F348084

General Info

Members Datasets Scaffolds Average Seq Length
235 160 470 270

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10026016|Ga0105243_100260164
Length 314
Sequence MARALWAGSLSFGLVNVPVQLFSAVRDLDLHFTQLHEKDGSPIETRRFCAEEDREVPYEEIAHGYDLEDEDRRLVLTDEDLASVAPRKTRTIDIHAFVDLADVDPIHFDHPYFLAPSGDSEGTRRAYQLLVEVMRSTDRAALGRFVMRTKEYLVAVRVRDDRLSLTTMLFADEIRDPGDVPAGGRKPSKAQLAGAVKLIEALSEPWKPDEYKDRYRKRLQDVVARKKSGKRIRAPKQEPQPSPVPDLMAALERSLQEAQGRGGNGKRASGDNXXXXGDDLAGLSRDELYDRAQQADVSGRSSMSKQQLIKALSR

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
88 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
89 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
90 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
91 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
95 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
96 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
97 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
106 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
107 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
136 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
137 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.83
Nodule 0
Rhizoplane 8.94
Rhizosphere 85.96
Stem 0
Stem Tuber 0
Unclassified 7.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10026016 3300009148 Bacteria 4477
2 JGI25406J46586_10007543 3300003203 Bacteria 4958
3 JGI25406J46586_10068862 3300003203 Bacteria 1117
4 JGI25407J50210_10000530 3300003373 Bacteria 7683
5 Ga0070658_10021770 3300005327 Bacteria 5139
6 Ga0070683_100017121 3300005329 Bacteria 6399
7 Ga0070683_100594588 3300005329 Unclassified 1059
8 Ga0070680_100000377 3300005336 Bacteria 30109
9 Ga0070660_100010370 3300005339 Bacteria 6585
10 Ga0070687_100079418 3300005343 Bacteria 1786
11 Ga0070661_100229539 3300005344 Unclassified 1426
12 Ga0070692_10014573 3300005345 Bacteria 3698
13 Ga0070674_100415283 3300005356 Bacteria 1103
14 Ga0070659_100013101 3300005366 Bacteria 6167
15 Ga0070659_100183242 3300005366 Unclassified 1719
16 Ga0070714_100021287 3300005435 Bacteria 5305
17 Ga0070714_100195238 3300005435 Bacteria 1849
18 Ga0070713_100095379 3300005436 Unclassified 2566
19 Ga0070700_100083815 3300005441 Bacteria 2064
20 Ga0070681_10007641 3300005458 Bacteria 10573
21 Ga0068867_100083323 3300005459 Bacteria 2414
22 Ga0070679_100001463 3300005530 Bacteria 20928
23 Ga0070679_100157300 3300005530 Bacteria 2247
24 Ga0070684_100006789 3300005535 Bacteria 8876
25 Ga0070686_100206933 3300005544 Bacteria 1410
26 Ga0070665_100000312 3300005548 Bacteria 75711
27 Ga0070665_100078720 3300005548 Bacteria 3303
28 Ga0068855_100156586 3300005563 Bacteria 2588
29 Ga0068854_100143088 3300005578 Bacteria 1837
30 Ga0068856_100161124 3300005614 Bacteria 2254
31 Ga0068856_100168965 3300005614 Bacteria 2199
32 Ga0068852_100029886 3300005616 Bacteria 4480
33 Ga0068852_100122188 3300005616 Bacteria 2386
34 Ga0068858_100091845 3300005842 Bacteria 2825
35 Ga0081538_10000035 3300005981 Bacteria 120009
36 Ga0081538_10000832 3300005981 Bacteria 33477
37 Ga0081538_10001175 3300005981 Bacteria 27654
38 Ga0081538_10023281 3300005981 Bacteria 4457
39 Ga0081538_10031897 3300005981 Bacteria 3543
40 Ga0081538_10037432 3300005981 Bacteria 3147
41 Ga0081539_10000369 3300005985 Bacteria 98527
42 Ga0081539_10010940 3300005985 Bacteria 7276
43 Ga0075365_10000038 3300006038 Bacteria 48381
44 Ga0075364_10000130 3300006051 Bacteria 31683
45 Ga0075362_10011723 3300006177 Bacteria 3459
46 Ga0075367_10065096 3300006178 Bacteria 2182
47 Ga0075366_10243572 3300006195 Bacteria 1096
