F347917

General Info

Members Datasets Scaffolds Average Seq Length
235 172 470 221

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100129474|Ga0070699_1001294742
Length 252
Sequence MTQRRRPRDDPSRLCGIQPKSSGRRRGGADMIDRIADGRTDLVFDYLGEGHLATSKDRNGTSLIEWCAYYGDVSAIKFLLANGESLQPLRDNLGLNAAAFHGHWRLCQFLIENGADVNLPLPDTGEMPLHAALSSARPAQNLVARVLLAKGADPNRTTKPSVETGAFMRDCRTRSETPLHRAAAFGNEDTIQLLLDAGARVDAKDMNGDSPLTWASWFQRPDSILRKLCYGQFSIHPERRSMDAYLQGQPHA

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
118 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
126 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
127 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
128 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
136 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
162 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
163 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
164 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
165 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 0.85
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.26
Nodule 0
Rhizoplane 2.13
Rhizosphere 91.91
Stem 0
Stem Tuber 0
Unclassified 30.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100129474 3300005518 Bacteria 2224
2 rootH2_10131290 3300003320 Bacteria 3835
3 Ga0058862_10234462 3300004803 Unclassified 1114
4 Ga0065715_10349817 3300005293 Bacteria 953
5 Ga0070690_100031032 3300005330 Bacteria 3326
6 Ga0070670_100044436 3300005331 Bacteria 3820
7 Ga0068869_100049900 3300005334 Bacteria 3031
8 Ga0070666_10019744 3300005335 Bacteria 4354
9 Ga0070680_100446262 3300005336 Unclassified 1105
10 Ga0068868_100010981 3300005338 Bacteria 6579
11 Ga0070689_100299169 3300005340 Bacteria 1339
12 Ga0070689_100520293 3300005340 Bacteria 1021
13 Ga0070687_100027902 3300005343 Bacteria 2732
14 Ga0070669_100000152 3300005353 Bacteria 62555
15 Ga0070675_100709334 3300005354 Unclassified 916
16 Ga0070675_100768068 3300005354 Unclassified 880
17 Ga0070671_100031950 3300005355 Bacteria 4351
18 Ga0070671_100425926 3300005355 Bacteria 1137
19 Ga0070674_100057052 3300005356 Bacteria 2710
20 Ga0070673_100017792 3300005364 Bacteria 5064
21 Ga0070673_100341897 3300005364 Unclassified 1326
22 Ga0070667_100013943 3300005367 Bacteria 6644
23 Ga0070713_100192591 3300005436 Unclassified 1838
24 Ga0070711_100346212 3300005439 Unclassified 1194
25 Ga0070711_100694499 3300005439 Unclassified 856
26 Ga0070708_100003098 3300005445 Bacteria 12934
27 Ga0070708_100502778 3300005445 Bacteria 1143
28 Ga0070663_100093528 3300005455 Unclassified 2231
29 Ga0068867_100125859 3300005459 Bacteria 1986
30 Ga0068867_100332834 3300005459 Bacteria 1262
31 Ga0070706_100188798 3300005467 Bacteria 1926
32 Ga0070707_100405992 3300005468 Unclassified 1322
33 Ga0070698_100037013 3300005471 Bacteria 5033
34 Ga0070679_100517426 3300005530 Bacteria 1137
35 Ga0070684_100347915 3300005535 Bacteria 1363
36 Ga0068853_100268605 3300005539 Bacteria 1570
37 Ga0070672_100031781 3300005543 Bacteria 3977
38 Ga0070686_100058590 3300005544 Bacteria 2478
