F347888

General Info

Members Datasets Scaffolds Average Seq Length
235 108 470 239

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10015154|Ga0070681_100151548
Length 245
Sequence MRLAILSDIHANLVALDAVRADLPEIDEVWVLGDIVGYGPQPNEVIAALQQMGARSVLGNHDGAAIGTVDPHDFNPDAARAIAWTTQVLDDNARAYLTSLPEVRCAGELTAVHGSPRDPIWEYITSVELAAINFEAFETRFGLFGHTHLPIIFAERQADPGETQVEALTATPDRSIELGSGRAMLNPGSVGQPRDGNAASSYLLLDTELAVAEFRRVSYDIGQVQRLMRDADLPARLIERLSWGR

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
53 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
54 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
55 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
56 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
57 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
58 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
59 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
60 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
61 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
62 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
63 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
64 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
65 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
66 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
67 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
68 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
69 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
70 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
71 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
72 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
73 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
74 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
84 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
85 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
86 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
87 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
88 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
89 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
90 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
91 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
92 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
93 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
94 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
95 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
96 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
97 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
98 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
99 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
100 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
101 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
102 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
103 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
104 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
105 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
106 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
107 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
108 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 3.4
Rhizosphere 95.74
Stem 0
Stem Tuber 0
Unclassified 14.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10015154 3300005458 Bacteria 7669
2 rootH1_10301705 3300003323 Bacteria 3510
3 Ga0070675_100165040 3300005354 Bacteria 1907
4 Ga0070674_100591697 3300005356 Archaea 936
5 Ga0070659_100211659 3300005366 Bacteria 1598
6 Ga0070703_10062157 3300005406 Unclassified 1225