48 Ga0075428_100011444 3300006844 Bacteria 9868
49 Ga0075428_100034195 3300006844 Bacteria 5608
50 Ga0075428_100195839 3300006844 Bacteria 2185
51 Ga0068865_100124405 3300006881 Bacteria 1923
52 Ga0075436_100027795 3300006914 Bacteria 3894
53 Ga0105240_10030536 3300009093 Bacteria 7003
54 Ga0111539_10044267 3300009094 Bacteria 5333
55 Ga0105245_10051690 3300009098 Bacteria 3683
56 Ga0105247_10040011 3300009101 Bacteria 2865
57 Ga0114129_10313641 3300009147 Bacteria 2087
58 Ga0105237_10124927 3300009545 Bacteria 2567
59 Ga0105238_10107507 3300009551 Bacteria 2770
60 Ga0105249_10314101 3300009553 Bacteria 1576
61 Ga0105249_10851609 3300009553 Unclassified 977
62 Ga0105239_10862867 3300010375 Bacteria 1038
63 Ga0157371_10388315 3300013102 Unclassified 1020
64 Ga0157370_10007489 3300013104 Bacteria 11858
65 Ga0157372_10134678 3300013307 Bacteria 2844
66 Ga0157375_10280270 3300013308 Bacteria 1830
67 Ga0163163_10973125 3300014325 Bacteria 912
68 Ga0157377_10191226 3300014745 Bacteria 1293
69 Ga0157379_10000652 3300014968 Bacteria 28069
70 Ga0206356_10958541 3300020070 Bacteria 1938
71 Ga0207656_10259726 3300025321 Unclassified 853
72 Ga0207688_10069223 3300025901 Bacteria 2000
73 Ga0207705_10116658 3300025909 Bacteria 1977
74 Ga0207693_10132120 3300025915 Unclassified 1962
75 Ga0207660_10017274 3300025917 Bacteria 4790
76 Ga0207662_10018380 3300025918 Bacteria 3966
77 Ga0207657_10012750 3300025919 Bacteria 8278
78 Ga0207652_10002299 3300025921 Bacteria 16199
79 Ga0207652_10421395 3300025921 Bacteria 1204
80 Ga0207664_10028234 3300025929 Bacteria 4262
81 Ga0207690_10231167 3300025932 Unclassified 1420
82 Ga0207689_10297544 3300025942 Bacteria 1337
83 Ga0207661_10113441 3300025944 Bacteria 2296
84 Ga0207661_10313966 3300025944 Bacteria 1408
85 Ga0207712_10300468 3300025961 Bacteria 1317
86 Ga0207640_10262439 3300025981 Bacteria 1347
87 Ga0207677_10261880 3300026023 Bacteria 1410
88 Ga0207708_10020367 3300026075 Bacteria 5003
89 Ga0207708_10135360 3300026075 Bacteria 1929
90 Ga0207708_10336703 3300026075 Unclassified 1235
91 Ga0207676_10531367 3300026095 Bacteria 1121
92 Ga0207674_10285192 3300026116 Bacteria 1600
93 Ga0207698_10012036 3300026142 Bacteria 5640
94 Ga0207698_10153808 3300026142 Bacteria 2001
95 Ga0268266_10025556 3300028379 Bacteria 5023
96 Ga0268266_10033884 3300028379 Bacteria 4340
97 Ga0265338_10031711 3300028800 Bacteria 5174
98 Ga0307408_100201949 3300031548 Bacteria 1610
99 Ga0307408_100521443 3300031548 Bacteria 1044
100 Ga0307406_10125844 3300031901 Bacteria 1790
101 Ga0307409_100806081 3300031995 Bacteria 947
102 Ga0307416_100141663 3300032002 Bacteria 2187
103 Ga0307416_100252813 3300032002 Bacteria 1717
104 Ga0307416_100504919 3300032002 Bacteria 1274
105 Ga0307411_10103683 3300032005 Bacteria 2018
106 Ga0307415_100340488 3300032126 Bacteria 1258
107 Ga0307415_100356879 3300032126 Bacteria 1233
108 Ga0373946_0123628 3300035171 Bacteria 1184
109 Ga0395899_0203315 3300037312 Bacteria 1380
110 Ga0395900_0090967 3300037418 Bacteria 3136
111 Ga0395900_0222272 3300037418 Bacteria 1903
112 Ga0395898_0048692 3300037466 Bacteria 4155
113 Ga0395898_0195754 3300037466 Bacteria 1931
114 Ga0436364_0635799 3300037853 Bacteria 1407
115 Ga0436365_0083592 3300039437 Unclassified 2844
116 Ga0436360_0749346 3300039438 Unclassified 1520
117 Ga0439450_013383 3300042008 Bacteria 1647
118 Ga0439455_0021413 3300042012 Bacteria 1541
119 Ga0439460_0066084 3300042461 Bacteria 1112
120 Ga0466965_0062558 3300044683 Bacteria 1862
121 Ga0466961_0103945 3300044693 Unclassified 1789
122 Ga0466961_0193017 3300044693 Bacteria 1262
