F347964

General Info

Members Datasets Scaffolds Average Seq Length
235 156 470 131

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10028007|Ga0081455_100280076
Length 147
Sequence VWLLMIKEGEMSSDSNSKKWIGISIAPMLSVRNGARAVEFYKTAFGAHEVYRMEDPGGAVVSRLSVEGAEFWVSDESPEHANFSPESLGGSTVRIILVVPDPDVMFAQAIATGAKEVYAVEEAYGWRLGRVVDPFGHHWEIGHPLPT

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
100 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
103 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
104 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
105 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
108 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
120 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
153 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
154 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
155 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
156 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.28
Nodule 0
Rhizoplane 1.7
Rhizosphere 95.74
Stem 0
Stem Tuber 0
Unclassified 28.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10028007 3300005937 Bacteria 5153
2 Ga0065704_10560277 3300005289 Unclassified 629
3 Ga0070676_10411404 3300005328 Unclassified 943
4 Ga0070675_101667487 3300005354 Unclassified 588
5 Ga0070671_100092404 3300005355 Bacteria 2535
6 Ga0070671_100233583 3300005355 Bacteria 1561
7 Ga0070674_100159981 3300005356 Bacteria 1708
8 Ga0070674_101401893 3300005356 Unclassified 626
9 Ga0070667_100069623 3300005367 Bacteria 2995
10 Ga0070709_10150441 3300005434 Bacteria 1608
11 Ga0070714_100038833 3300005435 Bacteria 4005
12 Ga0070713_100000109 3300005436 Bacteria 53750
13 Ga0070713_100616036 3300005436 Bacteria 1032
14 Ga0070713_100892663 3300005436 Bacteria 855
15 Ga0070710_10296873 3300005437 Bacteria 1053
16 Ga0070710_10384417 3300005437 Unclassified 937
17 Ga0070711_100010396 3300005439 Bacteria 5757
18 Ga0070711_100529497 3300005439 Bacteria 975
19 Ga0070711_100568061 3300005439 Bacteria 943
20 Ga0070705_100101054 3300005440 Unclassified 1821
21 Ga0070708_100001890 3300005445 Bacteria 16085
22 Ga0070708_100031590 3300005445 Bacteria 4585
23 Ga0070708_100241170 3300005445 Bacteria 1697
24 Ga0070678_100938048 3300005456 Unclassified 793
25 Ga0070662_100082206 3300005457 Bacteria 2402
26 Ga0068867_101674416 3300005459 Bacteria 596
27 Ga0070706_100001585 3300005467 Bacteria 23707
28 Ga0070706_100032681 3300005467 Unclassified 4800
29 Ga0070706_100266512 3300005467 Unclassified 1599
30 Ga0070706_100596254 3300005467 Bacteria 1027
31 Ga0070707_100020107 3300005468 Bacteria 6296
32 Ga0070698_100000547 3300005471 Bacteria 40166
33 Ga0070698_100333776 3300005471 Unclassified 1447
34 Ga0070699_100009092 3300005518 Bacteria 8614
35 Ga0070699_100230352 3300005518 Unclassified 1652
36 Ga0070697_100002461 3300005536 Bacteria 14253
37 Ga0070697_100281299 3300005536 Bacteria 1427
38 Ga0070697_100567820 3300005536 Viruses 996
39 Ga0070686_100611549 3300005544 Bacteria 860
40 Ga0070696_100159763 3300005546 Bacteria 1660
41 Ga0070693_100126976 3300005547 Unclassified 1589
42 Ga0070704_100516430 3300005549 Bacteria 1039
43 Ga0070704_101521157 3300005549 Unclassified 616
44 Ga0068854_100168765 3300005578 Bacteria 1701
