F348095

General Info

Members Datasets Scaffolds Average Seq Length
235 158 470 260

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10365014|Ga0105248_103650142
Length 276
Sequence VAGQLSALAPSLRVTVLGSGTSHGVPAIGCDCAVCRSSDPRDRRTRPSILIEVRSAAPSPFAGTVRSILVDTSTDLRMQALANDVRRVDAILFTHSHADHVFGLDDVRRYNQMQKTAIPCYGDEETMASVRRMFAYIFDPATQQGGGLPQLVPFTIAGPFTLGGVEVVPVPVFHGRLPVLGFRIGSFAYLTDCNRIPDQSWPLLEGVRTVVLDALRRRPHSTHFTVDQAVEVVARLGAERAYFTHICHDLAHAETCARLPPGVELAYDGLVLEITG

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
90 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
91 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
94 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
95 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
96 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
97 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
98 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
99 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
100 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
101 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
102 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
103 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
104 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
105 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
106 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
107 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
112 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.85
Rhizosphere 97.45
Stem 0
Stem Tuber 0
Unclassified 5.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10365014 3300009177 Bacteria 1626
2 rootL2_10163298 3300003322 Bacteria 2264
3 Ga0070676_10338886 3300005328 Bacteria 1030
4 Ga0070690_100092145 3300005330 Bacteria 1998
5 Ga0068868_100024721 3300005338 Bacteria 4561
6 Ga0068868_100220712 3300005338 Bacteria 1587
7 Ga0070689_100088564 3300005340 Bacteria 2437
8 Ga0070691_10037007 3300005341 Bacteria 2301
9 Ga0070668_100038552 3300005347 Bacteria 3652
10 Ga0070669_100006192 3300005353 Bacteria 8637
11 Ga0070669_100226541 3300005353 Bacteria 1480
12 Ga0070669_100503334 3300005353 Bacteria 1005
13 Ga0070675_100005932 3300005354 Bacteria 9359
14 Ga0070675_100072665 3300005354 Bacteria 2855
15 Ga0070674_100026276 3300005356 Bacteria 3800
16 Ga0070688_100455853 3300005365 Bacteria 957
17 Ga0070713_100324978 3300005436 Unclassified 1421
18 Ga0070705_100013631 3300005440 Bacteria 4162
19 Ga0070700_100065576 3300005441 Bacteria 2303
20 Ga0070694_100044452 3300005444 Bacteria 2972
21 Ga0070694_100086203 3300005444 Bacteria 2194
22 Ga0070708_100077806 3300005445 Bacteria 2997
23 Ga0068867_100096205 3300005459 Bacteria 2254
24 Ga0070685_10257758 3300005466 Bacteria 1158
25 Ga0070707_100338181 3300005468 Bacteria 1463
26 Ga0070698_100136572 3300005471 Bacteria 2406
27 Ga0070699_100010599 3300005518 Bacteria 7978
28 Ga0070699_100411834 3300005518 Bacteria 1223
29 Ga0070686_100002326 3300005544 Bacteria 10487
30 Ga0070695_100002246 3300005545 Bacteria 11064
31 Ga0070696_100133963 3300005546 Bacteria 1805
