F347782

General Info

Members Datasets Scaffolds Average Seq Length
235 160 235 239

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100374339|Ga0068869_1003743392
Length 265
Sequence VYDKTYGTDAGMKRIVIAGLTTLVMLSLTSAFAQERPLNRPPAGFIALFNAKDLTGWRGRQGTYSPHAEALLSKEELAAKQVQWNGERDLHWSVDTAKGEIVSDGKSVHLATVKDYGDFELYVDWLMVNHNGDSGIYLRGYPQVQIWDVDNPREVKNGAPKGSGALWNNNADNPGKWPLVKADNPVGQWNTLRIKMIGSRVWVWLNDKATVDGQVLDNFYDRALPLVPKGAIELQTHGSEIRFRNIYVREIPPAEAKAALDKFKG

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
86 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
93 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
94 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
99 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
100 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
103 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
107 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
110 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
114 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
115 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
116 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
148 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
149 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
150 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
151 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
152 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.49
Nodule 0
Rhizoplane 5.96
Rhizosphere 82.13
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10051770 3300005293 Bacteria 834
2 Ga0065715_10103206 3300005293 Bacteria 3051
3 Ga0070658_10004115 3300005327 Bacteria 11924
4 Ga0070683_100000328 3300005329 Bacteria 32851
5 Ga0070683_100854054 3300005329 Bacteria 873
6 Ga0070690_100528335 3300005330 Bacteria 886
7 Ga0070670_100003387 3300005331 Bacteria 13212
8 Ga0070670_100078398 3300005331 Unclassified 2838
9 Ga0070670_100244090 3300005331 Unclassified 1564
10 Ga0068869_100374339 3300005334 Bacteria 1166
11 Ga0068868_100078000 3300005338 Unclassified 2651
12 Ga0070689_100359433 3300005340 Bacteria 1223
13 Ga0070661_100087160 3300005344 Bacteria 2309
14 Ga0070669_100001414 3300005353 Bacteria 17346
15 Ga0070675_100133523 3300005354 Bacteria 2117
16 Ga0070675_100263030 3300005354 Unclassified 1512
17 Ga0070674_100029131 3300005356 Bacteria 3632
18 Ga0070674_100166912 3300005356 Bacteria 1675
19 Ga0070673_100169082 3300005364 Bacteria 1865
20 Ga0070659_100233837 3300005366 Unclassified 1519
21 Ga0070667_100107951 3300005367 Bacteria 2411
22 Ga0070667_100382783 3300005367 Unclassified 1278
23 Ga0070713_100001086 3300005436 Bacteria 17408
24 Ga0070663_100046275 3300005455 Bacteria 3078
25 Ga0070678_100071102 3300005456 Bacteria 2604
26 Ga0070706_100755684 3300005467 Bacteria 901
27 Ga0070698_100305444 3300005471 Bacteria 1522
28 Ga0070684_100010605 3300005535 Bacteria 7307
29 Ga0070684_100152631 3300005535 Unclassified 2093
30 Ga0070693_100029976 3300005547 Bacteria 2971
31 Ga0068855_100080904 3300005563 Unclassified 3767
32 Ga0070664_100000543 3300005564 Bacteria 28811
33 Ga0070664_100017730 3300005564 Bacteria 5849
34 Ga0068857_100006456 3300005577 Bacteria 10056
35 Ga0068857_100131314 3300005577 Bacteria 2259
36 Ga0068856_101052216 3300005614 Bacteria 832
37 Ga0068859_100164677 3300005617 Unclassified 2297
38 Ga0068870_10040532 3300005840 Bacteria 2415
39 Ga0068870_10494532 3300005840 Bacteria 814
40 Ga0068863_100033345 3300005841 Unclassified 4905
41 Ga0068863_100622875 3300005841 Bacteria 1069
42 Ga0068858_100409189 3300005842 Unclassified 1304