123 Ga0466963_0012912 3300044694 Bacteria 5118
124 Ga0466963_0013441 3300044694 Bacteria 5027
125 Ga0466963_0064025 3300044694 Bacteria 2462
126 Ga0466963_0217845 3300044694 Unclassified 1336
127 Ga0466963_0246128 3300044694 Bacteria 1254
128 Ga0466964_0022366 3300044706 Bacteria 2452
129 Ga0466971_0009632 3300044719 Bacteria 4217
130 Ga0466971_0101127 3300044719 Bacteria 1325
131 Ga0466968_0138906 3300044735 Archaea 1110
132 Ga0466970_0070457 3300044765 Bacteria 1880
133 Ga0466970_0244002 3300044765 Bacteria 1006
134 Ga0466957_0203896 3300044842 Bacteria 1300
135 Ga0466957_0325783 3300044842 Bacteria 1037
136 Ga0466960_0000102 3300044901 Bacteria 28180
137 Ga0466959_0018041 3300045049 Bacteria 5178
138 Ga0466959_0035310 3300045049 Bacteria 3699
139 Ga0466959_0048359 3300045049 Bacteria 3125
140 Ga0466959_0086392 3300045049 Bacteria 2257
141 Ga0466959_0216552 3300045049 Bacteria 1329
142 Ga0466958_0002091 3300045836 Bacteria 9888
143 Ga0466958_0012710 3300045836 Bacteria 4774
144 Ga0466958_0044794 3300045836 Unclassified 2667
145 Ga0466958_0048657 3300045836 Bacteria 2563
146 Ga0466967_0004051 3300045976 Bacteria 9776
147 Ga0466967_0017951 3300045976 Bacteria 5639
148 Ga0466967_0098912 3300045976 Bacteria 2664
149 Ga0466967_0281374 3300045976 Bacteria 1596
150 Ga0466967_0356255 3300045976 Bacteria 1417
151 Ga0466967_0398066 3300045976 Bacteria 1339
152 Ga0495650_0000012 3300046471 Bacteria 613144
153 Ga0495664_0000012 3300046477 Bacteria 226118
154 Ga0495599_0015117 3300046678 Bacteria 4785
155 Ga0495600_0059868 3300046809 Bacteria 2487
156 Ga0495676_0349717 3300047321 Bacteria 988
157 Ga0496101_0066312 3300048904 Bacteria 2633
158 Ga0496102_0000027 3300048905 Bacteria 225466
159 Ga0496102_0119960 3300048905 Bacteria 2456
160 Ga0496102_0139991 3300048905 Bacteria 2269
161 Ga0496103_0000155 3300048906 Bacteria 72091
162 Ga0496104_0083722 3300048907 Bacteria 3042
163 Ga0496105_0048972 3300048908 Bacteria 3488
164 Ga0496105_0155141 3300048908 Bacteria 1881
165 Ga0496105_0159234 3300048908 Bacteria 1854
166 Ga0496106_0093719 3300048909 Bacteria 2321
167 Ga0496106_0178238 3300048909 Bacteria 1687
168 Ga0496106_0197847 3300048909 Unclassified 1599
169 Ga0496107_0130422 3300048910 Bacteria 1856
170 Ga0496108_0000266 3300048911 Bacteria 44912
171 Ga0496108_0124307 3300048911 Bacteria 2214
172 Ga0496109_0001540 3300048912 Bacteria 19168
173 Ga0496109_0502933 3300048912 Bacteria 1144
174 Ga0496110_0031693 3300048913 Bacteria 4562
175 Ga0496111_0002660 3300048914 Bacteria 10835
176 Ga0496112_0004050 3300048915 Bacteria 12294
177 Ga0496112_0041326 3300048915 Bacteria 4511
178 Ga0496121_0001211 3300048924 Bacteria 44972
179 Ga0501031_0037996 3300049568 Bacteria 3142
180 Ga0501031_0225554 3300049568 Bacteria 1220
181 Ga0501032_0097957 3300049569 Bacteria 1943
182 Ga0501033_0035166 3300049570 Bacteria 3756
183 Ga0501033_0120671 3300049570 Bacteria 1903
184 Ga0501034_0165621 3300049571 Bacteria 2179
185 Ga0501034_0195063 3300049571 Bacteria 1985
186 Ga0501036_0029626 3300049572 Bacteria 4623
187 Ga0501037_0072248 3300049573 Bacteria 2509
188 Ga0501038_0081124 3300049574 Bacteria 2733
189 Ga0501038_0193012 3300049574 Bacteria 1638
190 Ga0501039_0087609 3300049575 Bacteria 2425
191 Ga0501040_0018154 3300049576 Bacteria 4672
192 Ga0501040_0094598 3300049576 Bacteria 2079
193 Ga0501042_0150258 3300049578 Bacteria 1679
194 Ga0501043_0005514 3300049579 Bacteria 10217
195 Ga0501046_0118076 3300049580 Bacteria 2020
196 Ga0501047_0246774 3300049581 Bacteria 1634
197 Ga0501048_0009165 3300049582 Bacteria 7441
198 Ga0501048_0124157 3300049582 Bacteria 1825