45 Ga0070702_100148244 3300005615 Bacteria 1503
46 Ga0068859_102385616 3300005617 Unclassified 583
47 Ga0068864_100681074 3300005618 Bacteria 1003
48 Ga0068861_100528093 3300005719 Bacteria 1071
49 Ga0068861_102081988 3300005719 Bacteria 567
50 Ga0068870_10091177 3300005840 Bacteria 1704
51 Ga0068870_11078717 3300005840 Bacteria 576
52 Ga0068863_100001067 3300005841 Bacteria 27391
53 Ga0068863_101430095 3300005841 Unclassified 699
54 Ga0068863_101530664 3300005841 Bacteria 676
55 Ga0068858_100210545 3300005842 Bacteria 1840
56 Ga0068860_100051370 3300005843 Bacteria 3923
57 Ga0068860_100738054 3300005843 Unclassified 996
58 Ga0081539_10102041 3300005985 Bacteria 1460
59 Ga0070717_10008078 3300006028 Bacteria 7847
60 Ga0070715_10162138 3300006163 Bacteria 1106
61 Ga0070716_100024874 3300006173 Unclassified 3188
62 Ga0070716_100636863 3300006173 Bacteria 807
63 Ga0070712_100085965 3300006175 Bacteria 2291
64 Ga0070712_100665680 3300006175 Unclassified 885
65 Ga0097621_100010480 3300006237 Bacteria 6787
66 Ga0075428_100212167 3300006844 Bacteria 2092
67 Ga0075431_100028913 3300006847 Bacteria 5700
68 Ga0075433_10011793 3300006852 Bacteria 7040
69 Ga0075433_10157861 3300006852 Bacteria 2018
70 Ga0075434_100019088 3300006871 Bacteria 6626
71 Ga0075434_100040544 3300006871 Bacteria 4611
72 Ga0075434_100126088 3300006871 Unclassified 2577
73 Ga0075429_100005158 3300006880 Bacteria 11238
74 Ga0075429_100180993 3300006880 Bacteria 1847
75 Ga0068865_100132232 3300006881 Bacteria 1871
76 Ga0068865_101277818 3300006881 Unclassified 652
77 Ga0075436_100041169 3300006914 Bacteria 3187
78 Ga0097620_100140166 3300006931 Bacteria 2492
79 Ga0097620_101868670 3300006931 Unclassified 663
80 Ga0097620_102384637 3300006931 Unclassified 583
81 Ga0075435_100128170 3300007076 Bacteria 2122
82 Ga0099794_10024517 3300007265 Bacteria 2770
83 Ga0105245_10089072 3300009098 Bacteria 2836
84 Ga0105245_12989120 3300009098 Bacteria 524
85 Ga0105247_10587017 3300009101 Bacteria 824
86 Ga0114129_10057917 3300009147 Bacteria 5421
87 Ga0114129_10592922 3300009147 Bacteria 1437
88 Ga0114129_10713966 3300009147 Bacteria 1287
89 Ga0114129_12061055 3300009147 Unclassified 689
90 Ga0105241_10471511 3300009174 Bacteria 1114
91 Ga0105248_10041343 3300009177 Bacteria 5168
92 Ga0105248_10171870 3300009177 Unclassified 2442
93 Ga0105248_11451364 3300009177 Bacteria 776
94 Ga0105237_11884219 3300009545 Unclassified 606
95 Ga0105249_10000156 3300009553 Bacteria 83676
96 Ga0105249_11053586 3300009553 Unclassified 883
97 Ga0099796_10189687 3300010159 Unclassified 829
98 Ga0105246_11257880 3300011119 Unclassified 684
99 Ga0157374_10423752 3300013296 Bacteria 1330
100 Ga0157374_10823609 3300013296 Unclassified 944
101 Ga0157374_12313553 3300013296 Unclassified 565
102 Ga0157378_12652482 3300013297 Unclassified 553
103 Ga0157378_12727188 3300013297 Bacteria 547
104 Ga0163162_10000009 3300013306 Bacteria 316099
105 Ga0163162_10330725 3300013306 Bacteria 1656
106 Ga0163162_10343865 3300013306 Bacteria 1624
107 Ga0163162_11079633 3300013306 Unclassified 909
108 Ga0157375_10395288 3300013308 Bacteria 1549
109 Ga0157375_10718258 3300013308 Bacteria 1152
110 Ga0157375_11077333 3300013308 Unclassified 940