39 Ga0070686_100212186 3300005544 Unclassified 1394
40 Ga0070696_100071513 3300005546 Unclassified 2441
41 Ga0070665_100267962 3300005548 Unclassified 1709
42 Ga0070665_100341523 3300005548 Unclassified 1502
43 Ga0070704_100510746 3300005549 Bacteria 1044
44 Ga0070664_100006186 3300005564 Bacteria 9673
45 Ga0070702_100026711 3300005615 Bacteria 3105
46 Ga0068859_100080483 3300005617 Bacteria 3298
47 Ga0068859_100245211 3300005617 Unclassified 1881
48 Ga0068859_100877842 3300005617 Bacteria 982
49 Ga0068864_100012642 3300005618 Bacteria 6979
50 Ga0068866_10134760 3300005718 Bacteria 1410
51 Ga0068861_100546911 3300005719 Unclassified 1054
52 Ga0068863_100030972 3300005841 Bacteria 5108
53 Ga0068858_100185371 3300005842 Unclassified 1966
54 Ga0068860_101087756 3300005843 Unclassified 819
55 Ga0068862_100178915 3300005844 Bacteria 1902
56 Ga0068862_100338828 3300005844 Bacteria 1392
57 Ga0081455_10155145 3300005937 Bacteria 1761
58 Ga0081539_10057052 3300005985 Bacteria 2163
59 Ga0070717_10379765 3300006028 Bacteria 1267
60 Ga0070717_10529780 3300006028 Unclassified 1066
61 Ga0075368_10010187 3300006042 Bacteria 3396
62 Ga0070716_100001205 3300006173 Bacteria 11383
63 Ga0070712_100002076 3300006175 Bacteria 12293
64 Ga0075362_10016856 3300006177 Unclassified 3000
65 Ga0075367_10005977 3300006178 Bacteria 6114
66 Ga0075366_10022761 3300006195 Bacteria 3648
67 Ga0097621_100002494 3300006237 Bacteria 12610
68 Ga0097621_100035410 3300006237 Bacteria 3989
69 Ga0068871_100005777 3300006358 Bacteria 8692
70 Ga0068871_100037207 3300006358 Bacteria 3880
71 Ga0075428_100003518 3300006844 Bacteria 17164
72 Ga0075428_100007176 3300006844 Bacteria 12338
73 Ga0075433_10815278 3300006852 Unclassified 815
74 Ga0075434_100092687 3300006871 Bacteria 3024
75 Ga0075434_100157828 3300006871 Bacteria 2288
76 Ga0075429_100021518 3300006880 Bacteria 5590
77 Ga0068865_100002361 3300006881 Bacteria 11141
78 Ga0068865_100016296 3300006881 Bacteria 4753
79 Ga0097620_100080485 3300006931 Bacteria 3298
80 Ga0097620_100245198 3300006931 Unclassified 1881
81 Ga0097620_100877635 3300006931 Bacteria 982
82 Ga0075435_100245051 3300007076 Unclassified 1525
83 Ga0099794_10019934 3300007265 Bacteria 3029
84 Ga0111539_10000849 3300009094 Bacteria 39823
85 Ga0111539_10001012 3300009094 Bacteria 36834
86 Ga0105245_10289099 3300009098 Bacteria 1605
87 Ga0114129_10075620 3300009147 Bacteria 4689
88 Ga0114129_10818111 3300009147 Bacteria 1187
89 Ga0105242_10020996 3300009176 Bacteria 5122
90 Ga0105248_10008448 3300009177 Bacteria 11298
91 Ga0105248_10009095 3300009177 Bacteria 10926
92 Ga0105248_10022392 3300009177 Bacteria 7009
93 Ga0105248_10148344 3300009177 Unclassified 2646
94 Ga0105248_10193307 3300009177 Bacteria 2293
95 Ga0105249_10104395 3300009553 Unclassified 2671
96 Ga0105249_10241851 3300009553 Bacteria 1785
97 Ga0105239_10125597 3300010375 Unclassified 2851
98 Ga0105239_11345202 3300010375 Bacteria 824
99 Ga0157378_10000309 3300013297 Bacteria 47634
100 Ga0163162_10061234 3300013306 Bacteria 3801