43 Ga0068860_100338988 3300005843 Unclassified 1478
44 Ga0075365_10035630 3300006038 Bacteria 3221
45 Ga0075368_10002358 3300006042 Bacteria 6142
46 Ga0075368_10046821 3300006042 Bacteria 1711
47 Ga0075364_10002871 3300006051 Bacteria 9706
48 Ga0075364_10024315 3300006051 Bacteria 3845
49 Ga0075364_10270043 3300006051 Bacteria 1157
50 Ga0075367_10002554 3300006178 Bacteria 8355
51 Ga0075367_10080549 3300006178 Bacteria 1969
52 Ga0075366_10007695 3300006195 Bacteria 5965
53 Ga0075366_10023764 3300006195 Bacteria 3572
54 Ga0075366_10104069 3300006195 Bacteria 1705
55 Ga0075366_10144077 3300006195 Bacteria 1441
56 Ga0075370_10330084 3300006353 Bacteria 909
57 Ga0068871_100525701 3300006358 Unclassified 1069
58 Ga0075433_10070922 3300006852 Bacteria 3063
59 Ga0075433_10412929 3300006852 Bacteria 1191
60 Ga0075434_100005266 3300006871 Bacteria 11758
61 Ga0075434_100062571 3300006871 Unclassified 3704
62 Ga0075434_100277242 3300006871 Bacteria 1696
63 Ga0075429_100243706 3300006880 Bacteria 1574
64 Ga0097620_100164673 3300006931 Unclassified 2297
65 Ga0075435_100560349 3300007076 Bacteria 990
66 Ga0105240_10037391 3300009093 Bacteria 6240
67 Ga0105240_10402758 3300009093 Unclassified 1541
68 Ga0111539_10000205 3300009094 Bacteria 69920
69 Ga0111539_10056849 3300009094 Bacteria 4649
70 Ga0111539_10122152 3300009094 Bacteria 3052
71 Ga0111539_10746144 3300009094 Bacteria 1139
72 Ga0111539_11186112 3300009094 Bacteria 887
73 Ga0111539_11262113 3300009094 Bacteria 857
74 Ga0114129_10638978 3300009147 Unclassified 1375
75 Ga0105243_10329715 3300009148 Bacteria 1394
76 Ga0105248_10008642 3300009177 Bacteria 11186
77 Ga0105248_10055040 3300009177 Unclassified 4462
78 Ga0105248_10279710 3300009177 Unclassified 1879
79 Ga0105237_10269200 3300009545 Bacteria 1707
80 Ga0105237_10295473 3300009545 Bacteria 1623
81 Ga0105249_10000654 3300009553 Bacteria 31467
82 Ga0105239_10068642 3300010375 Bacteria 3896
83 Ga0105239_10637317 3300010375 Bacteria 1217
84 Ga0105246_10276121 3300011119 Bacteria 1346
85 Ga0157370_10103446 3300013104 Bacteria 2666
86 Ga0157374_10118244 3300013296 Bacteria 2556
87 Ga0157374_10679200 3300013296 Unclassified 1042
88 Ga0157375_10370640 3300013308 Bacteria 1598
89 Ga0163163_10079737 3300014325 Bacteria 3272
90 Ga0163163_10088719 3300014325 Bacteria 3104
91 Ga0163163_10116628 3300014325 Bacteria 2702
92 Ga0163163_10301498 3300014325 Bacteria 1655
93 Ga0157379_10643762 3300014968 Bacteria 992
94 Ga0157376_10010746 3300014969 Bacteria 6716
95 Ga0207697_10008142 3300025315 Bacteria 4615
96 Ga0207680_10171794 3300025903 Bacteria 1460
97 Ga0207705_10008797 3300025909 Bacteria 7359
98 Ga0207707_10245022 3300025912 Bacteria 1557
99 Ga0207695_10192998 3300025913 Unclassified 1953
100 Ga0207695_10456817 3300025913 Bacteria 1160
101 Ga0207671_10106662 3300025914 Bacteria 2127
102 Ga0207663_10142948 3300025916 Unclassified 1669
103 Ga0207660_10274877 3300025917 Unclassified 1335
104 Ga0207681_10010075 3300025923 Bacteria 5786
105 Ga0207650_10023257 3300025925 Bacteria 4393
106 Ga0207650_10436643 3300025925 Bacteria 1088
107 Ga0207659_10103212 3300025926 Archaea 2154
108 Ga0207706_10068136 3300025933 Bacteria 3132
109 Ga0207669_10013180 3300025937 Bacteria 4096
110 Ga0207669_10176419 3300025937 Bacteria 1527
111 Ga0207711_10166266 3300025941 Unclassified 1999
112 Ga0207711_10168143 3300025941 Unclassified 1988
113 Ga0207689_10052777 3300025942 Bacteria 3349
114 Ga0207661_10001697 3300025944 Bacteria 15020
115 Ga0207679_10005525 3300025945 Bacteria 7922
116 Ga0207667_10060798 3300025949 Bacteria 3954
117 Ga0207651_10309254 3300025960 Bacteria 1317