199 Ga0501048_0127031 3300049582 Bacteria 1803
200 Ga0501067_0022157 3300049583 Bacteria 3515
201 Ga0501068_0075969 3300049584 Bacteria 2055
202 Ga0501069_0012069 3300049585 Bacteria 4588
203 Ga0501070_0015963 3300049586 Bacteria 6311
204 Ga0501071_0109398 3300049587 Bacteria 2042
205 Ga0501072_0074294 3300049588 Bacteria 2688
206 Ga0501072_0408030 3300049588 Unclassified 1077
207 Ga0501073_0024504 3300049589 Bacteria 4332
208 Ga0501074_0071221 3300049590 Bacteria 2499
209 Ga0501076_0045797 3300049592 Bacteria 3454
210 Ga0501076_0253008 3300049592 Bacteria 1442
211 Ga0501079_0192248 3300049741 Bacteria 1593
212 Ga0501080_0084116 3300049742 Bacteria 2956
213 Ga0501083_0019729 3300049744 Bacteria 4693
214 Ga0501035_0073435 3300049822 Bacteria 3026
215 Ga0501035_0163003 3300049822 Bacteria 1929
216 Ga0501044_0099941 3300049823 Bacteria 2919
217 Ga0501044_0307265 3300049823 Bacteria 1513
218 nmdc:mga03683_4966_c1 3300050489 Bacteria 4451
219 nmdc:mga00v17_103_c1 3300050491 Bacteria 50353
220 nmdc:mga0yw44_21_c1 3300050492 Bacteria 68733
221 nmdc:mga0k408_213096_c1 3300050493 Bacteria 1153
222 nmdc:mga05p37_283695_c1 3300050507 Bacteria 1974
223 nmdc:mga05p37_306667_c1 3300050507 Bacteria 1883
224 nmdc:mga06r32_30232_c1 3300050510 Bacteria 5082
225 nmdc:mga06r32_780423_c1 3300050510 Bacteria 917
226 nmdc:mga08y16_83382_c1 3300050511 Bacteria 3331
227 Ga0495601_0033644 3300053077 Bacteria 3194
228 Ga0501084_0165530 3300054114 Bacteria 1866
229 Ga0501082_0143337 3300060353 Bacteria 2073
230 Ga0501082_0383582 3300060353 Unclassified 1226
231 Ga0501082_0425288 3300060353 Bacteria 1160
232 Ga0466962_0020445 3300061719 Bacteria 3181
233 Ga0466962_0025341 3300061719 Bacteria 2848
234 Ga0466962_0134672 3300061719 Bacteria 1195
235 Ga0530510_0105922 3300061734 Bacteria 2058
236 Ga0105243_10026016
237 JGI25406J46586_10007543
238 JGI25406J46586_10068862
239 JGI25407J50210_10000530
240 Ga0070658_10021770
241 Ga0070683_100017121
242 Ga0070683_100594588
243 Ga0070680_100000377
244 Ga0070660_100010370
245 Ga0070687_100079418
246 Ga0070661_100229539
247 Ga0070692_10014573
248 Ga0070674_100415283
249 Ga0070659_100013101
250 Ga0070659_100183242
251 Ga0070714_100021287
252 Ga0070714_100195238
253 Ga0070713_100095379
254 Ga0070700_100083815
255 Ga0070681_10007641
256 Ga0068867_100083323
257 Ga0070679_100001463
258 Ga0070679_100157300
259 Ga0070684_100006789
260 Ga0070686_100206933
261 Ga0070665_100000312
262 Ga0070665_100078720
263 Ga0068855_100156586
264 Ga0068854_100143088
265 Ga0068856_100161124
266 Ga0068856_100168965
267 Ga0068852_100029886
268 Ga0068852_100122188
269 Ga0068858_100091845
270 Ga0081538_10000035
271 Ga0081538_10000832
272 Ga0081538_10001175
273 Ga0081538_10023281
274 Ga0081538_10031897
275 Ga0081538_10037432
276 Ga0081539_10000369
277 Ga0081539_10010940
278 Ga0075365_10000038
279 Ga0075364_10000130
280 Ga0075362_10011723
281 Ga0075367_10065096
282 Ga0075366_10243572
283 Ga0075428_100011444
284 Ga0075428_100034195
285 Ga0075428_100195839
286 Ga0068865_100124405
287 Ga0075436_100027795
288 Ga0105240_10030536
289 Ga0111539_10044267
290 Ga0105245_10051690
291 Ga0105247_10040011
292 Ga0114129_10313641
293 Ga0105237_10124927
294 Ga0105238_10107507
295 Ga0105249_10314101
296 Ga0105249_10851609
297 Ga0105239_10862867
298 Ga0157371_10388315
299 Ga0157370_10007489
300 Ga0157372_10134678
301 Ga0157375_10280270
302 Ga0163163_10973125
303 Ga0157377_10191226
304 Ga0157379_10000652
305 Ga0206356_10958541
306 Ga0207656_10259726
307 Ga0207688_10069223
308 Ga0207705_10116658
309 Ga0207693_10132120
310 Ga0207660_10017274
311 Ga0207662_10018380