101 Ga0163162_10142525 3300013306 Bacteria 2511
102 Ga0163162_10151987 3300013306 Unclassified 2433
103 Ga0163162_10176126 3300013306 Bacteria 2264
104 Ga0163162_11205648 3300013306 Unclassified 859
105 Ga0157375_10008731 3300013308 Bacteria 8879
106 Ga0157375_10029459 3300013308 Bacteria 5163
107 Ga0157375_10228246 3300013308 Unclassified 2021
108 Ga0157375_10330681 3300013308 Bacteria 1689
109 Ga0163163_10007233 3300014325 Bacteria 9783
110 Ga0157380_10004246 3300014326 Bacteria 9912
111 Ga0157380_10309483 3300014326 Unclassified 1459
112 Ga0157379_10170167 3300014968 Unclassified 1967
113 Ga0157379_10699667 3300014968 Unclassified 951
114 Ga0157376_10010752 3300014969 Bacteria 6714
115 Ga0157376_10175861 3300014969 Bacteria 1953
116 Ga0163161_10254116 3300017792 Bacteria 1371
117 Ga0206356_10809118 3300020070 Unclassified 1279
118 Ga0207692_10029801 3300025898 Unclassified 2597
119 Ga0207642_10062605 3300025899 Bacteria 1736
120 Ga0207642_10135534 3300025899 Unclassified 1291
121 Ga0207699_10509203 3300025906 Bacteria 870
122 Ga0207645_10092416 3300025907 Unclassified 1946
123 Ga0207643_10166463 3300025908 Unclassified 1328
124 Ga0207684_10011363 3300025910 Bacteria 7793
125 Ga0207693_10013848 3300025915 Bacteria 6496
126 Ga0207663_10343132 3300025916 Unclassified 1129
127 Ga0207663_10592589 3300025916 Unclassified 870
128 Ga0207646_10004479 3300025922 Bacteria 15145
129 Ga0207681_10000126 3300025923 Bacteria 62694
130 Ga0207650_10018505 3300025925 Bacteria 4889
131 Ga0207659_10114016 3300025926 Bacteria 2059
132 Ga0207687_10531695 3300025927 Unclassified 984
133 Ga0207670_10331425 3300025936 Bacteria 1200
134 Ga0207669_10064590 3300025937 Unclassified 2266
135 Ga0207704_10246874 3300025938 Unclassified 1337
136 Ga0207704_10483873 3300025938 Unclassified 994
137 Ga0207665_10000376 3300025939 Bacteria 30843
138 Ga0207691_10055845 3300025940 Bacteria 3598
139 Ga0207711_10059223 3300025941 Bacteria 3297
140 Ga0207711_10074640 3300025941 Unclassified 2950
141 Ga0207711_10515727 3300025941 Bacteria 1114
142 Ga0207689_10503248 3300025942 Unclassified 1015
143 Ga0207679_10030813 3300025945 Bacteria 3749
144 Ga0207651_10245011 3300025960 Unclassified 1463
145 Ga0207651_10603344 3300025960 Unclassified 960
146 Ga0207712_10042304 3300025961 Unclassified 3136
147 Ga0207668_10154672 3300025972 Unclassified 1780
148 Ga0207658_10017416 3300025986 Bacteria 4949
149 Ga0207677_10064597 3300026023 Unclassified 2550
150 Ga0207703_10165328 3300026035 Bacteria 1941
151 Ga0207648_10109188 3300026089 Bacteria 2428
152 Ga0207675_100761009 3300026118 Unclassified 980
153 Ga0207683_10195070 3300026121 Unclassified 1839
154 Ga0209813_10004596 3300027866 Unclassified 3304
155 Ga0207428_10000032 3300027907 Bacteria 232162
156 Ga0207428_10291711 3300027907 Bacteria 1209
157 Ga0207428_10365405 3300027907 Bacteria 1060
158 Ga0268266_10213614 3300028379 Unclassified 1770
159 Ga0268266_10299528 3300028379 Bacteria 1500
160 Ga0268265_10019023 3300028380 Bacteria 4768
161 Ga0268264_10671157 3300028381 Bacteria 1027
