.1440.80 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);Gap junction channel protein cysteine-rich domain 0.4885 91 176 1.20.1440.80
af_Q9XV13_19_284_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.487 82 227 1.20.1070.10
af_F1R9K7_67_295_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.4729 82 225 1.20.1270.60
af_Q94K88_191_391_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4364 82 196 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A3A4WDH1-F1-model_v4 Site-2 protease family protein 0.9776 9 232 GO:0005886
GO:0006508
GO:0008237
GO:0046872
AF-A0A081CAS7-F1-model_v4 M50 family peptidase 0.9716 1 232 GO:0005886
GO:0006508
GO:0008237
GO:0046872
AF-A0A523KAT1-F1-model_v4 Site-2 protease family protein 0.964 3 227 GO:0005886
GO:0006508
GO:0008237
GO:0046872
AF-A0A2V9H4D6-F1-model_v4 Site-2 protease family protein 0.9619 1 101 GO:0005886
GO:0006508
GO:0008237
GO:0046872
AF-A0A7C2YS75-F1-model_v4 Site-2 protease family protein 0.9606 1 232 GO:0005886
GO:0006508
GO:0008237
GO:0046872

Map