118 Ga0207703_10141280 3300026035 Unclassified 2090
119 Ga0207678_10113646 3300026067 Bacteria 2310
120 Ga0207708_10169456 3300026075 Unclassified 1728
121 Ga0207641_10100921 3300026088 Bacteria 2542
122 Ga0207674_10009939 3300026116 Bacteria 10823
123 Ga0207674_10030181 3300026116 Bacteria 5702
124 Ga0207675_100973445 3300026118 Bacteria 866
125 Ga0207683_10022678 3300026121 Bacteria 5391
126 Ga0209813_10004491 3300027866 Bacteria 3337
127 Ga0209813_10022512 3300027866 Bacteria 1783
128 Ga0209813_10043305 3300027866 Bacteria 1379
129 Ga0209974_10096556 3300027876 Bacteria 1029
130 Ga0207428_10009239 3300027907 Bacteria 8853
131 Ga0207428_10054935 3300027907 Unclassified 3169
132 Ga0268265_10016278 3300028380 Bacteria 5105
133 Ga0268264_10732932 3300028381 Unclassified 984
134 Ga0307409_100118498 3300031995 Bacteria 2236
135 Ga0373923_0214753 3300035111 Bacteria 893
136 Ga0373939_0113736 3300035114 Bacteria 946
137 Ga0373954_0178585 3300035118 Bacteria 1041
138 Ga0373943_0252788 3300035170 Bacteria 990
139 Ga0373937_0011944 3300036401 Bacteria 7623
140 Ga0373925_0370449 3300037068 Bacteria 1165
141 Ga0373925_0697635 3300037068 Bacteria 837
142 Ga0436365_0973064 3300039437 Bacteria 1750
143 Ga0439431_0024617 3300041997 Bacteria 1466
144 Ga0439449_0048172 3300042007 Bacteria 1578
145 Ga0439444_0026169 3300042437 Bacteria 1066
146 Ga0495651_0017269 3300046462 Bacteria 5590
147 Ga0495651_0239611 3300046462 Unclassified 1245
148 Ga0495653_0193452 3300046463 Unclassified 1386
149 Ga0495580_0000827 3300046472 Bacteria 26841
150 Ga0495628_0111016 3300046516 Bacteria 2109
151 Ga0495652_0181761 3300046529 Bacteria 1613
152 Ga0495665_0024424 3300046531 Bacteria 3247
153 Ga0495645_0006701 3300046543 Bacteria 8003
154 Ga0495667_0044805 3300046559 Bacteria 2929
155 Ga0495667_0054452 3300046559 Bacteria 2632
156 Ga0495599_0053337 3300046678 Bacteria 2533
157 Ga0495623_0232552 3300046679 Unclassified 1045
158 Ga0495674_0010281 3300047319 Bacteria 8862
159 Ga0495674_0086808 3300047319 Bacteria 2678
160 Ga0495680_0238256 3300047322 Bacteria 1293
161 Ga0495675_0098373 3300047444 Bacteria 1833
162 Ga0495684_0003813 3300047471 Bacteria 11747
163 Ga0495684_0056541 3300047471 Bacteria 2991
164 Ga0495684_0247521 3300047471 Unclassified 1298
165 Ga0495602_0045129 3300048088 Bacteria 3991
166 Ga0496101_0197858 3300048904 Bacteria 1553
167 Ga0496102_0054051 3300048905 Bacteria 3661
168 Ga0496102_0560718 3300048905 Bacteria 1065
169 Ga0496103_0026841 3300048906 Bacteria 3486
170 Ga0496103_0236247 3300048906 Bacteria 1176
171 Ga0496104_0021994 3300048907 Bacteria 5859
172 Ga0496105_0308716 3300048908 Bacteria 1270
173 Ga0496107_0307578 3300048910 Bacteria 1180
174 Ga0496108_0034832 3300048911 Bacteria 4183
175 Ga0496109_0005112 3300048912 Bacteria 10958
176 Ga0496110_0005074 3300048913 Bacteria 10291
177 Ga0496111_0015088 3300048914 Bacteria 5294
178 Ga0496112_0021509 3300048915 Bacteria 6136
179 Ga0496113_0319174 3300048916 Bacteria 1245
180 Ga0501032_0012350 3300049569 Bacteria 6105
181 Ga0501034_0286693 3300049571 Bacteria 1585
182 Ga0501036_0090277 3300049572 Bacteria 2588
183 Ga0501037_0101125 3300049573 Unclassified 2081
184 Ga0501038_0007862 3300049574 Bacteria 9826
185 Ga0501038_0018403 3300049574 Bacteria 6306
186 Ga0501039_0048310 3300049575 Bacteria 3290
187 Ga0501039_0229510 3300049575 Bacteria 1459
188 Ga0501043_0208891 3300049579 Bacteria 1513
189 Ga0501043_0362628 3300049579 Bacteria 1100
190 Ga0501046_0043683 3300049580 Bacteria 3567
191 Ga0501046_0185162 3300049580 Bacteria 1555
192 Ga0501047_0001050 3300049581 Bacteria 27546