32 Ga0070696_100177362 3300005546 Bacteria 1579
33 Ga0070704_100044248 3300005549 Bacteria 3092
34 Ga0070704_100108385 3300005549 Bacteria 2109
35 Ga0070704_100119429 3300005549 Bacteria 2022
36 Ga0068859_100169642 3300005617 Bacteria 2263
37 Ga0068866_10035685 3300005718 Bacteria 2430
38 Ga0068861_100004669 3300005719 Bacteria 9201
39 Ga0068858_100214241 3300005842 Bacteria 1823
40 Ga0068862_100577474 3300005844 Bacteria 1076
41 Ga0081539_10012639 3300005985 Bacteria 6474
42 Ga0081539_10183704 3300005985 Unclassified 979
43 Ga0070717_10243176 3300006028 Bacteria 1588
44 Ga0097621_100009407 3300006237 Bacteria 7090
45 Ga0068871_100072358 3300006358 Bacteria 2839
46 Ga0075428_100095905 3300006844 Bacteria 3233
47 Ga0075428_100413386 3300006844 Bacteria 1445
48 Ga0075430_100029747 3300006846 Bacteria 4636
49 Ga0075431_100000791 3300006847 Bacteria 27596
50 Ga0075431_100094454 3300006847 Bacteria 3086
51 Ga0075431_100491462 3300006847 Unclassified 1219
52 Ga0075433_10045117 3300006852 Bacteria 3831
53 Ga0075434_100006046 3300006871 Bacteria 11068
54 Ga0075434_100074765 3300006871 Bacteria 3381
55 Ga0075429_100009348 3300006880 Bacteria 8510
56 Ga0075429_100104597 3300006880 Bacteria 2473
57 Ga0068865_100018659 3300006881 Bacteria 4479
58 Ga0068865_100199828 3300006881 Unclassified 1551
59 Ga0068865_100219732 3300006881 Bacteria 1485
60 Ga0075436_100004000 3300006914 Bacteria 10111
61 Ga0075436_100012014 3300006914 Bacteria 5939
62 Ga0075436_100313457 3300006914 Bacteria 1126
63 Ga0097620_100169637 3300006931 Bacteria 2263
64 Ga0075435_100000054 3300007076 Bacteria 58537
65 Ga0075435_100001014 3300007076 Bacteria 17816
66 Ga0075435_100009536 3300007076 Bacteria 7037
67 Ga0075435_100012107 3300007076 Bacteria 6376
68 Ga0075435_100040783 3300007076 Bacteria 3709
69 Ga0075435_100043209 3300007076 Bacteria 3607
70 Ga0075435_100396810 3300007076 Unclassified 1186
71 Ga0075435_100486556 3300007076 Unclassified 1066
72 Ga0105240_10006705 3300009093 Bacteria 16868
73 Ga0111539_10003324 3300009094 Bacteria 21234
74 Ga0111539_10019722 3300009094 Bacteria 8316
75 Ga0111539_10265411 3300009094 Bacteria 1998
76 Ga0105245_10782743 3300009098 Unclassified 991
77 Ga0114129_10008618 3300009147 Bacteria 14540
78 Ga0114129_10018227 3300009147 Bacteria 9996
79 Ga0114129_10050929 3300009147 Bacteria 5814
80 Ga0114129_10088012 3300009147 Bacteria 4306
81 Ga0114129_10515421 3300009147 Bacteria 1560
82 Ga0114129_10787881 3300009147 Bacteria 1214
83 Ga0105243_10023858 3300009148 Bacteria 4662
84 Ga0105243_10033250 3300009148 Bacteria 3988
85 Ga0105242_10005857 3300009176 Bacteria 9471
86 Ga0105242_10439281 3300009176 Bacteria 1227
87 Ga0105248_10172572 3300009177 Bacteria 2437
88 Ga0105238_10583743 3300009551 Bacteria 1124
89 Ga0105238_10869605 3300009551 Bacteria 919
90 Ga0105239_11151104 3300010375 Bacteria 893
91 Ga0157374_10182597 3300013296 Bacteria 2050
92 Ga0163162_10611022 3300013306 Unclassified 1216
93 Ga0157377_10062656 3300014745 Bacteria 2128
94 Ga0157376_10147543 3300014969 Bacteria 2117
95 Ga0163161_10388253 3300017792 Unclassified 1117
96 Ga0207642_10093875 3300025899 Bacteria 1489