162 Ga0307515_10442167 3300028794 Bacteria 917
163 Ga0265332_10180009 3300031238 Unclassified 881
164 Ga0265328_10054127 3300031239 Bacteria 1472
165 Ga0265329_10004015 3300031242 Bacteria 6265
166 Ga0307513_10026274 3300031456 Bacteria 6719
167 Ga0307513_10369156 3300031456 Unclassified 1178
168 Ga0265314_10003151 3300031711 Bacteria 16181
169 Ga0373935_0063764 3300035692 Unclassified 2362
170 Ga0373927_0016308 3300035695 Bacteria 4902
171 Ga0373927_0126723 3300035695 Bacteria 1667
172 Ga0373947_0080587 3300035725 Bacteria 2014
173 Ga0373925_0003534 3300037068 Bacteria 12054
174 Ga0439453_0006598 3300041408 Unclassified 1813
175 Ga0451793_1639934 3300041452 Bacteria 1342
176 Ga0439450_013298 3300042008 Unclassified 1651
177 Ga0439435_0002012 3300042436 Bacteria 3929
178 Ga0466963_0119497 3300044694 Bacteria 1813
179 Ga0466957_0008424 3300044842 Bacteria 5864
180 Ga0451576_0019105 3300045051 Bacteria 7489
181 Ga0495603_0001826 3300046455 Bacteria 12559
182 Ga0495603_0405099 3300046455 Unclassified 782
183 Ga0495651_0065563 3300046462 Unclassified 2773
184 Ga0495580_0009632 3300046472 Bacteria 7586
185 Ga0495580_0022291 3300046472 Bacteria 4661
186 Ga0495580_0042254 3300046472 Bacteria 3248
187 Ga0495580_0253483 3300046472 Bacteria 1204
188 Ga0495594_0001060 3300046499 Bacteria 14320
189 Ga0495596_0009910 3300046500 Bacteria 4175
190 Ga0495608_0074188 3300046511 Bacteria 2217
191 Ga0495616_0020233 3300046513 Bacteria 3623
192 Ga0495630_0079265 3300046517 Unclassified 2477
193 Ga0495644_0000001 3300046523 Bacteria 229227
194 Ga0495648_0055357 3300046524 Bacteria 2392
195 Ga0495609_0008906 3300046538 Bacteria 4883
196 Ga0495633_0015312 3300046558 Bacteria 3980
197 Ga0495667_0039441 3300046559 Bacteria 3140
198 Ga0495668_0090649 3300046616 Bacteria 1675
199 Ga0495625_0007152 3300046660 Bacteria 9799
200 Ga0495625_0017343 3300046660 Bacteria 5639
201 Ga0495657_0195723 3300046675 Bacteria 1234
202 Ga0495669_0000377 3300046684 Bacteria 22584
203 Ga0495670_0028040 3300046691 Bacteria 2791
204 Ga0495589_0124787 3300046794 Bacteria 1238
205 Ga0495600_0143884 3300046809 Bacteria 1546
206 Ga0495604_0067760 3300047317 Bacteria 2711
207 Ga0495604_0083526 3300047317 Unclassified 2387
208 Ga0495676_0246619 3300047321 Bacteria 1220
209 Ga0495675_0055643 3300047444 Bacteria 2509
210 Ga0495602_0369566 3300048088 Bacteria 1030
211 Ga0496104_0000014 3300048907 Bacteria 377972
212 Ga0496106_0169367 3300048909 Bacteria 1730
213 Ga0496111_0401253 3300048914 Bacteria 1013
214 Ga0496112_0309560 3300048915 Unclassified 1525
215 Ga0501071_0073515 3300049587 Bacteria 2494
216 nmdc:mga03683_2026_c1 3300050489 Bacteria 6201
217 nmdc:mga00v17_13455_c1 3300050491 Bacteria 4544
218 nmdc:mga0k408_1208_c1 3300050493 Bacteria 14140
219 nmdc:mga06z11_10996_c1 3300050494 Unclassified 3882
220 nmdc:mga04h51_6383_c1 3300050495 Unclassified 3056
221 nmdc:mga05p37_168833_c1 3300050507 Bacteria 2669
222 nmdc:mga09592_264884_c1 3300050508 Unclassified 1491
223 nmdc:mga09592_441899_c1 3300050508 Bacteria 1122
224 nmdc:mga0qj67_243666_c1 3300050509 Bacteria 1458