7 Ga0070701_10084516 3300005438 Bacteria 1726
8 Ga0070705_100223433 3300005440 Bacteria 1305
9 Ga0070700_100045161 3300005441 Archaea 2717
10 Ga0070700_100084897 3300005441 Archaea 2053
11 Ga0070700_100304877 3300005441 Bacteria 1164
12 Ga0070694_100160679 3300005444 Archaea 1648
13 Ga0070708_100000614 3300005445 Bacteria 26906
14 Ga0070708_100004405 3300005445 Bacteria 11062
15 Ga0070708_100011932 3300005445 Bacteria 7078
16 Ga0070708_100036750 3300005445 Bacteria 4273
17 Ga0070708_100440547 3300005445 Archaea 1229
18 Ga0070663_100458422 3300005455 Bacteria 1052
19 Ga0068867_100171269 3300005459 Bacteria 1720
20 Ga0070706_100024095 3300005467 Bacteria 5603
21 Ga0070706_100055879 3300005467 Unclassified 3644
22 Ga0070706_100080406 3300005467 Unclassified 3018
23 Ga0070706_100112111 3300005467 Bacteria 2539
24 Ga0070707_100011609 3300005468 Bacteria 8220
25 Ga0070707_100043956 3300005468 Bacteria 4276
26 Ga0070707_100057851 3300005468 Bacteria 3719
27 Ga0070707_100059859 3300005468 Bacteria 3652
28 Ga0070707_100133720 3300005468 Unclassified 2412
29 Ga0070707_100172954 3300005468 Unclassified 2105
30 Ga0070707_100183555 3300005468 Unclassified 2040
31 Ga0070698_100001800 3300005471 Bacteria 23862
32 Ga0070699_100294308 3300005518 Unclassified 1456
33 Ga0070679_100565255 3300005530 Viruses 1081
34 Ga0070697_100051350 3300005536 Bacteria 3349
35 Ga0070697_100345933 3300005536 Bacteria 1284
36 Ga0070686_100019781 3300005544 Bacteria 3973
37 Ga0070686_100052642 3300005544 Archaea 2597
38 Ga0070696_100001689 3300005546 Bacteria 14469
39 Ga0070696_100113266 3300005546 Bacteria 1955
40 Ga0070696_100233366 3300005546 Unclassified 1385
41 Ga0070704_100133040 3300005549 Unclassified 1931
42 Ga0070704_100267510 3300005549 Bacteria 1411
43 Ga0068859_100032899 3300005617 Bacteria 5208
44 Ga0068859_101028523 3300005617 Bacteria 905
45 Ga0068864_100017518 3300005618 Bacteria 5972
46 Ga0068864_100043612 3300005618 Bacteria 3841
47 Ga0068863_100108495 3300005841 Bacteria 2642
48 Ga0068863_101032921 3300005841 Bacteria 825
49 Ga0068860_100198420 3300005843 Bacteria 1944
50 Ga0075434_100103066 3300006871 Bacteria 2861
51 Ga0097620_100032899 3300006931 Bacteria 5208
52 Ga0097620_101028510 3300006931 Bacteria 905
53 Ga0111539_10035773 3300009094 Bacteria 6011
54 Ga0111539_10205736 3300009094 Bacteria 2294
55 Ga0105245_10471971 3300009098 Bacteria 1266
56 Ga0114129_10184659 3300009147 Bacteria 2835
57 Ga0114129_10229655 3300009147 Unclassified 2500
58 Ga0105243_10216222 3300009148 Archaea 1691
59 Ga0105239_10064710 3300010375 Bacteria 4014
60 Ga0105246_10026677 3300011119 Bacteria 3779
61 Ga0157378_10113792 3300013297 Unclassified 2485
62 Ga0163163_10017027 3300014325 Bacteria 6769
63 Ga0163163_10047475 3300014325 Bacteria 4221
64 Ga0157380_10455757 3300014326 Archaea 1230
65 Ga0157379_10035124 3300014968 Bacteria 4469
66 Ga0207684_10026076 3300025910 Bacteria 4982
67 Ga0207684_10032815 3300025910 Bacteria 4415
68 Ga0207684_10051300 3300025910 Unclassified 3500
69 Ga0207684_10124128 3300025910 Unclassified 2215
70 Ga0207707_10020391 3300025912 Bacteria 5789
71 Ga0207707_10426964 3300025912 Archaea 1136
72 Ga0207662_10004376 3300025918 Bacteria 7422
73 Ga0207646_10019084 3300025922 Bacteria 6379
74 Ga0207646_10021168 3300025922 Bacteria 6014
75 Ga0207646_10076408 3300025922 Bacteria 2992
76 Ga0207646_10371321 3300025922 Unclassified 1292
77 Ga0207706_10087400 3300025933 Bacteria 2741
78 Ga0207709_10212188 3300025935 Archaea 1390
79 Ga0207677_10521952 3300026023 Bacteria 1030
80 Ga0207641_10047554 3300026088 Bacteria 3618