97 Ga0207680_10152878 3300025903 Bacteria 1540
98 Ga0207645_10047784 3300025907 Bacteria 2732
99 Ga0207654_10188105 3300025911 Bacteria 1351
100 Ga0207646_10110800 3300025922 Bacteria 2463
101 Ga0207681_10060794 3300025923 Bacteria 2595
102 Ga0207694_10567685 3300025924 Bacteria 953
103 Ga0207659_10000607 3300025926 Bacteria 21418
104 Ga0207659_10009183 3300025926 Bacteria 6174
105 Ga0207706_10039767 3300025933 Bacteria 4170
106 Ga0207686_10053277 3300025934 Bacteria 2528
107 Ga0207709_10015393 3300025935 Bacteria 4240
108 Ga0207670_10043396 3300025936 Bacteria 2969
109 Ga0207670_10353843 3300025936 Bacteria 1164
110 Ga0207669_10187833 3300025937 Unclassified 1488
111 Ga0207704_10073412 3300025938 Bacteria 2178
112 Ga0207704_10351067 3300025938 Bacteria 1148
113 Ga0207665_10111912 3300025939 Bacteria 1919
114 Ga0207711_10111739 3300025941 Bacteria 2431
115 Ga0207689_10032026 3300025942 Bacteria 4374
116 Ga0207712_10020550 3300025961 Bacteria 4325
117 Ga0207668_10149168 3300025972 Bacteria 1808
118 Ga0207640_10339859 3300025981 Bacteria 1202
119 Ga0207677_10013103 3300026023 Bacteria 4793
120 Ga0207703_10184593 3300026035 Bacteria 1843
121 Ga0207708_10055924 3300026075 Bacteria 3009
122 Ga0207641_10318765 3300026088 Bacteria 1474
123 Ga0207648_10034892 3300026089 Bacteria 4435
124 Ga0207648_10203321 3300026089 Bacteria 1757
125 Ga0207675_100005222 3300026118 Bacteria 12498
126 Ga0207675_100459673 3300026118 Bacteria 1262
127 Ga0207683_10512917 3300026121 Unclassified 1108
128 Ga0207428_10000650 3300027907 Bacteria 40750
129 Ga0207428_10028957 3300027907 Bacteria 4596
130 Ga0207428_10045291 3300027907 Bacteria 3544
131 Ga0207428_10191893 3300027907 Bacteria 1540
132 Ga0268265_10309152 3300028380 Bacteria 1426
133 Ga0268264_10404463 3300028381 Unclassified 1313
134 Ga0307517_10002351 3300028786 Bacteria 30512
135 Ga0307511_10000182 3300030521 Bacteria 62310
136 Ga0265339_10066160 3300031249 Bacteria 1936
137 Ga0265314_10051445 3300031711 Bacteria 2869
138 Ga0307516_10005011 3300031730 Bacteria 16062
139 Ga0373930_0000192 3300034816 Bacteria 7395
140 Ga0373958_0017566 3300034819 Bacteria 1287
141 Ga0373959_0001636 3300034820 Bacteria 3561
142 Ga0373938_0000411 3300034957 Bacteria 6904
143 Ga0373928_0020267 3300035084 Bacteria 1393
144 Ga0373940_0003189 3300035088 Bacteria 3312
145 Ga0373949_0000975 3300035090 Bacteria 8874
146 Ga0373951_0000906 3300035091 Bacteria 7975
147 Ga0373952_0001705 3300035092 Bacteria 3995
148 Ga0373932_0002625 3300035112 Bacteria 4482
149 Ga0373939_0006525 3300035114 Bacteria 2814
150 Ga0373941_0000100 3300035115 Bacteria 14305
151 Ga0373956_0078809 3300035119 Bacteria 1509
152 Ga0373960_0004127 3300035121 Bacteria 3319
153 Ga0373943_0003534 3300035170 Bacteria 7116
154 Ga0373943_0177278 3300035170 Bacteria 1170
155 Ga0373946_0016834 3300035171 Bacteria 2790
156 Ga0373955_0092762 3300035172 Bacteria 1723
157 Ga0373961_0001007 3300035241 Bacteria 9195
158 Ga0373924_0009672 3300035410 Bacteria 3541
159 Ga0373931_0000326 3300035691 Bacteria 19957
160 Ga0373947_0035333 3300035725 Bacteria 2959