225 nmdc:mga0qj67_628846_c1 3300050509 Unclassified 857
226 nmdc:mga08y16_214094_c1 3300050511 Unclassified 1995
227 nmdc:mga08y16_335330_c1 3300050511 Bacteria 1555
228 nmdc:mga08y16_62531_c1 3300050511 Bacteria 3888
229 nmdc:mga08y16_6890_c1 3300050511 Bacteria 11916
230 nmdc:mga0a205_3157_c2 3300050515 Bacteria 9919
231 nmdc:mga0a205_563106_c1 3300050515 Unclassified 994
232 nmdc:mga0a205_805648_c1 3300050515 Unclassified 787
233 nmdc:mga0a205_899435_c1 3300050515 Unclassified 732
234 Ga0495601_0018941 3300053077 Bacteria 4194
235 2894417803 2894414249 Bacteria 4405451
236 Ga0070699_100129474
237 rootH2_10131290
238 Ga0058862_10234462
239 Ga0065715_10349817
240 Ga0070690_100031032
241 Ga0070670_100044436
242 Ga0068869_100049900
243 Ga0070666_10019744
244 Ga0070680_100446262
245 Ga0068868_100010981
246 Ga0070689_100299169
247 Ga0070689_100520293
248 Ga0070687_100027902
249 Ga0070669_100000152
250 Ga0070675_100709334
251 Ga0070675_100768068
252 Ga0070671_100031950
253 Ga0070671_100425926
254 Ga0070674_100057052
255 Ga0070673_100017792
256 Ga0070673_100341897
257 Ga0070667_100013943
258 Ga0070713_100192591
259 Ga0070711_100346212
260 Ga0070711_100694499
261 Ga0070708_100003098
262 Ga0070708_100502778
263 Ga0070663_100093528
264 Ga0068867_100125859
265 Ga0068867_100332834
266 Ga0070706_100188798
267 Ga0070707_100405992
268 Ga0070698_100037013
269 Ga0070679_100517426
270 Ga0070684_100347915
271 Ga0068853_100268605
272 Ga0070672_100031781
273 Ga0070686_100058590
274 Ga0070686_100212186
275 Ga0070696_100071513
276 Ga0070665_100267962
277 Ga0070665_100341523
278 Ga0070704_100510746
279 Ga0070664_100006186
280 Ga0070702_100026711
281 Ga0068859_100080483
282 Ga0068859_100245211
283 Ga0068859_100877842
284 Ga0068864_100012642
285 Ga0068866_10134760
286 Ga0068861_100546911
287 Ga0068863_100030972
288 Ga0068858_100185371
289 Ga0068860_101087756
290 Ga0068862_100178915
291 Ga0068862_100338828
292 Ga0081455_10155145
293 Ga0081539_10057052
294 Ga0070717_10379765
295 Ga0070717_10529780
296 Ga0075368_10010187
297 Ga0070716_100001205
298 Ga0070712_100002076
299 Ga0075362_10016856
300 Ga0075367_10005977
301 Ga0075366_10022761
302 Ga0097621_100002494
303 Ga0097621_100035410
304 Ga0068871_100005777
305 Ga0068871_100037207
306 Ga0075428_100003518
307 Ga0075428_100007176
308 Ga0075433_10815278
309 Ga0075434_100092687
310 Ga0075434_100157828
311 Ga0075429_100021518
312 Ga0068865_100002361
313 Ga0068865_100016296
314 Ga0097620_100080485
315 Ga0097620_100245198
316 Ga0097620_100877635
317 Ga0075435_100245051
318 Ga0099794_10019934
319 Ga0111539_10000849
320 Ga0111539_10001012
321 Ga0105245_10289099
322 Ga0114129_10075620
323 Ga0114129_10818111
324 Ga0105242_10020996
325 Ga0105248_10008448
326 Ga0105248_10009095
327 Ga0105248_10022392
328 Ga0105248_10148344
329 Ga0105248_10193307
330 Ga0105249_10104395
331 Ga0105249_10241851
332 Ga0105239_10125597
333 Ga0105239_11345202
334 Ga0157378_10000309
335 Ga0163162_10061234
336 Ga0163162_10142525
337 Ga0163162_10151987
338 Ga0163162_10176126
339 Ga0163162_11205648