193 Ga0501047_0011774 3300049581 Bacteria 8273
194 Ga0501047_0504628 3300049581 Unclassified 1036
195 Ga0501067_0095106 3300049583 Bacteria 1654
196 Ga0501068_0570338 3300049584 Bacteria 736
197 Ga0501069_0053258 3300049585 Bacteria 2254
198 Ga0501069_0141113 3300049585 Bacteria 1382
199 Ga0501073_0023893 3300049589 Bacteria 4389
200 Ga0501073_0481106 3300049589 Bacteria 858
201 Ga0501077_0058713 3300049593 Bacteria 2442
202 Ga0501080_0020134 3300049742 Bacteria 6174
203 Ga0501083_0062678 3300049744 Bacteria 2480
204 Ga0501083_0083937 3300049744 Bacteria 2109
205 Ga0501083_0261862 3300049744 Bacteria 1125
206 Ga0501035_0119309 3300049822 Bacteria 2307
207 Ga0501044_0029616 3300049823 Bacteria 5771
208 Ga0501044_0507626 3300049823 Bacteria 1106
209 Ga0501045_0118153 3300049824 Unclassified 1968
210 nmdc:mga00v17_6134_c1 3300050491 Bacteria 6368
211 nmdc:mga0yw44_490238_c1 3300050492 Bacteria 834
212 nmdc:mga0k408_4593_c1 3300050493 Bacteria 7019
213 nmdc:mga0k408_6265_c1 3300050493 Bacteria 6346
214 nmdc:mga0k408_99280_c1 3300050493 Bacteria 1716
215 nmdc:mga06z11_77509_c1 3300050494 Bacteria 1775
216 nmdc:mga04h51_26616_c1 3300050495 Bacteria 1790
217 nmdc:mga04h51_32752_c1 3300050495 Bacteria 1650
218 nmdc:mga04h51_4725_c1 3300050495 Bacteria 3414
219 nmdc:mga07m45_30350_c1 3300050496 Bacteria 2994
220 nmdc:mga05p37_331515_c2 3300050507 Unclassified 1375
221 nmdc:mga05p37_347694_c1 3300050507 Bacteria 1746
222 nmdc:mga06r32_895779_c1 3300050510 Bacteria 844
223 nmdc:mga08y16_250_c1 3300050511 Bacteria 48435
224 nmdc:mga08y16_7828_c1 3300050511 Bacteria 11191
225 nmdc:mga0n895_284622_c1 3300050512 Bacteria 1676
226 nmdc:mga0n895_4246_c1 3300050512 Bacteria 11718
227 nmdc:mga0n895_61095_c1 3300050512 Unclassified 3719
228 nmdc:mga0a205_185389_c1 3300050515 Bacteria 1974
229 nmdc:mga0a205_25670_c2 3300050515 Bacteria 4417
230 nmdc:mga0a205_436311_c1 3300050515 Bacteria 1171
231 nmdc:mga0a205_6227_c2 3300050515 Bacteria 6531
232 nmdc:mga0a205_99619_c1 3300050515 Bacteria 2332
233 Ga0500628_006560 3300053129 Bacteria 1972
234 Ga0501084_0007033 3300054114 Bacteria 9275
235 Ga0501082_0049490 3300060353 Bacteria 3624

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035170 Ga0373943_0252788 Ga0373943_0252788_236_979 203
2 3300037068 Ga0373925_0370449 Ga0373925_0370449_356_1099 203
3 3300009094 Ga0111539_11262113 Ga0111539_112621131 204
4 3300048916 Ga0496113_0319174 Ga0496113_0319174_529_1227 209
5 3300005331 Ga0070670_100078398 Ga0070670_1000783982 214
6 3300005344 Ga0070661_100087160 Ga0070661_1000871602 214
7 3300005564 Ga0070664_100017730 Ga0070664_1000177303 214
8 3300005577 Ga0068857_100131314 Ga0068857_1001313142 214
9 3300026116 Ga0207674_10030181 Ga0207674_100301812 214
10 3300050512 nmdc:mga0n895_284622_c1 nmdc:mga0n895_284622_c1_238_957 215
11 3300005356 Ga0070674_100166912 Ga0070674_1001669122 216
12 3300006195 Ga0075366_10144077 Ga0075366_101440772 216
13 3300006871 Ga0075434_100005266 Ga0075434_10000526610 216
14 3300025937 Ga0207669_10176419 Ga0207669_101764192 216
15 3300050512 nmdc:mga0n895_4246_c1 nmdc:mga0n895_4246_c1_7784_8518 216
16 3300050515 nmdc:mga0a205_185389_c1 nmdc:mga0a205_185389_c1_33_767 216
17 3300006871 Ga0075434_100277242 Ga0075434_1002772422 217
18 3300026118 Ga0207675_100973445 Ga0207675_1009734451 217
19 3300005436 Ga0070713_100001086 Ga0070713_10000108611 218
20 3300006042 Ga0075368_10002358 Ga0075368_100023584 218
21 3300006051 Ga0075364_10024315 Ga0075364_100243152 218
22 3300006353 Ga0075370_10330084 Ga0075370_103300841 218
23 3300027866 Ga0209813_10004491 Ga0209813_100044912 218