161 Ga0373925_0088349 3300037068 Bacteria 2367
162 Ga0373925_0137940 3300037068 Bacteria 1907
163 Ga0453684_0454201 3300044712 Bacteria 1426
164 Ga0451576_0023257 3300045051 Bacteria 6712
165 Ga0451576_0086577 3300045051 Bacteria 3259
166 Ga0495592_0021324 3300046454 Bacteria 4928
167 Ga0495629_0204632 3300046459 Bacteria 1364
168 Ga0495580_0277333 3300046472 Bacteria 1144
169 Ga0495582_0051454 3300046473 Bacteria 2271
170 Ga0495664_0267717 3300046477 Bacteria 1033
171 Ga0495608_0037425 3300046511 Bacteria 3263
172 Ga0495630_0015944 3300046517 Bacteria 5491
173 Ga0495630_0183062 3300046517 Bacteria 1598
174 Ga0495587_0044714 3300046536 Bacteria 2634
175 Ga0495634_0049238 3300046642 Bacteria 2834
176 Ga0495635_0140142 3300046663 Bacteria 1647
177 Ga0495635_0233892 3300046663 Bacteria 1241
178 Ga0495657_0254755 3300046675 Bacteria 1056
179 Ga0495658_0037578 3300046683 Bacteria 2677
180 Ga0495613_0012828 3300046689 Bacteria 6230
181 Ga0495613_0168420 3300046689 Bacteria 1556
182 Ga0495600_0117011 3300046809 Bacteria 1735
183 Ga0495581_0257537 3300047315 Bacteria 1020
184 Ga0495604_0020185 3300047317 Bacteria 5325
185 Ga0495674_0048798 3300047319 Bacteria 3744
186 Ga0495680_0219101 3300047322 Bacteria 1359
187 Ga0495684_0004863 3300047471 Bacteria 10480
188 Ga0495602_0226897 3300048088 Bacteria 1406
189 Ga0496102_0197340 3300048905 Bacteria 1897
190 Ga0496106_0098730 3300048909 Bacteria 2263
191 Ga0501042_0323628 3300049578 Unclassified 1114
192 Ga0501043_0000103 3300049579 Bacteria 78851
193 Ga0501046_0000081 3300049580 Bacteria 101779
194 Ga0501047_0018148 3300049581 Bacteria 6741
195 Ga0501075_0329925 3300049591 Bacteria 1163
196 Ga0501083_0000037 3300049744 Bacteria 95622
197 Ga0501044_0047573 3300049823 Bacteria 4436
198 Ga0501044_0431867 3300049823 Bacteria 1226
199 nmdc:mga05p37_20245_c1 3300050507 Bacteria 8053
200 nmdc:mga05p37_231720_c1 3300050507 Bacteria 2225
201 nmdc:mga05p37_27973_c1 3300050507 Bacteria 6868
202 nmdc:mga05p37_483734_c1 3300050507 Bacteria 1425
203 nmdc:mga05p37_604604_c1 3300050507 Bacteria 1237
204 nmdc:mga05p37_760140_c1 3300050507 Bacteria 1067
205 nmdc:mga09592_251484_c1 3300050508 Bacteria 1532
206 nmdc:mga09592_32460_c1 3300050508 Bacteria 4353
207 nmdc:mga09592_55014_c1 3300050508 Bacteria 3363
208 nmdc:mga0qj67_107848_c1 3300050509 Bacteria 2247
209 nmdc:mga06r32_186439_c1 3300050510 Bacteria 2062
210 nmdc:mga06r32_4461_c1 3300050510 Bacteria 12534
211 nmdc:mga08y16_1356_c1 3300050511 Bacteria 24451
212 nmdc:mga08y16_138261_c1 3300050511 Bacteria 2533
213 nmdc:mga08y16_154314_c1 3300050511 Bacteria 2386
214 nmdc:mga0n895_184962_c1 3300050512 Bacteria 2115
215 nmdc:mga0n895_3855_c1 3300050512 Bacteria 12172
216 nmdc:mga0n895_43518_c1 3300050512 Bacteria 4376
217 nmdc:mga0n895_953138_c1 3300050512 Bacteria 841
218 nmdc:mga0rr50_116997_c1 3300050513 Bacteria 2117
219 nmdc:mga0rr50_173083_c1 3300050513 Bacteria 1760
220 nmdc:mga0rr50_427964_c1 3300050513 Unclassified 1120
221 nmdc:mga0rr50_50117_c1 3300050513 Bacteria 3093
222 nmdc:mga0rr50_5_c1 3300050513 Bacteria 327169
223 nmdc:mga0rr50_93758_c1 3300050513 Bacteria 2343