312 Ga0207657_10012750
313 Ga0207652_10002299
314 Ga0207652_10421395
315 Ga0207664_10028234
316 Ga0207690_10231167
317 Ga0207689_10297544
318 Ga0207661_10113441
319 Ga0207661_10313966
320 Ga0207712_10300468
321 Ga0207640_10262439
322 Ga0207677_10261880
323 Ga0207708_10020367
324 Ga0207708_10135360
325 Ga0207708_10336703
326 Ga0207676_10531367
327 Ga0207674_10285192
328 Ga0207698_10012036
329 Ga0207698_10153808
330 Ga0268266_10025556
331 Ga0268266_10033884
332 Ga0265338_10031711
333 Ga0307408_100201949
334 Ga0307408_100521443
335 Ga0307406_10125844
336 Ga0307409_100806081
337 Ga0307416_100141663
338 Ga0307416_100252813
339 Ga0307416_100504919
340 Ga0307411_10103683
341 Ga0307415_100340488
342 Ga0307415_100356879
343 Ga0373946_0123628
344 Ga0395899_0203315
345 Ga0395900_0090967
346 Ga0395900_0222272
347 Ga0395898_0048692
348 Ga0395898_0195754
349 Ga0436364_0635799
350 Ga0436365_0083592
351 Ga0436360_0749346
352 Ga0439450_013383
353 Ga0439455_0021413
354 Ga0439460_0066084
355 Ga0466965_0062558
356 Ga0466961_0103945
357 Ga0466961_0193017
358 Ga0466963_0012912
359 Ga0466963_0013441
360 Ga0466963_0064025
361 Ga0466963_0217845
362 Ga0466963_0246128
363 Ga0466964_0022366
364 Ga0466971_0009632
365 Ga0466971_0101127
366 Ga0466968_0138906
367 Ga0466970_0070457
368 Ga0466970_0244002
369 Ga0466957_0203896
370 Ga0466957_0325783
371 Ga0466960_0000102
372 Ga0466959_0018041
373 Ga0466959_0035310
374 Ga0466959_0048359
375 Ga0466959_0086392
376 Ga0466959_0216552
377 Ga0466958_0002091
378 Ga0466958_0012710
379 Ga0466958_0044794
380 Ga0466958_0048657
381 Ga0466967_0004051
382 Ga0466967_0017951
383 Ga0466967_0098912
384 Ga0466967_0281374
385 Ga0466967_0356255
386 Ga0466967_0398066
387 Ga0495650_0000012
388 Ga0495664_0000012
389 Ga0495599_0015117
390 Ga0495600_0059868
391 Ga0495676_0349717
392 Ga0496101_0066312
393 Ga0496102_0000027
394 Ga0496102_0119960
395 Ga0496102_0139991
396 Ga0496103_0000155
397 Ga0496104_0083722
398 Ga0496105_0048972
399 Ga0496105_0155141
400 Ga0496105_0159234
401 Ga0496106_0093719
402 Ga0496106_0178238
403 Ga0496106_0197847
404 Ga0496107_0130422
405 Ga0496108_0000266
406 Ga0496108_0124307
407 Ga0496109_0001540
408 Ga0496109_0502933
409 Ga0496110_0031693
410 Ga0496111_0002660
411 Ga0496112_0004050
412 Ga0496112_0041326
413 Ga0496121_0001211
414 Ga0501031_0037996
415 Ga0501031_0225554
416 Ga0501032_0097957
417 Ga0501033_0035166
418 Ga0501033_0120671
419 Ga0501034_0165621
420 Ga0501034_0195063
421 Ga0501036_0029626
422 Ga0501037_0072248
423 Ga0501038_0081124
424 Ga0501038_0193012
425 Ga0501039_0087609
426 Ga0501040_0018154
427 Ga0501040_0094598
428 Ga0501042_0150258
429 Ga0501043_0005514
430 Ga0501046_0118076
431 Ga0501047_0246774
432 Ga0501048_0009165
433 Ga0501048_0124157
434 Ga0501048_0127031
435 Ga0501067_0022157
436 Ga0501068_0075969
437 Ga0501069_0012069
438 Ga0501070_0015963
439 Ga0501071_0109398
440 Ga0501072_0074294
441 Ga0501072_0408030
442 Ga0501073_0024504
443 Ga0501074_0071221
444 Ga0501076_0045797
445 Ga0501076_0253008
446 Ga0501079_0192248
447 Ga0501080_0084116
448 Ga0501083_0019729
449 Ga0501035_0073435
450 Ga0501035_0163003
451 Ga0501044_0099941
452 Ga0501044_0307265
453 nmdc:mga03683_4966_c1
454 nmdc:mga00v17_103_c1
455 nmdc:mga0yw44_21_c1
456 nmdc:mga0k408_213096_c1
457 nmdc:mga05p37_283695_c1
458 nmdc:mga05p37_306667_c1
459 nmdc:mga06r32_30232_c1
460 nmdc:mga06r32_780423_c1
461 nmdc:mga08y16_83382_c1
462 Ga0495601_0033644
463 Ga0501084_0165530
464 Ga0501082_0143337
465 Ga0501082_0383582
466 Ga0501082_0425288
467 Ga0466962_0020445
468 Ga0466962_0025341
469 Ga0466962_0134672
470 Ga0530510_0105922