24 3300050492 nmdc:mga0yw44_490238_c1 nmdc:mga0yw44_490238_c1_49_774 218
25 3300050495 nmdc:mga04h51_4725_c1 nmdc:mga04h51_4725_c1_2394_3119 218
26 3300050496 nmdc:mga07m45_30350_c1 nmdc:mga07m45_30350_c1_1874_2599 218
27 3300006051 Ga0075364_10270043 Ga0075364_102700432 219
28 3300049581 Ga0501047_0504628 Ga0501047_0504628_108_863 219
29 3300049584 Ga0501068_0570338 Ga0501068_0570338_40_702 219
30 3300005329 Ga0070683_100000328 Ga0070683_10000032815 221
31 3300005331 Ga0070670_100003387 Ga0070670_1000033875 221
32 3300005354 Ga0070675_100133523 Ga0070675_1001335232 221
33 3300005366 Ga0070659_100233837 Ga0070659_1002338372 221
34 3300005455 Ga0070663_100046275 Ga0070663_1000462752 221
35 3300005535 Ga0070684_100010605 Ga0070684_1000106055 221
36 3300005564 Ga0070664_100000543 Ga0070664_10000054310 221
37 3300009177 Ga0105248_10008642 Ga0105248_100086427 221
38 3300009545 Ga0105237_10295473 Ga0105237_102954732 221
39 3300014325 Ga0163163_10079737 Ga0163163_100797372 221
40 3300014968 Ga0157379_10643762 Ga0157379_106437621 221
41 3300025315 Ga0207697_10008142 Ga0207697_100081423 221
42 3300025903 Ga0207680_10171794 Ga0207680_101717942 221
43 3300025925 Ga0207650_10023257 Ga0207650_100232572 221
44 3300025926 Ga0207659_10103212 Ga0207659_101032122 221
45 3300025933 Ga0207706_10068136 Ga0207706_100681362 221
46 3300025944 Ga0207661_10001697 Ga0207661_100016972 221
47 3300025945 Ga0207679_10005525 Ga0207679_100055254 221
48 3300026067 Ga0207678_10113646 Ga0207678_101136462 221
49 3300048905 Ga0496102_0560718 Ga0496102_0560718_227_991 221
50 3300048907 Ga0496104_0021994 Ga0496104_0021994_4408_5172 221
51 3300048908 Ga0496105_0308716 Ga0496105_0308716_164_928 221
52 3300048911 Ga0496108_0034832 Ga0496108_0034832_2711_3475 221
53 3300048912 Ga0496109_0005112 Ga0496109_0005112_5172_5936 221
54 3300048913 Ga0496110_0005074 Ga0496110_0005074_4313_5077 221
55 3300048914 Ga0496111_0015088 Ga0496111_0015088_1748_2512 221
56 3300048915 Ga0496112_0021509 Ga0496112_0021509_5125_5889 221
57 3300005547 Ga0070693_100029976 Ga0070693_1000299763 222
58 3300006195 Ga0075366_10007695 Ga0075366_100076954 222
59 3300007076 Ga0075435_100560349 Ga0075435_1005603491 222
60 3300009094 Ga0111539_10122152 Ga0111539_101221523 222
61 3300048904 Ga0496101_0197858 Ga0496101_0197858_51_815 222
62 3300048906 Ga0496103_0236247 Ga0496103_0236247_103_867 222
63 3300049824 Ga0501045_0118153 Ga0501045_0118153_1278_1955 222
64 3300050493 nmdc:mga0k408_6265_c1 nmdc:mga0k408_6265_c1_4866_5591 222
65 3300005467 Ga0070706_100755684 Ga0070706_1007556841 223
66 3300031995 Ga0307409_100118498 Ga0307409_1001184982 223
67 3300041997 Ga0439431_0024617 Ga0439431_0024617_652_1362 223
68 3300042007 Ga0439449_0048172 Ga0439449_0048172_37_747 223
69 3300009093 Ga0105240_10037391 Ga0105240_100373912 224
70 3300009094 Ga0111539_11186112 Ga0111539_111861122 224
71 3300013104 Ga0157370_10103446 Ga0157370_101034462 224
72 3300048905 Ga0496102_0054051 Ga0496102_0054051_919_1677 227
73 3300048906 Ga0496103_0026841 Ga0496103_0026841_2430_3188 227
74 3300048910 Ga0496107_0307578 Ga0496107_0307578_286_1044 227
75 3300006038 Ga0075365_10035630 Ga0075365_100356303 228
76 3300025912 Ga0207707_10245022 Ga0207707_102450222 229
77 3300005327 Ga0070658_10004115 Ga0070658_100041156 230
78 3300025909 Ga0207705_10008797 Ga0207705_100087976 230
79 3300025917 Ga0207660_10274877 Ga0207660_102748771 230
80 3300005563 Ga0068855_100080904 Ga0068855_1000809042 231
81 3300006178 Ga0075367_10002554 Ga0075367_100025543 231
82 3300006195 Ga0075366_10104069 Ga0075366_101040692 231
83 3300013308 Ga0157375_10370640 Ga0157375_103706402 231