224 nmdc:mga08x19_11981_c1 3300050514 Bacteria 5219
225 nmdc:mga08x19_249890_c1 3300050514 Bacteria 1224
226 nmdc:mga08x19_406_c1 3300050514 Bacteria 30257
227 nmdc:mga08x19_42379_c1 3300050514 Bacteria 2902
228 nmdc:mga0a205_145778_c1 3300050515 Bacteria 2268
229 nmdc:mga0a205_168563_c1 3300050515 Bacteria 2085
230 nmdc:mga0a205_371179_c1 3300050515 Bacteria 1297
231 nmdc:mga0a205_634322_c1 3300050515 Bacteria 920
232 nmdc:mga0a205_63920_c1 3300050515 Bacteria 3555
233 Ga0495601_0005971 3300053077 Bacteria 7105
234 Ga0495619_0003455 3300053085 Bacteria 10194
235 Ga0590075_015651 3300059424 Bacteria 1861
236 Ga0105248_10365014
237 rootL2_10163298
238 Ga0070676_10338886
239 Ga0070690_100092145
240 Ga0068868_100024721
241 Ga0068868_100220712
242 Ga0070689_100088564
243 Ga0070691_10037007
244 Ga0070668_100038552
245 Ga0070669_100006192
246 Ga0070669_100226541
247 Ga0070669_100503334
248 Ga0070675_100005932
249 Ga0070675_100072665
250 Ga0070674_100026276
251 Ga0070688_100455853
252 Ga0070713_100324978
253 Ga0070705_100013631
254 Ga0070700_100065576
255 Ga0070694_100044452
256 Ga0070694_100086203
257 Ga0070708_100077806
258 Ga0068867_100096205
259 Ga0070685_10257758
260 Ga0070707_100338181
261 Ga0070698_100136572
262 Ga0070699_100010599
263 Ga0070699_100411834
264 Ga0070686_100002326
265 Ga0070695_100002246
266 Ga0070696_100133963
267 Ga0070696_100177362
268 Ga0070704_100044248
269 Ga0070704_100108385
270 Ga0070704_100119429
271 Ga0068859_100169642
272 Ga0068866_10035685
273 Ga0068861_100004669
274 Ga0068858_100214241
275 Ga0068862_100577474
276 Ga0081539_10012639
277 Ga0081539_10183704
278 Ga0070717_10243176
279 Ga0097621_100009407
280 Ga0068871_100072358
281 Ga0075428_100095905
282 Ga0075428_100413386
283 Ga0075430_100029747
284 Ga0075431_100000791
285 Ga0075431_100094454
286 Ga0075431_100491462
287 Ga0075433_10045117
288 Ga0075434_100006046
289 Ga0075434_100074765
290 Ga0075429_100009348
291 Ga0075429_100104597
292 Ga0068865_100018659
293 Ga0068865_100199828
294 Ga0068865_100219732
295 Ga0075436_100004000
296 Ga0075436_100012014
297 Ga0075436_100313457
298 Ga0097620_100169637
299 Ga0075435_100000054
300 Ga0075435_100001014
301 Ga0075435_100009536
302 Ga0075435_100012107
303 Ga0075435_100040783
304 Ga0075435_100043209
305 Ga0075435_100396810
306 Ga0075435_100486556
307 Ga0105240_10006705
308 Ga0111539_10003324
309 Ga0111539_10019722
310 Ga0111539_10265411
311 Ga0105245_10782743
312 Ga0114129_10008618
313 Ga0114129_10018227
314 Ga0114129_10050929
315 Ga0114129_10088012
316 Ga0114129_10515421
317 Ga0114129_10787881
318 Ga0105243_10023858
319 Ga0105243_10033250
320 Ga0105242_10005857
321 Ga0105242_10439281
322 Ga0105248_10172572
323 Ga0105238_10583743
324 Ga0105238_10869605
325 Ga0105239_11151104
326 Ga0157374_10182597
327 Ga0163162_10611022
328 Ga0157377_10062656
329 Ga0157376_10147543
330 Ga0163161_10388253
331 Ga0207642_10093875
332 Ga0207680_10152878
333 Ga0207645_10047784
334 Ga0207654_10188105
335 Ga0207646_10110800
336 Ga0207681_10060794
337 Ga0207694_10567685
338 Ga0207659_10000607
339 Ga0207659_10009183
