F348160

General Info

Members Datasets Scaffolds Average Seq Length
235 164 471 117

Family's Representative Sequence

Representative Sequence 3300014745|Ga0157377_10036967|Ga0157377_100369674
Length 107
Sequence MAFRFEDLKVWHKAVDLSNEIDILSRQFPKTELFSLSSQIKKAADSVVLNIALRSAVKVVACLFLAKKRDYINEQLFKKMYDEHELLCKMITKLRDSMTQKSMNNEQ

Samples

Sample ID Description Type Environment
1 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
130 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
131 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
132 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
133 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
134 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
135 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
136 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
137 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
138 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
139 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
144 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
145 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
146 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
147 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
148 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
154 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
155 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
156 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
157 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
158 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
159 2738541302 Pedobacter sp. CF074 Isolate Unclassified
160 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
161 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
162 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
163 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
164 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.6
Metatranscriptomes 0
Isolates 3.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.26
Nodule 0
Rhizoplane 0.43
Rhizosphere 91.49
Stem 0
Stem Tuber 0
Unclassified 2.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157377_10036967 3300014745 Bacteria 2689
2 JGI24740J21852_10007179 3300001979 Bacteria 4545
3 JGI24739J22299_10014343 3300001989 Bacteria 2884
4 JGI24744J21845_10038233 3300002077 Bacteria 903
5 JGI25162J39368_1000141 3300002737 Bacteria 77973
6 rootH1_10044460 3300003316 Bacteria 10176
7 rootH1_10044460 3300003323 Bacteria 12555
8 rootH1_10122117 3300003323 Bacteria 6475
9 Ga0065714_10005722 3300005288 Bacteria 5520
10 Ga0070658_10000047 3300005327 Bacteria 129483
11 Ga0070658_10000079 3300005327 Bacteria 90829
12 Ga0070683_100110783 3300005329 Bacteria 2589
13 Ga0070690_100654032 3300005330 Bacteria 803
14 Ga0070670_100021996 3300005331 Bacteria 5487
15 Ga0070670_100024515 3300005331 Bacteria 5187
16 Ga0070670_100258453 3300005331 Bacteria 1518
17 Ga0068869_100944293 3300005334 Bacteria 748
18 Ga0070682_101489112 3300005337 Bacteria 582
19 Ga0068868_101075864 3300005338 Bacteria 739
20 Ga0070660_100260710 3300005339 Bacteria 1415
21 Ga0070689_100001873 3300005340 Bacteria 13563
22 Ga0070687_100175678 3300005343 Bacteria 1278
23 Ga0070661_100073747 3300005344 Bacteria 2513
24 Ga0070669_100698319 3300005353 Bacteria 856
25 Ga0070675_100016687 3300005354 Bacteria 5828
26 Ga0070671_101223529 3300005355 Bacteria 661
27 Ga0070671_101905369 3300005355 Bacteria 529
28 Ga0070674_100142306 3300005356 Bacteria 1801
29 Ga0070673_100259213 3300005364 Bacteria 1518
30 Ga0070688_100040199 3300005365 Bacteria 2864
31 Ga0070688_101667097 3300005365 Bacteria 521
32 Ga0070659_100674613 3300005366 Bacteria 892
33 Ga0070663_100001762 3300005455 Bacteria 12041