84 3300025949 Ga0207667_10060798 Ga0207667_100607982 231
85 3300027866 Ga0209813_10022512 Ga0209813_100225122 231
86 3300049579 Ga0501043_0208891 Ga0501043_0208891_474_1178 231
87 3300049744 Ga0501083_0083937 Ga0501083_0083937_1342_2046 231
88 3300005614 Ga0068856_101052216 Ga0068856_1010522161 232
89 3300005293 Ga0065715_10103206 Ga0065715_101032062 233
90 3300005367 Ga0070667_100382783 Ga0070667_1003827832 233
91 3300005840 Ga0068870_10494532 Ga0068870_104945321 233
92 3300014325 Ga0163163_10301498 Ga0163163_103014982 233
93 3300028381 Ga0268264_10732932 Ga0268264_107329321 233
94 3300037068 Ga0373925_0697635 Ga0373925_0697635_122_826 233
95 3300046462 Ga0495651_0239611 Ga0495651_0239611_32_763 233
96 3300046463 Ga0495653_0193452 Ga0495653_0193452_138_842 233
97 3300046516 Ga0495628_0111016 Ga0495628_0111016_703_1407 233
98 3300046543 Ga0495645_0006701 Ga0495645_0006701_190_894 233
99 3300046559 Ga0495667_0054452 Ga0495667_0054452_280_984 233
100 3300046679 Ga0495623_0232552 Ga0495623_0232552_76_807 233
101 3300047319 Ga0495674_0086808 Ga0495674_0086808_1103_1807 233
102 3300047471 Ga0495684_0056541 Ga0495684_0056541_1689_2393 233
103 3300049571 Ga0501034_0286693 Ga0501034_0286693_24_728 233
104 3300049572 Ga0501036_0090277 Ga0501036_0090277_353_1057 233
105 3300049574 Ga0501038_0007862 Ga0501038_0007862_446_1150 233
106 3300049575 Ga0501039_0229510 Ga0501039_0229510_427_1131 233
107 3300049580 Ga0501046_0185162 Ga0501046_0185162_225_929 233
108 3300049581 Ga0501047_0011774 Ga0501047_0011774_2187_2891 233
109 3300049583 Ga0501067_0095106 Ga0501067_0095106_249_953 233
110 3300049585 Ga0501069_0141113 Ga0501069_0141113_205_909 233
111 3300049589 Ga0501073_0023893 Ga0501073_0023893_2434_3138 233
112 3300049593 Ga0501077_0058713 Ga0501077_0058713_220_924 233
113 3300049823 Ga0501044_0507626 Ga0501044_0507626_170_874 233
114 3300050515 nmdc:mga0a205_99619_c1 nmdc:mga0a205_99619_c1_1596_2318 233
115 3300060353 Ga0501082_0049490 Ga0501082_0049490_529_1233 233
116 3300050510 nmdc:mga06r32_895779_c1 nmdc:mga06r32_895779_c1_18_731 235
117 3300005471 Ga0070698_100305444 Ga0070698_1003054442 236
118 3300006051 Ga0075364_10002871 Ga0075364_100028714 236
119 3300027876 Ga0209974_10096556 Ga0209974_100965561 236
120 3300049569 Ga0501032_0012350 Ga0501032_0012350_4869_5588 236
121 3300049573 Ga0501037_0101125 Ga0501037_0101125_54_773 236
122 3300049574 Ga0501038_0018403 Ga0501038_0018403_145_864 236
123 3300049575 Ga0501039_0048310 Ga0501039_0048310_250_969 236
124 3300049579 Ga0501043_0362628 Ga0501043_0362628_193_912 236
125 3300049580 Ga0501046_0043683 Ga0501046_0043683_240_959 236
126 3300049581 Ga0501047_0001050 Ga0501047_0001050_16322_17041 236
127 3300049585 Ga0501069_0053258 Ga0501069_0053258_1052_1771 236
128 3300049589 Ga0501073_0481106 Ga0501073_0481106_78_797 236
129 3300049742 Ga0501080_0020134 Ga0501080_0020134_5034_5753 236
130 3300049744 Ga0501083_0062678 Ga0501083_0062678_992_1711 236
131 3300049744 Ga0501083_0261862 Ga0501083_0261862_87_806 236
132 3300049822 Ga0501035_0119309 Ga0501035_0119309_239_958 236
133 3300049823 Ga0501044_0029616 Ga0501044_0029616_4507_5226 236
134 3300050491 nmdc:mga00v17_6134_c1 nmdc:mga00v17_6134_c1_5439_6164 236
135 3300050493 nmdc:mga0k408_4593_c1 nmdc:mga0k408_4593_c1_5686_6411 236
136 3300050495 nmdc:mga04h51_26616_c1 nmdc:mga04h51_26616_c1_623_1348 236
137 3300053129 Ga0500628_006560 Ga0500628_006560_813_1535 236
138 3300054114 Ga0501084_0007033 Ga0501084_0007033_802_1521 236
139 3300006042 Ga0075368_10046821 Ga0075368_100468212 238
140 3300006178 Ga0075367_10080549 Ga0075367_100805492 238