81 Ga0207641_10994373 3300026088 Bacteria 835
82 Ga0207676_10090893 3300026095 Bacteria 2506
83 Ga0207676_10243018 3300026095 Bacteria 1616
84 Ga0207675_100211559 3300026118 Archaea 1865
85 Ga0209998_10000102 3300027717 Bacteria 33838
86 Ga0207428_10049323 3300027907 Unclassified 3374
87 Ga0268264_10098229 3300028381 Bacteria 2539
88 Ga0265318_10015915 3300028577 Bacteria 3115
89 Ga0307408_100015291 3300031548 Bacteria 5109
90 Ga0307409_100014366 3300031995 Bacteria 5148
91 Ga0307409_100154705 3300031995 Archaea 1996
92 Ga0307416_100079540 3300032002 Unclassified 2763
93 Ga0307416_100103553 3300032002 Bacteria 2485
94 Ga0307415_100000485 3300032126 Bacteria 17218
95 Ga0373943_0010395 3300035170 Bacteria 4170
96 Ga0373931_0242099 3300035691 Bacteria 1094
97 Ga0373935_0198118 3300035692 Bacteria 1387
98 Ga0395900_0393302 3300037418 Bacteria 1352
99 Ga0439441_001168 3300042001 Bacteria 3320
100 Ga0450922_001457 3300042124 Unclassified 2323
101 Ga0450923_003545 3300042125 Unclassified 2370
102 Ga0450910_014781 3300042147 Bacteria 1144
103 Ga0439434_0013720 3300042435 Bacteria 2407
104 Ga0451576_0060450 3300045051 Bacteria 3953
105 Ga0496105_0102509 3300048908 Bacteria 2363
106 Ga0496107_0500622 3300048910 Bacteria 901
107 Ga0496108_0271013 3300048911 Bacteria 1477
108 Ga0496109_0032653 3300048912 Bacteria 4680
109 Ga0496110_0014660 3300048913 Bacteria 6515
110 Ga0496111_0055211 3300048914 Bacteria 2872
111 Ga0496112_0000001 3300048915 Bacteria 1346031
112 Ga0496112_0107962 3300048915 Bacteria 2753
113 Ga0501031_0044595 3300049568 Bacteria 2894
114 Ga0501031_0195777 3300049568 Bacteria 1319
115 Ga0501031_0300640 3300049568 Archaea 1040
116 Ga0501036_0070749 3300049572 Bacteria 2950
117 Ga0501036_0279458 3300049572 Unclassified 1397
118 Ga0501036_0279747 3300049572 Bacteria 1396
119 Ga0501038_0037871 3300049574 Bacteria 4226
120 Ga0501038_0124629 3300049574 Bacteria 2121
121 Ga0501039_0010855 3300049575 Bacteria 6942
122 Ga0501039_0312276 3300049575 Bacteria 1236
123 Ga0501040_0003852 3300049576 Bacteria 9731
124 Ga0501040_0011970 3300049576 Bacteria 5676
125 Ga0501040_0214226 3300049576 Archaea 1370
126 Ga0501040_0256208 3300049576 Unclassified 1248
127 Ga0501040_0303928 3300049576 Bacteria 1140
128 Ga0501040_0330880 3300049576 Unclassified 1090
129 Ga0501040_0359459 3300049576 Bacteria 1043
130 Ga0501041_0025845 3300049577 Bacteria 3530
131 Ga0501041_0060189 3300049577 Unclassified 2324
132 Ga0501041_0182541 3300049577 Bacteria 1313
133 Ga0501042_0021083 3300049578 Bacteria 4538
134 Ga0501042_0064604 3300049578 Bacteria 2615
135 Ga0501042_0253411 3300049578 Bacteria 1270
136 Ga0501046_0012110 3300049580 Bacteria 7352
137 Ga0501046_0296752 3300049580 Bacteria 1181
138 Ga0501046_0351191 3300049580 Unclassified 1071
139 Ga0501048_0002588 3300049582 Bacteria 13853
140 Ga0501048_0014079 3300049582 Bacteria 5928
141 Ga0501048_0027974 3300049582 Bacteria 4095
142 Ga0501048_0181653 3300049582 Unclassified 1491
143 Ga0501067_0015649 3300049583 Bacteria 4197
144 Ga0501068_0008120 3300049584 Bacteria 5828
145 Ga0501068_0017741 3300049584 Bacteria 4119
146 Ga0501068_0031143 3300049584 Bacteria 3168
147 Ga0501068_0180827 3300049584 Unclassified 1333
148 Ga0501068_0242560 3300049584 Archaea 1147
149 Ga0501069_0007715 3300049585 Bacteria 5647
150 Ga0501069_0018242 3300049585 Bacteria 3785
151 Ga0501069_0036251 3300049585 Bacteria 2719
152 Ga0501070_0032394 3300049586 Bacteria 4374
153 Ga0501070_0064420 3300049586 Bacteria 3035
154 Ga0501070_0107335 3300049586 Bacteria 2307
155 Ga0501070_0130297 3300049586 Bacteria 2078