34 Ga0070678_101956437 3300005456 Bacteria 554
35 Ga0070685_10004450 3300005466 Bacteria 7085
36 Ga0070679_100096499 3300005530 Bacteria 2944
37 Ga0070679_100557818 3300005530 Bacteria 1089
38 Ga0070684_100031817 3300005535 Bacteria 4493
39 Ga0070684_101628732 3300005535 Unclassified 609
40 Ga0068853_102258948 3300005539 Unclassified 527
41 Ga0070704_100314279 3300005549 Bacteria 1310
42 Ga0068855_100000134 3300005563 Bacteria 94864
43 Ga0068855_100020720 3300005563 Bacteria 7885
44 Ga0068855_100026390 3300005563 Bacteria 6948
45 Ga0068855_100125858 3300005563 Bacteria 2930
46 Ga0068855_100260669 3300005563 Bacteria 1931
47 Ga0068855_101113300 3300005563 Bacteria 825
48 Ga0070664_100018839 3300005564 Bacteria 5675
49 Ga0068857_101692735 3300005577 Bacteria 618
50 Ga0068856_100000023 3300005614 Bacteria 141671
51 Ga0068856_100001612 3300005614 Bacteria 23598
52 Ga0068856_100421890 3300005614 Bacteria 1354
53 Ga0068852_100006294 3300005616 Bacteria 8569
54 Ga0068852_100150443 3300005616 Bacteria 2164
55 Ga0068852_100849944 3300005616 Bacteria 928
56 Ga0068859_100480842 3300005617 Bacteria 1337
57 Ga0068864_100915799 3300005618 Bacteria 866
58 Ga0068866_10584266 3300005718 Bacteria 752
59 Ga0068861_101148869 3300005719 Bacteria 748
60 Ga0068851_10860405 3300005834 Bacteria 566
61 Ga0068870_10099660 3300005840 Bacteria 1639
62 Ga0068858_101373186 3300005842 Bacteria 696
63 Ga0068862_100167790 3300005844 Bacteria 1963
64 Ga0097621_100756529 3300006237 Bacteria 898
65 Ga0075429_101108435 3300006880 Bacteria 691
66 Ga0097620_100480838 3300006931 Bacteria 1337
67 Ga0105240_10070596 3300009093 Bacteria 4321
68 Ga0105240_10084323 3300009093 Bacteria 3896
69 Ga0105245_10035506 3300009098 Bacteria 4424
70 Ga0105245_10230596 3300009098 Bacteria 1791
71 Ga0105241_10208389 3300009174 Bacteria 1637
72 Ga0105242_10734845 3300009176 Bacteria 970
73 Ga0105237_10375599 3300009545 Bacteria 1426
74 Ga0105237_11112798 3300009545 Bacteria 797
75 Ga0105237_12007878 3300009545 Bacteria 587
76 Ga0105238_10048733 3300009551 Bacteria 4268
77 Ga0105238_10235878 3300009551 Bacteria 1806
78 Ga0105238_11269598 3300009551 Bacteria 762
79 Ga0105249_10054779 3300009553 Bacteria 3647
80 Ga0105249_10181011 3300009553 Bacteria 2051
81 Ga0105249_10974735 3300009553 Bacteria 916
82 Ga0105239_10000007 3300010375 Bacteria 385297
83 Ga0105239_10000578 3300010375 Bacteria 52273
84 Ga0105239_10143679 3300010375 Bacteria 2660
85 Ga0105239_10279381 3300010375 Bacteria 1879
86 Ga0105246_10219739 3300011119 Bacteria 1489
87 Ga0105246_11526217 3300011119 Bacteria 628
88 Ga0157371_10085780 3300013102 Bacteria 2231
89 Ga0157371_10915031 3300013102 Bacteria 666
90 Ga0157370_10135007 3300013104 Bacteria 2300
91 Ga0157370_11121599 3300013104 Bacteria 710
92 Ga0157369_10180579 3300013105 Bacteria 2221
93 Ga0157369_10241719 3300013105 Bacteria 1886
94 Ga0157374_10288151 3300013296 Bacteria 1622
95 Ga0157374_10950174 3300013296 Bacteria 878
96 Ga0157378_10026814 3300013297 Bacteria 5081
97 Ga0157378_10106979 3300013297 Bacteria 2559
98 Ga0157378_10358912 3300013297 Bacteria 1426
99 Ga0157378_12274201 3300013297 Bacteria 594
100 Ga0163162_10034902 3300013306 Bacteria 5007
101 Ga0163162_10428870 3300013306 Unclassified 1454
102 Ga0163162_11369836 3300013306 Bacteria 805
103 Ga0163162_11915586 3300013306 Bacteria 679
104 Ga0157372_10405151 3300013307 Bacteria 1589
105 Ga0157375_10279589 3300013308 Bacteria 1832
106 Ga0157375_10404022 3300013308 Bacteria 1533
107 Ga0157375_10908707 3300013308 Bacteria 1024
108 Ga0163163_10012674 3300014325 Bacteria 7689
109 Ga0157380_10452321 3300014326 Bacteria 1234
110 Ga0157379_10018192 3300014968 Bacteria 6192
111 Ga0157379_10995709 3300014968 Bacteria 799
112 Ga0163161_10438258 3300017792 Bacteria 1054