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02735

Ku

Ku70/Ku80 beta-barrel domain

11

193

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kxf-assembly1.cif.gz_A crystal structure of the spoc domain of the arabidopsis flowering regulator fpa 0.6753 85 175
2x8t-assembly1.cif.gz_A crystal structure of the abn2 h318a mutant 0.671 138 168
2x8s-assembly2.cif.gz_B crystal structure of the abn2 d171a mutant in complex with arabinotriose 0.6698 138 168
2x8f-assembly2.cif.gz_B native structure of endo-1,5-alpha-l-arabinanases from bacillus subtilis 0.6615 138 166
3x37-assembly1.cif.gz_B crystal structure of the n-terminal domain of sld7 in complex with sld3 0.6512 91 168
ID Description Score Start End Superfamily
af_Q58543_201_249_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.8009 62 82 2.30.30.60
af_A4IG29_244_418_2.40.290.10 Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; 0.761 85 184 2.40.290.10
af_P32807_339_451_2.40.290.10 Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; 0.7319 73 169 2.40.290.10
af_Q8TC57_257_413_2.40.290.10 Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; 0.7294 78 183 2.40.290.10
af_D3ZVK0_237_416_2.40.290.10 Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; 0.7177 78 183 2.40.290.10
ID Description Score Start End GO Terms
AF-A0A536VMD1-F1-model_v4 Ku protein 0.8777 90 208 GO:0003690
GO:0006303
AF-A0A2W6DZP3-F1-model_v4 Ku protein 0.8761 95 260 GO:0003690
GO:0006303
GO:0006310
AF-A0A5S9M9T1-F1-model_v4 Ku domain-containing protein 0.871 88 191 GO:0003690
GO:0006303
AF-A0A536VMD1-F1-model_v4 Ku protein 0.8708 90 208 GO:0003690
GO:0006303
AF-A0A7Y8HTZ8-F1-model_v4 Ku domain-containing protein 0.8677 75 260 GO:0003690
GO:0006303

Map