156 Ga0501071_0006327 3300049587 Bacteria 7681
157 Ga0501071_0008138 3300049587 Bacteria 6914
158 Ga0501071_0027121 3300049587 Bacteria 4028
159 Ga0501071_0030533 3300049587 Bacteria 3812
160 Ga0501071_0051567 3300049587 Bacteria 2965
161 Ga0501071_0081594 3300049587 Bacteria 2367
162 Ga0501071_0096786 3300049587 Bacteria 2173
163 Ga0501071_0113580 3300049587 Bacteria 2003
164 Ga0501072_0002311 3300049588 Bacteria 14287
165 Ga0501072_0038260 3300049588 Unclassified 3764
166 Ga0501072_0078691 3300049588 Bacteria 2611
167 Ga0501072_0298268 3300049588 Bacteria 1281
168 Ga0501072_0337653 3300049588 Bacteria 1197
169 Ga0501072_1006999 3300049588 Bacteria 649
170 Ga0501073_0387732 3300049589 Bacteria 965
171 Ga0501073_0484868 3300049589 Unclassified 855
172 Ga0501073_0525171 3300049589 Bacteria 818
173 Ga0501073_0528712 3300049589 Bacteria 815
174 Ga0501074_0006355 3300049590 Bacteria 8533
175 Ga0501074_0009019 3300049590 Bacteria 7243
176 Ga0501074_0084395 3300049590 Bacteria 2277
177 Ga0501074_0156660 3300049590 Unclassified 1627
178 Ga0501074_0201088 3300049590 Bacteria 1420
179 Ga0501074_0388985 3300049590 Bacteria 989
180 Ga0501074_0510990 3300049590 Bacteria 851
181 Ga0501075_0011393 3300049591 Bacteria 6293
182 Ga0501075_0086856 3300049591 Unclassified 2370
183 Ga0501075_0176221 3300049591 Bacteria 1631
184 Ga0501075_0230834 3300049591 Bacteria 1411
185 Ga0501075_0282501 3300049591 Bacteria 1265
186 Ga0501075_0417378 3300049591 Bacteria 1023
187 Ga0501076_0005989 3300049592 Bacteria 8781
188 Ga0501076_0016716 3300049592 Bacteria 5565
189 Ga0501076_0016892 3300049592 Bacteria 5541
190 Ga0501076_0080098 3300049592 Bacteria 2621
191 Ga0501076_0180631 3300049592 Archaea 1720
192 Ga0501076_0752147 3300049592 Bacteria 804
193 Ga0501076_0778821 3300049592 Bacteria 789
194 Ga0501077_0043427 3300049593 Bacteria 2857
195 Ga0501077_0154376 3300049593 Bacteria 1457
196 Ga0501079_0024950 3300049741 Bacteria 4586
197 Ga0501079_0121404 3300049741 Bacteria 2032
198 Ga0501079_0160049 3300049741 Unclassified 1755
199 Ga0501079_0324080 3300049741 Bacteria 1206
200 Ga0501080_0024368 3300049742 Bacteria 5609
201 Ga0501080_0612078 3300049742 Bacteria 966
202 Ga0501081_0018999 3300049743 Bacteria 4570
203 Ga0501081_0112002 3300049743 Unclassified 1937
204 Ga0501081_0165123 3300049743 Archaea 1597
205 Ga0501081_0258132 3300049743 Archaea 1273
206 Ga0501045_0059709 3300049824 Bacteria 2794
207 Ga0501045_0259844 3300049824 Bacteria 1292
208 Ga0501045_0278925 3300049824 Bacteria 1244
209 Ga0501045_0351606 3300049824 Archaea 1097
210 nmdc:mga08y16_42796_c1 3300050511 Bacteria 4743
211 nmdc:mga0n895_1109670_c1 3300050512 Unclassified 768
212 nmdc:mga0n895_49964_c1 3300050512 Bacteria 4099
213 nmdc:mga0rr50_321132_c1 3300050513 Bacteria 1298
214 nmdc:mga0a205_10879_c1 3300050515 Bacteria 8371
215 Ga0495601_0105951 3300053077 Bacteria 1818
216 Ga0495595_0025060 3300053084 Bacteria 2639
217 Ga0500628_014169 3300053129 Bacteria 1502
218 Ga0501084_0053472 3300054114 Bacteria 3378
219 Ga0501084_0155849 3300054114 Bacteria 1926
220 Ga0501084_0318953 3300054114 Bacteria 1313
221 Ga0501084_0481029 3300054114 Bacteria 1049
222 Ga0501084_0495006 3300054114 Archaea 1033
223 Ga0590071_079950 3300059421 Bacteria 812
224 Ga0501082_0002321 3300060353 Bacteria 16647
225 Ga0501082_0065794 3300060353 Bacteria 3121
226 Ga0501082_0079080 3300060353 Archaea 2837
227 Ga0501082_0146064 3300060353 Bacteria 2053
228 Ga0501082_0201739 3300060353 Bacteria 1730
229 Ga0530510_0005845 3300061734 Bacteria 8526
230 Ga0530510_0015897 3300061734 Bacteria 5321