340 Ga0157375_10008731
341 Ga0157375_10029459
342 Ga0157375_10228246
343 Ga0157375_10330681
344 Ga0163163_10007233
345 Ga0157380_10004246
346 Ga0157380_10309483
347 Ga0157379_10170167
348 Ga0157379_10699667
349 Ga0157376_10010752
350 Ga0157376_10175861
351 Ga0163161_10254116
352 Ga0206356_10809118
353 Ga0207692_10029801
354 Ga0207642_10062605
355 Ga0207642_10135534
356 Ga0207699_10509203
357 Ga0207645_10092416
358 Ga0207643_10166463
359 Ga0207684_10011363
360 Ga0207693_10013848
361 Ga0207663_10343132
362 Ga0207663_10592589
363 Ga0207646_10004479
364 Ga0207681_10000126
365 Ga0207650_10018505
366 Ga0207659_10114016
367 Ga0207687_10531695
368 Ga0207670_10331425
369 Ga0207669_10064590
370 Ga0207704_10246874
371 Ga0207704_10483873
372 Ga0207665_10000376
373 Ga0207691_10055845
374 Ga0207711_10059223
375 Ga0207711_10074640
376 Ga0207711_10515727
377 Ga0207689_10503248
378 Ga0207679_10030813
379 Ga0207651_10245011
380 Ga0207651_10603344
381 Ga0207712_10042304
382 Ga0207668_10154672
383 Ga0207658_10017416
384 Ga0207677_10064597
385 Ga0207703_10165328
386 Ga0207648_10109188
387 Ga0207675_100761009
388 Ga0207683_10195070
389 Ga0209813_10004596
390 Ga0207428_10000032
391 Ga0207428_10291711
392 Ga0207428_10365405
393 Ga0268266_10213614
394 Ga0268266_10299528
395 Ga0268265_10019023
396 Ga0268264_10671157
397 Ga0307515_10442167
398 Ga0265332_10180009
399 Ga0265328_10054127
400 Ga0265329_10004015
401 Ga0307513_10026274
402 Ga0307513_10369156
403 Ga0265314_10003151
404 Ga0373935_0063764
405 Ga0373927_0016308
406 Ga0373927_0126723
407 Ga0373947_0080587
408 Ga0373925_0003534
409 Ga0439453_0006598
410 Ga0451793_1639934
411 Ga0439450_013298
412 Ga0439435_0002012
413 Ga0466963_0119497
414 Ga0466957_0008424
415 Ga0451576_0019105
416 Ga0495603_0001826
417 Ga0495603_0405099
418 Ga0495651_0065563
419 Ga0495580_0009632
420 Ga0495580_0022291
421 Ga0495580_0042254
422 Ga0495580_0253483
423 Ga0495594_0001060
424 Ga0495596_0009910
425 Ga0495608_0074188
426 Ga0495616_0020233
427 Ga0495630_0079265
428 Ga0495644_0000001
429 Ga0495648_0055357
430 Ga0495609_0008906
431 Ga0495633_0015312
432 Ga0495667_0039441
433 Ga0495668_0090649
434 Ga0495625_0007152
435 Ga0495625_0017343
436 Ga0495657_0195723
437 Ga0495669_0000377
438 Ga0495670_0028040
439 Ga0495589_0124787
440 Ga0495600_0143884
441 Ga0495604_0067760
442 Ga0495604_0083526
443 Ga0495676_0246619
444 Ga0495675_0055643
445 Ga0495602_0369566
446 Ga0496104_0000014
447 Ga0496106_0169367
448 Ga0496111_0401253
449 Ga0496112_0309560
450 Ga0501071_0073515
451 nmdc:mga03683_2026_c1
452 nmdc:mga00v17_13455_c1
453 nmdc:mga0k408_1208_c1
454 nmdc:mga06z11_10996_c1
455 nmdc:mga04h51_6383_c1
456 nmdc:mga05p37_168833_c1
457 nmdc:mga09592_264884_c1
458 nmdc:mga09592_441899_c1
459 nmdc:mga0qj67_243666_c1
460 nmdc:mga0qj67_628846_c1
461 nmdc:mga08y16_214094_c1
462 nmdc:mga08y16_335330_c1
463 nmdc:mga08y16_62531_c1
464 nmdc:mga08y16_6890_c1
465 nmdc:mga0a205_3157_c2
466 nmdc:mga0a205_563106_c1
467 nmdc:mga0a205_805648_c1
468 nmdc:mga0a205_899435_c1
469 Ga0495601_0018941
470 2894417803