111 Ga0157375_13083729 3300013308 Unclassified 556
112 Ga0163163_10314778 3300014325 Bacteria 1619
113 Ga0163163_11447058 3300014325 Unclassified 749
114 Ga0157379_10011039 3300014968 Bacteria 7872
115 Ga0157376_10347859 3300014969 Bacteria 1418
116 Ga0157376_11017862 3300014969 Bacteria 851
117 Ga0157376_11601744 3300014969 Unclassified 685
118 Ga0207692_10087343 3300025898 Bacteria 1683
119 Ga0207685_10226520 3300025905 Bacteria 892
120 Ga0207699_10044570 3300025906 Bacteria 2583
121 Ga0207699_10063152 3300025906 Bacteria 2236
122 Ga0207699_10572175 3300025906 Unclassified 821
123 Ga0207684_10003969 3300025910 Bacteria 14166
124 Ga0207684_10059986 3300025910 Bacteria 3231
125 Ga0207684_10291423 3300025910 Unclassified 1407
126 Ga0207684_10659538 3300025910 Bacteria 891
127 Ga0207693_10000022 3300025915 Bacteria 127887
128 Ga0207663_10001153 3300025916 Bacteria 12196
129 Ga0207663_10438938 3300025916 Bacteria 1005
130 Ga0207663_10451374 3300025916 Bacteria 992
131 Ga0207646_10000880 3300025922 Bacteria 38839
132 Ga0207646_10476749 3300025922 Bacteria 1125
133 Ga0207700_10003171 3300025928 Bacteria 9493
134 Ga0207700_10694838 3300025928 Bacteria 908
135 Ga0207664_10000095 3300025929 Bacteria 81655
136 Ga0207664_10172208 3300025929 Bacteria 1853
137 Ga0207644_10229445 3300025931 Bacteria 1475
138 Ga0207644_10331950 3300025931 Unclassified 1232
139 Ga0207706_10094226 3300025933 Bacteria 2634
140 Ga0207686_11038483 3300025934 Unclassified 666
141 Ga0207669_11756133 3300025937 Unclassified 530
142 Ga0207704_10856008 3300025938 Bacteria 762
143 Ga0207665_10004286 3300025939 Bacteria 9480
144 Ga0207665_10616440 3300025939 Bacteria 848
145 Ga0207711_10055360 3300025941 Bacteria 3405
146 Ga0207689_11381118 3300025942 Unclassified 591
147 Ga0207651_10110915 3300025960 Bacteria 2059
148 Ga0207712_10000123 3300025961 Bacteria 83597
149 Ga0207640_10252874 3300025981 Bacteria 1369
150 Ga0207677_10256893 3300026023 Unclassified 1422
151 Ga0207703_10658581 3300026035 Unclassified 994
152 Ga0207639_11548761 3300026041 Unclassified 622
153 Ga0207678_10513575 3300026067 Bacteria 1045
154 Ga0207641_10001367 3300026088 Bacteria 24146
155 Ga0207641_10592507 3300026088 Bacteria 1085
156 Ga0207648_10046580 3300026089 Bacteria 3802
157 Ga0207648_10710436 3300026089 Bacteria 932
158 Ga0207675_100980942 3300026118 Bacteria 863
159 Ga0268266_10214986 3300028379 Archaea 1765
160 Ga0268264_10203702 3300028381 Bacteria 1812
161 Ga0265325_10004199 3300031241 Bacteria 9150
162 Ga0307416_101551970 3300032002 Bacteria 768
163 Ga0373934_0143156 3300035086 Bacteria 978
164 Ga0373923_0011629 3300035111 Bacteria 3235
165 Ga0373923_0208826 3300035111 Unclassified 905
166 Ga0373936_0004173 3300035113 Bacteria 5445
167 Ga0373945_0350445 3300035116 Bacteria 640
168 Ga0373953_0180192 3300035117 Bacteria 911
169 Ga0373954_0078722 3300035118 Bacteria 1573
170 Ga0373956_0122841 3300035119 Bacteria 1213
171 Ga0373943_0000310 3300035170 Bacteria 20382
172 Ga0373962_0275909 3300035242 Unclassified 590
173 Ga0373924_0076584 3300035410 Bacteria 1417
174 Ga0373931_0584407 3300035691 Bacteria 729
175 Ga0373935_0001677 3300035692 Bacteria 12377
176 Ga0373927_0000636 3300035695 Bacteria 26603