113 Ga0213876_10105372 3300021384 Bacteria 1496
114 Ga0209437_100070 3300025233 Bacteria 306718
115 Ga0209258_116737 3300025242 Bacteria 814
116 Ga0209026_1001074 3300025250 Bacteria 13206
117 Ga0209026_1006847 3300025250 Bacteria 2696
118 Ga0209148_1014928 3300025254 Bacteria 1366
119 Ga0207656_10129516 3300025321 Bacteria 1181
120 Ga0207642_10520250 3300025899 Bacteria 731
121 Ga0207647_10000263 3300025904 Bacteria 43120
122 Ga0207647_10078547 3300025904 Bacteria 1982
123 Ga0207643_10011349 3300025908 Bacteria 4811
124 Ga0207705_10000052 3300025909 Bacteria 168319
125 Ga0207705_10000112 3300025909 Bacteria 90821
126 Ga0207654_10122195 3300025911 Bacteria 1637
127 Ga0207695_10046474 3300025913 Bacteria 4602
128 Ga0207695_10451339 3300025913 Bacteria 1169
129 Ga0207671_10240000 3300025914 Bacteria 1423
130 Ga0207671_10807979 3300025914 Bacteria 743
131 Ga0207662_10039731 3300025918 Bacteria 2761
132 Ga0207649_10134307 3300025920 Bacteria 1685
133 Ga0207652_10130061 3300025921 Bacteria 2245
134 Ga0207652_10502321 3300025921 Bacteria 1092
135 Ga0207681_10525772 3300025923 Bacteria 971
136 Ga0207694_10201606 3300025924 Bacteria 1619
137 Ga0207694_10380188 3300025924 Bacteria 1172
138 Ga0207650_10002225 3300025925 Bacteria 13543
139 Ga0207650_10066711 3300025925 Bacteria 2699
140 Ga0207650_10533358 3300025925 Bacteria 983
141 Ga0207659_10031140 3300025926 Bacteria 3649
142 Ga0207687_10267984 3300025927 Bacteria 1364
143 Ga0207644_10214632 3300025931 Bacteria 1523
144 Ga0207670_10026993 3300025936 Bacteria 3625
145 Ga0207669_10018549 3300025937 Bacteria 3600
146 Ga0207691_10079529 3300025940 Bacteria 2950
147 Ga0207689_10845615 3300025942 Bacteria 772
148 Ga0207661_10026476 3300025944 Bacteria 4419
149 Ga0207679_10018804 3300025945 Bacteria 4635
150 Ga0207667_10001127 3300025949 Bacteria 33693
151 Ga0207667_10066650 3300025949 Bacteria 3752
152 Ga0207667_10092191 3300025949 Bacteria 3129
153 Ga0207667_11027164 3300025949 Bacteria 810
154 Ga0207667_11088158 3300025949 Bacteria 783
155 Ga0207667_11893137 3300025949 Bacteria 559
156 Ga0207651_10102784 3300025960 Bacteria 2125
157 Ga0207712_10418331 3300025961 Bacteria 1130
158 Ga0207712_11538196 3300025961 Unclassified 596
159 Ga0207640_11284030 3300025981 Bacteria 653
160 Ga0207677_10158757 3300026023 Bacteria 1754
161 Ga0207703_10021581 3300026035 Bacteria 5042
162 Ga0207703_11750257 3300026035 Bacteria 598
163 Ga0207639_11343198 3300026041 Bacteria 671
164 Ga0207678_10055038 3300026067 Bacteria 3427
165 Ga0207702_10000165 3300026078 Bacteria 79066
166 Ga0207702_10001259 3300026078 Bacteria 25526
167 Ga0207702_10871332 3300026078 Bacteria 892
168 Ga0207676_10732436 3300026095 Unclassified 960
169 Ga0207674_11485461 3300026116 Bacteria 647
170 Ga0207675_100474936 3300026118 Bacteria 1242
171 Ga0207698_10095727 3300026142 Bacteria 2445
172 Ga0207698_10192033 3300026142 Bacteria 1820
173 Ga0207698_10374302 3300026142 Bacteria 1353
174 Ga0268265_10133760 3300028380 Bacteria 2065
175 Ga0265338_10019195 3300028800 Bacteria 7275
176 Ga0307412_10259725 3300031911 Bacteria 1353
177 Ga0307409_100936978 3300031995 Bacteria 881
178 Ga0307507_10001815 3300033179 Bacteria 46860
179 Ga0395900_0002301 3300037418 Bacteria 21221
180 Ga0395900_0401670 3300037418 Bacteria 1334
181 Ga0395898_0342655 3300037466 Bacteria 1425
182 Ga0395905_0000278 3300037471 Bacteria 75859
183 Ga0395901_0009402 3300038443 Bacteria 9917
184 Ga0436365_0741238 3300039437 Bacteria 21789
185 Ga0436361_0125444 3300039447 Bacteria 1191
186 Ga0466965_0206189 3300044683 Bacteria 1044
187 Ga0466966_0385924 3300044684 Bacteria 841
188 Ga0495629_0100797 3300046459 Bacteria 2015
189 Ga0495651_0741014 3300046462 Bacteria 610
190 Ga0495585_0001159 3300046492 Bacteria 21485