141 3300006195 Ga0075366_10023764 Ga0075366_100237642 238
142 3300013296 Ga0157374_10118244 Ga0157374_101182442 238
143 3300027866 Ga0209813_10043305 Ga0209813_100433052 238
144 3300050507 nmdc:mga05p37_347694_c1 nmdc:mga05p37_347694_c1_60_815 238
145 3300005338 Ga0068868_100078000 Ga0068868_1000780002 239
146 3300009177 Ga0105248_10055040 Ga0105248_100550403 239
147 3300009545 Ga0105237_10269200 Ga0105237_102692002 239
148 3300010375 Ga0105239_10068642 Ga0105239_100686425 239
149 3300025913 Ga0207695_10192998 Ga0207695_101929983 239
150 3300025914 Ga0207671_10106662 Ga0207671_101066622 239
151 3300025941 Ga0207711_10168143 Ga0207711_101681432 239
152 3300047444 Ga0495675_0098373 Ga0495675_0098373_989_1711 239
153 3300050493 nmdc:mga0k408_99280_c1 nmdc:mga0k408_99280_c1_207_932 239
154 3300050494 nmdc:mga06z11_77509_c1 nmdc:mga06z11_77509_c1_192_917 239
155 3300050495 nmdc:mga04h51_32752_c1 nmdc:mga04h51_32752_c1_81_806 239
156 3300025916 Ga0207663_10142948 Ga0207663_101429482 240
157 3300005617 Ga0068859_100164677 Ga0068859_1001646771 241
158 3300005843 Ga0068860_100338988 Ga0068860_1003389882 241
159 3300006931 Ga0097620_100164673 Ga0097620_1001646733 241
160 3300013296 Ga0157374_10679200 Ga0157374_106792001 242
161 3300025942 Ga0207689_10052777 Ga0207689_100527772 242
162 3300006871 Ga0075434_100062571 Ga0075434_1000625712 243
163 3300035114 Ga0373939_0113736 Ga0373939_0113736_12_779 243
164 3300039437 Ga0436365_0973064 Ga0436365_0973064_756_1511 243
165 3300050512 nmdc:mga0n895_61095_c1 nmdc:mga0n895_61095_c1_1972_2739 243
166 3300050515 nmdc:mga0a205_6227_c2 nmdc:mga0a205_6227_c2_4122_4889 243
167 3300010375 Ga0105239_10637317 Ga0105239_106373172 245
168 3300005356 Ga0070674_100029131 Ga0070674_1000291312 246
169 3300005364 Ga0070673_100169082 Ga0070673_1001690822 246
170 3300005456 Ga0070678_100071102 Ga0070678_1000711022 246
171 3300005841 Ga0068863_100622875 Ga0068863_1006228751 246
172 3300006358 Ga0068871_100525701 Ga0068871_1005257012 246
173 3300006852 Ga0075433_10070922 Ga0075433_100709222 246
174 3300009094 Ga0111539_10746144 Ga0111539_107461441 246
175 3300009147 Ga0114129_10638978 Ga0114129_106389782 246
176 3300014325 Ga0163163_10088719 Ga0163163_100887194 246
177 3300025937 Ga0207669_10013180 Ga0207669_100131803 246
178 3300026121 Ga0207683_10022678 Ga0207683_100226784 246
179 3300050507 nmdc:mga05p37_331515_c2 nmdc:mga05p37_331515_c2_543_1298 246
180 3300050515 nmdc:mga0a205_25670_c2 nmdc:mga0a205_25670_c2_1966_2721 246
181 3300005329 Ga0070683_100854054 Ga0070683_1008540541 247
182 3300005330 Ga0070690_100528335 Ga0070690_1005283351 247
183 3300009094 Ga0111539_10056849 Ga0111539_100568493 247
184 3300014325 Ga0163163_10116628 Ga0163163_101166282 247
185 3300014969 Ga0157376_10010746 Ga0157376_100107462 247
186 3300036401 Ga0373937_0011944 Ga0373937_0011944_4461_5231 247
187 3300046472 Ga0495580_0000827 Ga0495580_0000827_10012_10773 247
188 3300046531 Ga0495665_0024424 Ga0495665_0024424_714_1475 247
189 3300005293 Ga0065715_10051770 Ga0065715_100517701 248
190 3300005331 Ga0070670_100244090 Ga0070670_1002440902 248
191 3300005334 Ga0068869_100374339 Ga0068869_1003743392 248
192 3300005340 Ga0070689_100359433 Ga0070689_1003594332 248
193 3300005353 Ga0070669_100001414 Ga0070669_1000014142 248
194 3300005354 Ga0070675_100263030 Ga0070675_1002630301 248
195 3300005367 Ga0070667_100107951 Ga0070667_1001079512 248
196 3300005535 Ga0070684_100152631 Ga0070684_1001526312 248
197 3300005577 Ga0068857_100006456 Ga0068857_1000064562 248
198 3300005840 Ga0068870_10040532 Ga0068870_100405322 248