231 Ga0530510_0023642 3300061734 Bacteria 4381
232 Ga0530510_0090722 3300061734 Bacteria 2229
233 Ga0530510_0201201 3300061734 Bacteria 1479
234 Ga0530510_0227679 3300061734 Unclassified 1386
235 Ga0530510_0571405 3300061734 Bacteria 859
236 Ga0070681_10015154
237 rootH1_10301705
238 Ga0070675_100165040
239 Ga0070674_100591697
240 Ga0070659_100211659
241 Ga0070703_10062157
242 Ga0070701_10084516
243 Ga0070705_100223433
244 Ga0070700_100045161
245 Ga0070700_100084897
246 Ga0070700_100304877
247 Ga0070694_100160679
248 Ga0070708_100000614
249 Ga0070708_100004405
250 Ga0070708_100011932
251 Ga0070708_100036750
252 Ga0070708_100440547
253 Ga0070663_100458422
254 Ga0068867_100171269
255 Ga0070706_100024095
256 Ga0070706_100055879
257 Ga0070706_100080406
258 Ga0070706_100112111
259 Ga0070707_100011609
260 Ga0070707_100043956
261 Ga0070707_100057851
262 Ga0070707_100059859
263 Ga0070707_100133720
264 Ga0070707_100172954
265 Ga0070707_100183555
266 Ga0070698_100001800
267 Ga0070699_100294308
268 Ga0070679_100565255
269 Ga0070697_100051350
270 Ga0070697_100345933
271 Ga0070686_100019781
272 Ga0070686_100052642
273 Ga0070696_100001689
274 Ga0070696_100113266
275 Ga0070696_100233366
276 Ga0070704_100133040
277 Ga0070704_100267510
278 Ga0068859_100032899
279 Ga0068859_101028523
280 Ga0068864_100017518
281 Ga0068864_100043612
282 Ga0068863_100108495
283 Ga0068863_101032921
284 Ga0068860_100198420
285 Ga0075434_100103066
286 Ga0097620_100032899
287 Ga0097620_101028510
288 Ga0111539_10035773
289 Ga0111539_10205736
290 Ga0105245_10471971
291 Ga0114129_10184659
292 Ga0114129_10229655
293 Ga0105243_10216222
294 Ga0105239_10064710
295 Ga0105246_10026677
296 Ga0157378_10113792
297 Ga0163163_10017027
298 Ga0163163_10047475
299 Ga0157380_10455757
300 Ga0157379_10035124
301 Ga0207684_10026076
302 Ga0207684_10032815
303 Ga0207684_10051300
304 Ga0207684_10124128
305 Ga0207707_10020391
306 Ga0207707_10426964
307 Ga0207662_10004376
308 Ga0207646_10019084
309 Ga0207646_10021168
310 Ga0207646_10076408
311 Ga0207646_10371321
312 Ga0207706_10087400
313 Ga0207709_10212188
314 Ga0207677_10521952
315 Ga0207641_10047554
316 Ga0207641_10994373
317 Ga0207676_10090893
318 Ga0207676_10243018
319 Ga0207675_100211559
320 Ga0209998_10000102
321 Ga0207428_10049323
322 Ga0268264_10098229
323 Ga0265318_10015915
324 Ga0307408_100015291
325 Ga0307409_100014366
326 Ga0307409_100154705
327 Ga0307416_100079540
328 Ga0307416_100103553
329 Ga0307415_100000485
330 Ga0373943_0010395
331 Ga0373931_0242099
332 Ga0373935_0198118
333 Ga0395900_0393302
334 Ga0439441_001168
335 Ga0450922_001457
336 Ga0450923_003545
337 Ga0450910_014781
338 Ga0439434_0013720
339 Ga0451576_0060450
340 Ga0496105_0102509
341 Ga0496107_0500622
342 Ga0496108_0271013
343 Ga0496109_0032653
344 Ga0496110_0014660
345 Ga0496111_0055211
346 Ga0496112_0000001
347 Ga0496112_0107962
348 Ga0501031_0044595
349 Ga0501031_0195777
350 Ga0501031_0300640
351 Ga0501036_0070749
352 Ga0501036_0279458
353 Ga0501036_0279747
354 Ga0501038_0037871
355 Ga0501038_0124629
356 Ga0501039_0010855
357 Ga0501039_0312276
358 Ga0501040_0003852
359 Ga0501040_0011970
360 Ga0501040_0214226
361 Ga0501040_0256208
362 Ga0501040_0303928
363 Ga0501040_0330880
364 Ga0501040_0359459
365 Ga0501041_0025845
366 Ga0501041_0060189
367 Ga0501041_0182541
368 Ga0501042_0021083
369 Ga0501042_0064604
370 Ga0501042_0253411
371 Ga0501046_0012110
372 Ga0501046_0296752
373 Ga0501046_0351191
374 Ga0501048_0002588
375 Ga0501048_0014079
376 Ga0501048_0027974
377 Ga0501048_0181653
378 Ga0501067_0015649
379 Ga0501068_0008120
380 Ga0501068_0017741