191 Ga0495585_0006258 3300046492 Bacteria 7410
192 Ga0495606_0000241 3300046507 Bacteria 96663
193 Ga0495606_0103607 3300046507 Bacteria 1728
194 Ga0495610_0022836 3300046512 Bacteria 3412
195 Ga0495616_0001895 3300046513 Bacteria 14129
196 Ga0495616_0202051 3300046513 Bacteria 873
197 Ga0495631_0436290 3300046518 Bacteria 558
198 Ga0495632_0200346 3300046519 Bacteria 909
199 Ga0495644_0087960 3300046523 Unclassified 1171
200 Ga0495648_0003102 3300046524 Bacteria 14832
201 Ga0495663_0114054 3300046525 Bacteria 900
202 Ga0495642_0496988 3300046528 Bacteria 540
203 Ga0495654_0082609 3300046530 Bacteria 1503
204 Ga0495654_0091688 3300046530 Bacteria 1409
205 Ga0495622_0051432 3300046557 Bacteria 1911
206 Ga0495622_0098609 3300046557 Bacteria 1340
207 Ga0495633_0005736 3300046558 Bacteria 7506
208 Ga0495668_0002237 3300046616 Bacteria 16368
209 Ga0495625_0000003 3300046660 Bacteria 686847
210 Ga0495625_0000381 3300046660 Bacteria 67732
211 Ga0495625_0003704 3300046660 Bacteria 14924
212 Ga0495658_0733672 3300046683 Bacteria 633
213 Ga0495649_0000002 3300046694 Bacteria 1093458
214 Ga0495687_000785 3300047443 Bacteria 34129
215 Ga0495687_046683 3300047443 Bacteria 1868
216 Ga0495685_074131 3300047447 Unclassified 1138
217 Ga0495686_0107685 3300047472 Bacteria 1675
218 Ga0495614_0184471 3300048089 Bacteria 939
219 Ga0495682_0287943 3300049460 Bacteria 580
220 Ga0501033_0408893 3300049570 Bacteria 946
221 Ga0501044_0069093 3300049823 Bacteria 3597
222 nmdc:mga0k408_631196_c1 3300050493 Bacteria 631
223 nmdc:mga08y16_1203482_c1 3300050511 Bacteria 728
224 Ga0500614_033050 3300053123 Bacteria 1276
225 Ga0500614_121784 3300053123 Bacteria 768
226 Ga0500642_0019775 3300053130 Bacteria 2634
227 Ga0500622_0212368 3300053156 Bacteria 873
228 Ga0500634_0109565 3300053161 Bacteria 1366
229 2586209843 2585427687 Bacteria 5544917
230 2599477280 2599185184 Bacteria 6430550
231 2738855437 2738541302 Bacteria 5944758
232 2902049465 2902048731 Bacteria 4976191
233 2910250905 2910245624 Bacteria 6935613
234 2928079197 2928078545 Bacteria 6534839
235 2932085728 2932082852 Bacteria 6563563
236 2945999257 2945997725 Bacteria 6404843
237 Ga0157377_10036967
238 JGI24740J21852_10007179
239 JGI24739J22299_10014343
240 JGI24744J21845_10038233
241 JGI25162J39368_1000141
242 rootH1_10044460
243 rootH1_10122117
244 Ga0065714_10005722
245 Ga0070658_10000047
246 Ga0070658_10000079
247 Ga0070683_100110783
248 Ga0070690_100654032
249 Ga0070670_100021996
250 Ga0070670_100024515
251 Ga0070670_100258453
252 Ga0068869_100944293
253 Ga0070682_101489112
254 Ga0068868_101075864
255 Ga0070660_100260710
256 Ga0070689_100001873
257 Ga0070687_100175678
258 Ga0070661_100073747
259 Ga0070669_100698319
260 Ga0070675_100016687
261 Ga0070671_101223529
262 Ga0070671_101905369
263 Ga0070674_100142306
264 Ga0070673_100259213
265 Ga0070688_100040199
266 Ga0070688_101667097
267 Ga0070659_100674613
268 Ga0070663_100001762
269 Ga0070678_101956437
270 Ga0070685_10004450
271 Ga0070679_100096499
272 Ga0070679_100557818
273 Ga0070684_100031817
274 Ga0070684_101628732
275 Ga0068853_102258948
276 Ga0070704_100314279
277 Ga0068855_100000134
278 Ga0068855_100020720
279 Ga0068855_100026390
280 Ga0068855_100125858
281 Ga0068855_100260669
282 Ga0068855_101113300
283 Ga0070664_100018839
284 Ga0068857_101692735
285 Ga0068856_100000023
286 Ga0068856_100001612
287 Ga0068856_100421890
288 Ga0068852_100006294
289 Ga0068852_100150443
290 Ga0068852_100849944
291 Ga0068859_100480842
292 Ga0068864_100915799
293 Ga0068866_10584266
294 Ga0068861_101148869
295 Ga0068851_10860405
296 Ga0068870_10099660
297 Ga0068858_101373186
298 Ga0068862_100167790
299 Ga0097621_100756529
300 Ga0075429_101108435
301 Ga0097620_100480838
302 Ga0105240_10070596
303 Ga0105240_10084323
304 Ga0105245_10035506