177 Ga0373927_0072321 3300035695 Bacteria 2231
178 Ga0373933_0615263 3300035724 Unclassified 713
179 Ga0373933_1043941 3300035724 Bacteria 538
180 Ga0373947_0000267 3300035725 Bacteria 29577
181 Ga0373925_0002560 3300037068 Bacteria 14484
182 Ga0373925_0009581 3300037068 Bacteria 7057
183 Ga0373925_1202747 3300037068 Unclassified 623
184 Ga0395900_1691176 3300037418 Unclassified 544
185 Ga0395905_0379249 3300037471 Unclassified 1308
186 Ga0395901_0531134 3300038443 Bacteria 1194
187 Ga0436363_0491206 3300039450 Bacteria 933
188 Ga0436363_1240071 3300039450 Unclassified 506
189 Ga0451853_0944924 3300041512 Unclassified 798
190 Ga0453683_0159708 3300044673 Bacteria 1426
191 Ga0451576_1163879 3300045051 Bacteria 806
192 Ga0495629_0121787 3300046459 Bacteria 1817
193 Ga0495653_0287091 3300046463 Bacteria 1078
194 Ga0495580_0023093 3300046472 Unclassified 4572
195 Ga0495580_0078525 3300046472 Bacteria 2302
196 Ga0495582_0000131 3300046473 Bacteria 40163
197 Ga0495582_0092962 3300046473 Bacteria 1683
198 Ga0495594_0014482 3300046499 Bacteria 4134
199 Ga0495628_0053295 3300046516 Bacteria 3193
200 Ga0495630_0589833 3300046517 Unclassified 852
201 Ga0495665_0241922 3300046531 Unclassified 930
202 Ga0495665_0473685 3300046531 Unclassified 632
203 Ga0495622_0393899 3300046557 Unclassified 597
204 Ga0495599_0293382 3300046678 Bacteria 983
205 Ga0495646_0418567 3300046680 Bacteria 695
206 Ga0495646_0466303 3300046680 Unclassified 651
207 Ga0495647_0191309 3300046681 Unclassified 894
208 Ga0495647_0246754 3300046681 Bacteria 794
209 Ga0495669_0271554 3300046684 Unclassified 815
210 Ga0495613_0525222 3300046689 Bacteria 795
211 Ga0495624_0053307 3300046690 Bacteria 2554
212 Ga0495674_0011431 3300047319 Bacteria 8376
213 Ga0495674_0755802 3300047319 Unclassified 759
214 Ga0495676_0274225 3300047321 Bacteria 1144
215 Ga0495675_0670657 3300047444 Bacteria 583
216 Ga0495684_0081237 3300047471 Bacteria 2460
217 Ga0495602_0154432 3300048088 Bacteria 1799
218 Ga0496104_0109249 3300048907 Bacteria 2651
219 Ga0496105_0708109 3300048908 Unclassified 772
220 Ga0496114_0648068 3300048917 Unclassified 929
221 Ga0496115_0002322 3300048918 Bacteria 13623
222 nmdc:mga05p37_567954_c1 3300050507 Bacteria 1287
223 nmdc:mga05p37_78293_c1 3300050507 Bacteria 4070
224 nmdc:mga09592_928888_c1 3300050508 Unclassified 730
225 nmdc:mga06r32_141777_c1 3300050510 Bacteria 2380
226 nmdc:mga0n895_166944_c1 3300050512 Bacteria 2233
227 nmdc:mga0n895_917299_c1 3300050512 Unclassified 861
228 nmdc:mga08x19_39116_c1 3300050514 Bacteria 3015
229 nmdc:mga0a205_29873_c1 3300050515 Bacteria 5216
230 nmdc:mga0a205_53063_c2 3300050515 Bacteria 3532
231 Ga0495601_0016574 3300053077 Unclassified 4466
232 Ga0495612_0430618 3300053078 Bacteria 601
233 Ga0500555_001276 3300053103 Bacteria 8048
234 Ga0500617_216607 3300053124 Unclassified 685
235 Ga0500616_0000167 3300053153 Bacteria 109823
236 Ga0081455_10028007
237 Ga0065704_10560277
238 Ga0070676_10411404
239 Ga0070675_101667487
240 Ga0070671_100092404
241 Ga0070671_100233583
242 Ga0070674_100159981
243 Ga0070674_101401893
244 Ga0070667_100069623
245 Ga0070709_10150441
246 Ga0070714_100038833
247 Ga0070713_100000109
248 Ga0070713_100616036
249 Ga0070713_100892663