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13637

Ank_4

Ankyrin repeats (many copies)

179

225

0.95

PF00023

Ank

Ankyrin repeat

175

206

0.93

PF13637

Ank_4

Ankyrin repeats (many copies)

95

140

0.92

PF13606

Ank_3

Ankyrin repeat

174

203

0.91

PF00023

Ank

Ankyrin repeat

95

120

0.9

PF12796

Ank_2

Ankyrin repeats (3 copies)

64

158

0.87

PF12796

Ank_2

Ankyrin repeats (3 copies)

34

120

0.83

PF12796

Ank_2

Ankyrin repeats (3 copies)

162

238

0.81

PF00023

Ank

Ankyrin repeat

124

159

0.81

PF13637

Ank_4

Ankyrin repeats (many copies)

136

195

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8tyq-assembly1.cif.gz_B structure of the c-terminal half of lrrk2 bound to gzd-824 (g2019s mutant) 0.9554 67 188
7z73-assembly1.cif.gz_F crystal structure of p63 tetramerization domain in complex with darpin 8f1 0.9544 64 201
8p9d-assembly1.cif.gz_F crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with darpin 1810 a2 0.9513 64 201
7txd-assembly1.cif.gz_L cryo-em structure of bg505 sosip hiv-1 env trimer in complex with cd4 receptor (d1d2) and broadly neutralizing darpin bnd.9 0.9499 66 201
7b4u-assembly2.cif.gz_C broadly neutralizing darpin bnd.2 in complex with the hiv-1 envelope variable loop 3 crown mimetic peptide v3-if (bg505) 0.9497 64 201
ID Description Score Start End Superfamily
af_Q5ZAP0_440_552_1.25.40.20 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Ankyrin repeat-containing domain 0.9419 147 201 1.25.40.20
af_F1QR97_2_133_1.25.40.20 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Ankyrin repeat-containing domain 0.9415 67 201 1.25.40.20
6mzgL00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Ankyrin repeat-containing domain 0.9372 67 201 1.25.40.20
5aqbA01 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Ankyrin repeat-containing domain 0.9345 68 202 1.25.40.20
af_Q8TDY4_621_679_1.25.40.20 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Ankyrin repeat-containing domain 0.9273 148 201 1.25.40.20
ID Description Score Start End GO Terms
AF-A0A7V8WF19-F1-model_v4 Ankyrin repeat domain-containing protein 0.9768 3 210
AF-A0A2V9NBT9-F1-model_v4 Uncharacterized protein 0.9654 3 100
AF-A0A849SJX8-F1-model_v4 Ankyrin repeat domain-containing protein 0.9578 5 212
AF-R7VAY5-F1-model_v4 Uncharacterized protein 0.9497 99 202
AF-A0A3B4ZCS6-F1-model_v4 Si:ch211-1o7.2 0.9469 67 201 GO:0000922
GO:0007080
GO:0031116
GO:0060236
GO:1902412

Map