305 Ga0105245_10230596
306 Ga0105241_10208389
307 Ga0105242_10734845
308 Ga0105237_10375599
309 Ga0105237_11112798
310 Ga0105237_12007878
311 Ga0105238_10048733
312 Ga0105238_10235878
313 Ga0105238_11269598
314 Ga0105249_10054779
315 Ga0105249_10181011
316 Ga0105249_10974735
317 Ga0105239_10000007
318 Ga0105239_10000578
319 Ga0105239_10143679
320 Ga0105239_10279381
321 Ga0105246_10219739
322 Ga0105246_11526217
323 Ga0157371_10085780
324 Ga0157371_10915031
325 Ga0157370_10135007
326 Ga0157370_11121599
327 Ga0157369_10180579
328 Ga0157369_10241719
329 Ga0157374_10288151
330 Ga0157374_10950174
331 Ga0157378_10026814
332 Ga0157378_10106979
333 Ga0157378_10358912
334 Ga0157378_12274201
335 Ga0163162_10034902
336 Ga0163162_10428870
337 Ga0163162_11369836
338 Ga0163162_11915586
339 Ga0157372_10405151
340 Ga0157375_10279589
341 Ga0157375_10404022
342 Ga0157375_10908707
343 Ga0163163_10012674
344 Ga0157380_10452321
345 Ga0157379_10018192
346 Ga0157379_10995709
347 Ga0163161_10438258
348 Ga0213876_10105372
349 Ga0209437_100070
350 Ga0209258_116737
351 Ga0209026_1001074
352 Ga0209026_1006847
353 Ga0209148_1014928
354 Ga0207656_10129516
355 Ga0207642_10520250
356 Ga0207647_10000263
357 Ga0207647_10078547
358 Ga0207643_10011349
359 Ga0207705_10000052
360 Ga0207705_10000112
361 Ga0207654_10122195
362 Ga0207695_10046474
363 Ga0207695_10451339
364 Ga0207671_10240000
365 Ga0207671_10807979
366 Ga0207662_10039731
367 Ga0207649_10134307
368 Ga0207652_10130061
369 Ga0207652_10502321
370 Ga0207681_10525772
371 Ga0207694_10201606
372 Ga0207694_10380188
373 Ga0207650_10002225
374 Ga0207650_10066711
375 Ga0207650_10533358
376 Ga0207659_10031140
377 Ga0207687_10267984
378 Ga0207644_10214632
379 Ga0207670_10026993
380 Ga0207669_10018549
381 Ga0207691_10079529
382 Ga0207689_10845615
383 Ga0207661_10026476
384 Ga0207679_10018804
385 Ga0207667_10001127
386 Ga0207667_10066650
387 Ga0207667_10092191
388 Ga0207667_11027164
389 Ga0207667_11088158
390 Ga0207667_11893137
391 Ga0207651_10102784
392 Ga0207712_10418331
393 Ga0207712_11538196
394 Ga0207640_11284030
395 Ga0207677_10158757
396 Ga0207703_10021581
397 Ga0207703_11750257
398 Ga0207639_11343198
399 Ga0207678_10055038
400 Ga0207702_10000165
401 Ga0207702_10001259
402 Ga0207702_10871332
403 Ga0207676_10732436
404 Ga0207674_11485461
405 Ga0207675_100474936
406 Ga0207698_10095727
407 Ga0207698_10192033
408 Ga0207698_10374302
409 Ga0268265_10133760
410 Ga0265338_10019195
411 Ga0307412_10259725
412 Ga0307409_100936978
413 Ga0307507_10001815
414 Ga0395900_0002301
415 Ga0395900_0401670
416 Ga0395898_0342655
417 Ga0395905_0000278
418 Ga0395901_0009402
419 Ga0436365_0741238
420 Ga0436361_0125444
421 Ga0466965_0206189
422 Ga0466966_0385924
423 Ga0495629_0100797
424 Ga0495651_0741014
425 Ga0495585_0001159
426 Ga0495585_0006258
427 Ga0495606_0000241
428 Ga0495606_0103607
429 Ga0495610_0022836
430 Ga0495616_0001895
431 Ga0495616_0202051
432 Ga0495631_0436290
433 Ga0495632_0200346
434 Ga0495644_0087960
435 Ga0495648_0003102
436 Ga0495663_0114054
437 Ga0495642_0496988
438 Ga0495654_0082609
439 Ga0495654_0091688
440 Ga0495622_0051432
441 Ga0495622_0098609
442 Ga0495633_0005736
443 Ga0495668_0002237
444 Ga0495625_0000003
445 Ga0495625_0000381
446 Ga0495625_0003704
447 Ga0495658_0733672
448 Ga0495649_0000002
449 Ga0495687_000785
450 Ga0495687_046683
451 Ga0495685_074131
452 Ga0495686_0107685
453 Ga0495614_0184471
454 Ga0495682_0287943
455 Ga0501033_0408893
456 Ga0501044_0069093
457 nmdc:mga0k408_631196_c1
458 nmdc:mga08y16_1203482_c1
459 Ga0500614_033050
460 Ga0500614_121784
461 Ga0500642_0019775
462 Ga0500622_0212368
463 Ga0500634_0109565
464 2586209843
465 2599477280
466 2738855437
467 2902049465
468 2910250905
469 2928079197
470 2932085728
471 2945999257