250 Ga0070710_10296873
251 Ga0070710_10384417
252 Ga0070711_100010396
253 Ga0070711_100529497
254 Ga0070711_100568061
255 Ga0070705_100101054
256 Ga0070708_100001890
257 Ga0070708_100031590
258 Ga0070708_100241170
259 Ga0070678_100938048
260 Ga0070662_100082206
261 Ga0068867_101674416
262 Ga0070706_100001585
263 Ga0070706_100032681
264 Ga0070706_100266512
265 Ga0070706_100596254
266 Ga0070707_100020107
267 Ga0070698_100000547
268 Ga0070698_100333776
269 Ga0070699_100009092
270 Ga0070699_100230352
271 Ga0070697_100002461
272 Ga0070697_100281299
273 Ga0070697_100567820
274 Ga0070686_100611549
275 Ga0070696_100159763
276 Ga0070693_100126976
277 Ga0070704_100516430
278 Ga0070704_101521157
279 Ga0068854_100168765
280 Ga0070702_100148244
281 Ga0068859_102385616
282 Ga0068864_100681074
283 Ga0068861_100528093
284 Ga0068861_102081988
285 Ga0068870_10091177
286 Ga0068870_11078717
287 Ga0068863_100001067
288 Ga0068863_101430095
289 Ga0068863_101530664
290 Ga0068858_100210545
291 Ga0068860_100051370
292 Ga0068860_100738054
293 Ga0081539_10102041
294 Ga0070717_10008078
295 Ga0070715_10162138
296 Ga0070716_100024874
297 Ga0070716_100636863
298 Ga0070712_100085965
299 Ga0070712_100665680
300 Ga0097621_100010480
301 Ga0075428_100212167
302 Ga0075431_100028913
303 Ga0075433_10011793
304 Ga0075433_10157861
305 Ga0075434_100019088
306 Ga0075434_100040544
307 Ga0075434_100126088
308 Ga0075429_100005158
309 Ga0075429_100180993
310 Ga0068865_100132232
311 Ga0068865_101277818
312 Ga0075436_100041169
313 Ga0097620_100140166
314 Ga0097620_101868670
315 Ga0097620_102384637
316 Ga0075435_100128170
317 Ga0099794_10024517
318 Ga0105245_10089072
319 Ga0105245_12989120
320 Ga0105247_10587017
321 Ga0114129_10057917
322 Ga0114129_10592922
323 Ga0114129_10713966
324 Ga0114129_12061055
325 Ga0105241_10471511
326 Ga0105248_10041343
327 Ga0105248_10171870
328 Ga0105248_11451364
329 Ga0105237_11884219
330 Ga0105249_10000156
331 Ga0105249_11053586
332 Ga0099796_10189687
333 Ga0105246_11257880
334 Ga0157374_10423752
335 Ga0157374_10823609
336 Ga0157374_12313553
337 Ga0157378_12652482
338 Ga0157378_12727188
339 Ga0163162_10000009
340 Ga0163162_10330725
341 Ga0163162_10343865
342 Ga0163162_11079633
343 Ga0157375_10395288
344 Ga0157375_10718258
345 Ga0157375_11077333
346 Ga0157375_13083729
347 Ga0163163_10314778
348 Ga0163163_11447058
349 Ga0157379_10011039
350 Ga0157376_10347859
351 Ga0157376_11017862
352 Ga0157376_11601744
353 Ga0207692_10087343
354 Ga0207685_10226520
355 Ga0207699_10044570
356 Ga0207699_10063152
357 Ga0207699_10572175
358 Ga0207684_10003969
359 Ga0207684_10059986
360 Ga0207684_10291423
361 Ga0207684_10659538
362 Ga0207693_10000022
363 Ga0207663_10001153
364 Ga0207663_10438938
365 Ga0207663_10451374
366 Ga0207646_10000880
367 Ga0207646_10476749
368 Ga0207700_10003171
369 Ga0207700_10694838
370 Ga0207664_10000095
371 Ga0207664_10172208
372 Ga0207644_10229445
373 Ga0207644_10331950
374 Ga0207706_10094226
375 Ga0207686_11038483
376 Ga0207669_11756133
377 Ga0207704_10856008
378 Ga0207665_10004286
379 Ga0207665_10616440
380 Ga0207711_10055360
381 Ga0207689_11381118
382 Ga0207651_10110915
383 Ga0207712_10000123
384 Ga0207640_10252874
385 Ga0207677_10256893
386 Ga0207703_10658581
387 Ga0207639_11548761