340 Ga0207706_10039767
341 Ga0207686_10053277
342 Ga0207709_10015393
343 Ga0207670_10043396
344 Ga0207670_10353843
345 Ga0207669_10187833
346 Ga0207704_10073412
347 Ga0207704_10351067
348 Ga0207665_10111912
349 Ga0207711_10111739
350 Ga0207689_10032026
351 Ga0207712_10020550
352 Ga0207668_10149168
353 Ga0207640_10339859
354 Ga0207677_10013103
355 Ga0207703_10184593
356 Ga0207708_10055924
357 Ga0207641_10318765
358 Ga0207648_10034892
359 Ga0207648_10203321
360 Ga0207675_100005222
361 Ga0207675_100459673
362 Ga0207683_10512917
363 Ga0207428_10000650
364 Ga0207428_10028957
365 Ga0207428_10045291
366 Ga0207428_10191893
367 Ga0268265_10309152
368 Ga0268264_10404463
369 Ga0307517_10002351
370 Ga0307511_10000182
371 Ga0265339_10066160
372 Ga0265314_10051445
373 Ga0307516_10005011
374 Ga0373930_0000192
375 Ga0373958_0017566
376 Ga0373959_0001636
377 Ga0373938_0000411
378 Ga0373928_0020267
379 Ga0373940_0003189
380 Ga0373949_0000975
381 Ga0373951_0000906
382 Ga0373952_0001705
383 Ga0373932_0002625
384 Ga0373939_0006525
385 Ga0373941_0000100
386 Ga0373956_0078809
387 Ga0373960_0004127
388 Ga0373943_0003534
389 Ga0373943_0177278
390 Ga0373946_0016834
391 Ga0373955_0092762
392 Ga0373961_0001007
393 Ga0373924_0009672
394 Ga0373931_0000326
395 Ga0373947_0035333
396 Ga0373925_0088349
397 Ga0373925_0137940
398 Ga0453684_0454201
399 Ga0451576_0023257
400 Ga0451576_0086577
401 Ga0495592_0021324
402 Ga0495629_0204632
403 Ga0495580_0277333
404 Ga0495582_0051454
405 Ga0495664_0267717
406 Ga0495608_0037425
407 Ga0495630_0015944
408 Ga0495630_0183062
409 Ga0495587_0044714
410 Ga0495634_0049238
411 Ga0495635_0140142
412 Ga0495635_0233892
413 Ga0495657_0254755
414 Ga0495658_0037578
415 Ga0495613_0012828
416 Ga0495613_0168420
417 Ga0495600_0117011
418 Ga0495581_0257537
419 Ga0495604_0020185
420 Ga0495674_0048798
421 Ga0495680_0219101
422 Ga0495684_0004863
423 Ga0495602_0226897
424 Ga0496102_0197340
425 Ga0496106_0098730
426 Ga0501042_0323628
427 Ga0501043_0000103
428 Ga0501046_0000081
429 Ga0501047_0018148
430 Ga0501075_0329925
431 Ga0501083_0000037
432 Ga0501044_0047573
433 Ga0501044_0431867
434 nmdc:mga05p37_20245_c1
435 nmdc:mga05p37_231720_c1
436 nmdc:mga05p37_27973_c1
437 nmdc:mga05p37_483734_c1
438 nmdc:mga05p37_604604_c1
439 nmdc:mga05p37_760140_c1
440 nmdc:mga09592_251484_c1
441 nmdc:mga09592_32460_c1
442 nmdc:mga09592_55014_c1
443 nmdc:mga0qj67_107848_c1
444 nmdc:mga06r32_186439_c1
445 nmdc:mga06r32_4461_c1
446 nmdc:mga08y16_1356_c1
447 nmdc:mga08y16_138261_c1
448 nmdc:mga08y16_154314_c1
449 nmdc:mga0n895_184962_c1
450 nmdc:mga0n895_3855_c1
451 nmdc:mga0n895_43518_c1
452 nmdc:mga0n895_953138_c1
453 nmdc:mga0rr50_116997_c1
454 nmdc:mga0rr50_173083_c1
455 nmdc:mga0rr50_427964_c1
456 nmdc:mga0rr50_50117_c1
457 nmdc:mga0rr50_5_c1
458 nmdc:mga0rr50_93758_c1
459 nmdc:mga08x19_11981_c1
460 nmdc:mga08x19_249890_c1
461 nmdc:mga08x19_406_c1
462 nmdc:mga08x19_42379_c1
463 nmdc:mga0a205_145778_c1
464 nmdc:mga0a205_168563_c1
465 nmdc:mga0a205_371179_c1
466 nmdc:mga0a205_634322_c1
467 nmdc:mga0a205_63920_c1
468 Ga0495601_0005971
469 Ga0495619_0003455
470 Ga0590075_015651