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05635

23S_rRNA_IVP

23S rRNA-intervening sequence protein

6

53

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gsc-assembly1.cif.gz_D crystal structure of the conserved hypothetical cytosolic protein xcc0516 from xanthomonas campestris 0.9774 5 115
2gsc-assembly1.cif.gz_C crystal structure of the conserved hypothetical cytosolic protein xcc0516 from xanthomonas campestris 0.9729 5 116
2gsc-assembly1.cif.gz_C crystal structure of the conserved hypothetical cytosolic protein xcc0516 from xanthomonas campestris 0.9472 5 116
2gsc-assembly1.cif.gz_D crystal structure of the conserved hypothetical cytosolic protein xcc0516 from xanthomonas campestris 0.936 5 115
2rld-assembly1.cif.gz_E crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.9267 10 113
ID Description Score Start End Superfamily
2gscA00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.9836 5 115 1.20.1440.60
2gscC00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.9729 5 116 1.20.1440.60
2gscC00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.9472 5 116 1.20.1440.60
2gscA00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.924 5 115 1.20.1440.60
2rldD00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.9179 10 112 1.20.1440.60
ID Description Score Start End GO Terms
AF-A0A661XBT2-F1-model_v4 Four helix bundle protein 0.9953 3 115
AF-X1IK68-F1-model_v4 Four helix bundle protein 0.9951 5 114
AF-A0A1F7BEC5-F1-model_v4 Four helix bundle protein 0.995 4 116
AF-A0A832XEE8-F1-model_v4 Four helix bundle protein 0.9948 4 115
AF-A0A7V0ZGY8-F1-model_v4 Four helix bundle protein 0.9943 8 114

Map