388 Ga0207678_10513575
389 Ga0207641_10001367
390 Ga0207641_10592507
391 Ga0207648_10046580
392 Ga0207648_10710436
393 Ga0207675_100980942
394 Ga0268266_10214986
395 Ga0268264_10203702
396 Ga0265325_10004199
397 Ga0307416_101551970
398 Ga0373934_0143156
399 Ga0373923_0011629
400 Ga0373923_0208826
401 Ga0373936_0004173
402 Ga0373945_0350445
403 Ga0373953_0180192
404 Ga0373954_0078722
405 Ga0373956_0122841
406 Ga0373943_0000310
407 Ga0373962_0275909
408 Ga0373924_0076584
409 Ga0373931_0584407
410 Ga0373935_0001677
411 Ga0373927_0000636
412 Ga0373927_0072321
413 Ga0373933_0615263
414 Ga0373933_1043941
415 Ga0373947_0000267
416 Ga0373925_0002560
417 Ga0373925_0009581
418 Ga0373925_1202747
419 Ga0395900_1691176
420 Ga0395905_0379249
421 Ga0395901_0531134
422 Ga0436363_0491206
423 Ga0436363_1240071
424 Ga0451853_0944924
425 Ga0453683_0159708
426 Ga0451576_1163879
427 Ga0495629_0121787
428 Ga0495653_0287091
429 Ga0495580_0023093
430 Ga0495580_0078525
431 Ga0495582_0000131
432 Ga0495582_0092962
433 Ga0495594_0014482
434 Ga0495628_0053295
435 Ga0495630_0589833
436 Ga0495665_0241922
437 Ga0495665_0473685
438 Ga0495622_0393899
439 Ga0495599_0293382
440 Ga0495646_0418567
441 Ga0495646_0466303
442 Ga0495647_0191309
443 Ga0495647_0246754
444 Ga0495669_0271554
445 Ga0495613_0525222
446 Ga0495624_0053307
447 Ga0495674_0011431
448 Ga0495674_0755802
449 Ga0495676_0274225
450 Ga0495675_0670657
451 Ga0495684_0081237
452 Ga0495602_0154432
453 Ga0496104_0109249
454 Ga0496105_0708109
455 Ga0496114_0648068
456 Ga0496115_0002322
457 nmdc:mga05p37_567954_c1
458 nmdc:mga05p37_78293_c1
459 nmdc:mga09592_928888_c1
460 nmdc:mga06r32_141777_c1
461 nmdc:mga0n895_166944_c1
462 nmdc:mga0n895_917299_c1
463 nmdc:mga08x19_39116_c1
464 nmdc:mga0a205_29873_c1
465 nmdc:mga0a205_53063_c2
466 Ga0495601_0016574
467 Ga0495612_0430618
468 Ga0500555_001276
469 Ga0500617_216607
470 Ga0500616_0000167

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

27

142

0.77

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

24

141

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.8043 1 123
2p7p-assembly4.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and sulfate ion 0.795 1 125
2i7r-assembly1.cif.gz_B conserved domain protein 0.7938 3 124
2zw7-assembly1.cif.gz_B crystal structure of bleomycin n-acetyltransferase complexed with bleomycin a2 and coenzyme a 0.7913 1 125
2p7l-assembly4.cif.gz_A crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 5.75 0.7863 1 125
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9092 73 127 3.30.720.110
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8848 73 126 3.30.720.110
af_I1N1R1_19_162_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8485 1 127 3.10.180.10
af_I1N1R1_19_162_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8424 1 127 3.10.180.10
3itwB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8347 3 57 3.30.720.120
ID Description Score Start End GO Terms
AF-A0A538P7X4-F1-model_v4 VOC family protein 0.9933 1 127
AF-A0A428MQV9-F1-model_v4 PhnB protein 0.9884 1 127
AF-A0A2V7LW48-F1-model_v4 Glyoxalase 0.9868 1 126
AF-A0A1Q7MZY8-F1-model_v4 Glyoxalase 0.986 2 127
AF-A0A538P7X4-F1-model_v4 VOC family protein 0.9856 1 127

Map