381 Ga0501068_0031143
382 Ga0501068_0180827
383 Ga0501068_0242560
384 Ga0501069_0007715
385 Ga0501069_0018242
386 Ga0501069_0036251
387 Ga0501070_0032394
388 Ga0501070_0064420
389 Ga0501070_0107335
390 Ga0501070_0130297
391 Ga0501071_0006327
392 Ga0501071_0008138
393 Ga0501071_0027121
394 Ga0501071_0030533
395 Ga0501071_0051567
396 Ga0501071_0081594
397 Ga0501071_0096786
398 Ga0501071_0113580
399 Ga0501072_0002311
400 Ga0501072_0038260
401 Ga0501072_0078691
402 Ga0501072_0298268
403 Ga0501072_0337653
404 Ga0501072_1006999
405 Ga0501073_0387732
406 Ga0501073_0484868
407 Ga0501073_0525171
408 Ga0501073_0528712
409 Ga0501074_0006355
410 Ga0501074_0009019
411 Ga0501074_0084395
412 Ga0501074_0156660
413 Ga0501074_0201088
414 Ga0501074_0388985
415 Ga0501074_0510990
416 Ga0501075_0011393
417 Ga0501075_0086856
418 Ga0501075_0176221
419 Ga0501075_0230834
420 Ga0501075_0282501
421 Ga0501075_0417378
422 Ga0501076_0005989
423 Ga0501076_0016716
424 Ga0501076_0016892
425 Ga0501076_0080098
426 Ga0501076_0180631
427 Ga0501076_0752147
428 Ga0501076_0778821
429 Ga0501077_0043427
430 Ga0501077_0154376
431 Ga0501079_0024950
432 Ga0501079_0121404
433 Ga0501079_0160049
434 Ga0501079_0324080
435 Ga0501080_0024368
436 Ga0501080_0612078
437 Ga0501081_0018999
438 Ga0501081_0112002
439 Ga0501081_0165123
440 Ga0501081_0258132
441 Ga0501045_0059709
442 Ga0501045_0259844
443 Ga0501045_0278925
444 Ga0501045_0351606
445 nmdc:mga08y16_42796_c1
446 nmdc:mga0n895_1109670_c1
447 nmdc:mga0n895_49964_c1
448 nmdc:mga0rr50_321132_c1
449 nmdc:mga0a205_10879_c1
450 Ga0495601_0105951
451 Ga0495595_0025060
452 Ga0500628_014169
453 Ga0501084_0053472
454 Ga0501084_0155849
455 Ga0501084_0318953
456 Ga0501084_0481029
457 Ga0501084_0495006
458 Ga0590071_079950
459 Ga0501082_0002321
460 Ga0501082_0065794
461 Ga0501082_0079080
462 Ga0501082_0146064
463 Ga0501082_0201739
464 Ga0530510_0005845
465 Ga0530510_0015897
466 Ga0530510_0023642
467 Ga0530510_0090722
468 Ga0530510_0201201
469 Ga0530510_0227679
470 Ga0530510_0571405

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

1

209

0.72

PF00149

Metallophos

Calcineurin-like phosphoesterase

1

164

0.63

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rqz-assembly1.cif.gz_A crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.9016 1 230
3rqz-assembly2.cif.gz_B crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.8999 1 230
3rqz-assembly3.cif.gz_C crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.8986 1 230
3rqz-assembly1.cif.gz_A crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.8978 1 230
3rqz-assembly2.cif.gz_B crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.8961 1 230
ID Description Score Start End Superfamily
3rqzB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8857 3 230 3.60.21.10
3rqzB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8746 3 230 3.60.21.10
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8698 3 230 3.60.21.10
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8589 3 230 3.60.21.10
2gjuC00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7998 2 230 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A2V7H478-F1-model_v4 Metallophosphoesterase 0.9825 63 230
AF-X1CXE3-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9808 15 137 GO:0005737
GO:0016791
AF-A0A535XU76-F1-model_v4 Metallophosphoesterase family protein 0.9774 1 230 GO:0005737
GO:0016791
AF-X1PK23-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9734 47 230
AF-A0A535XU76-F1-model_v4 Metallophosphoesterase family protein 0.9732 1 230 GO:0005737
GO:0016791

Map