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

66

246

0.91

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

62

245

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b9v-assembly1.cif.gz_A crystal structure of a new diphosphatase from the phnp family 0.955 5 261
6b9v-assembly1.cif.gz_B crystal structure of a new diphosphatase from the phnp family 0.9469 6 259
6b9v-assembly1.cif.gz_A crystal structure of a new diphosphatase from the phnp family 0.933 5 261
6b9v-assembly1.cif.gz_B crystal structure of a new diphosphatase from the phnp family 0.9251 6 259
3qh8-assembly1.cif.gz_A crystal structure of a beta-lactamase-like protein bound to amp from brucella melitensis, long wavelength synchrotron data 0.9096 5 259
ID Description Score Start End Superfamily
af_C4J9M0_89_373_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9403 5 258 3.60.15.10
af_O74545_3_299_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9204 4 258 3.60.15.10
af_C4J9M0_89_373_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9091 5 258 3.60.15.10
3py6A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9087 5 259 3.60.15.10
af_I1K3H5_2_307_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.896 6 259 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A4V1ZVG4-F1-model_v4 MBL fold metallo-hydrolase 0.9965 187 256 GO:0016787
AF-A0A4Q3SYF3-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9923 143 262
AF-A0A358XTR4-F1-model_v4 MBL fold metallo-hydrolase 0.9919 161 258 GO:0016787
AF-A0A6J4JS92-F1-model_v4 Metal-dependent hydrolases of the beta-lactamase superfamily I PhnP protein 0.9915 143 259 GO:0016787
AF-A0A090W1C7-F1-model_v4 Metal-dependent hydrolases of the beta-lactamase superfamily I 0.9896 151 258 GO:0016787

Map