199 3300005841 Ga0068863_100033345 Ga0068863_1000333453 248
200 3300005842 Ga0068858_100409189 Ga0068858_1004091892 248
201 3300006852 Ga0075433_10412929 Ga0075433_104129291 248
202 3300006880 Ga0075429_100243706 Ga0075429_1002437061 248
203 3300009093 Ga0105240_10402758 Ga0105240_104027582 248
204 3300009094 Ga0111539_10000205 Ga0111539_100002054 248
205 3300009148 Ga0105243_10329715 Ga0105243_103297151 248
206 3300009177 Ga0105248_10279710 Ga0105248_102797102 248
207 3300009553 Ga0105249_10000654 Ga0105249_100006543 248
208 3300011119 Ga0105246_10276121 Ga0105246_102761211 248
209 3300025913 Ga0207695_10456817 Ga0207695_104568172 248
210 3300025923 Ga0207681_10010075 Ga0207681_100100751 248
211 3300025925 Ga0207650_10436643 Ga0207650_104366431 248
212 3300025941 Ga0207711_10166266 Ga0207711_101662662 248
213 3300025960 Ga0207651_10309254 Ga0207651_103092542 248
214 3300026035 Ga0207703_10141280 Ga0207703_101412803 248
215 3300026075 Ga0207708_10169456 Ga0207708_101694562 248
216 3300026088 Ga0207641_10100921 Ga0207641_101009214 248
217 3300026116 Ga0207674_10009939 Ga0207674_100099395 248
218 3300027907 Ga0207428_10009239 Ga0207428_100092396 248
219 3300027907 Ga0207428_10054935 Ga0207428_100549352 248
220 3300028380 Ga0268265_10016278 Ga0268265_100162782 248
221 3300035111 Ga0373923_0214753 Ga0373923_0214753_91_855 248
222 3300035118 Ga0373954_0178585 Ga0373954_0178585_118_882 248
223 3300042437 Ga0439444_0026169 Ga0439444_0026169_61_828 248
224 3300046462 Ga0495651_0017269 Ga0495651_0017269_2521_3285 248
225 3300046529 Ga0495652_0181761 Ga0495652_0181761_375_1139 248
226 3300046559 Ga0495667_0044805 Ga0495667_0044805_469_1233 248
227 3300046678 Ga0495599_0053337 Ga0495599_0053337_221_985 248
228 3300047319 Ga0495674_0010281 Ga0495674_0010281_771_1535 248
229 3300047322 Ga0495680_0238256 Ga0495680_0238256_187_951 248
230 3300047471 Ga0495684_0003813 Ga0495684_0003813_1834_2598 248
231 3300047471 Ga0495684_0247521 Ga0495684_0247521_144_908 248
232 3300048088 Ga0495602_0045129 Ga0495602_0045129_2786_3550 248
233 3300050511 nmdc:mga08y16_250_c1 nmdc:mga08y16_250_c1_18579_19358 248
234 3300050511 nmdc:mga08y16_7828_c1 nmdc:mga08y16_7828_c1_9026_9790 248
235 3300050515 nmdc:mga0a205_436311_c1 nmdc:mga0a205_436311_c1_223_987 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06439

3keto-disac_hyd

3-keto-disaccharide hydrolase

44

249

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3imm-assembly3.cif.gz_C crystal structure of putative glycosyl hydrolase (yp_001301887.1) from parabacteroides distasonis atcc 8503 at 2.00 a resolution 0.6598 33 239
4b1m-assembly3.cif.gz_C carbohydrate binding module cbm66 from bacillus subtilis 0.6534 88 238
4fff-assembly2.cif.gz_B crystal structure of levan fructotransferase from arthrobacter ureafaciens 0.6506 88 241
3imm-assembly3.cif.gz_C crystal structure of putative glycosyl hydrolase (yp_001301887.1) from parabacteroides distasonis atcc 8503 at 2.00 a resolution 0.6506 33 239
3u1x-assembly1.cif.gz_B crystal structure of a putative glycosyl hydrolase (bdi_1869) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.6407 25 240
ID Description Score Start End Superfamily
af_A0A1D6DUP7_339_555_2.60.120.560 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7238 177 239 2.60.120.560
af_A0A2R8QDB2_1_107_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.7148 176 203 2.60.120.200
af_F4I1L3_628_775_3.30.700.30 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin; 0.7002 172 202 3.30.700.30
af_A0A1D6J3D9_935_1062_3.30.700.30 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin; 0.6894 172 202 3.30.700.30
3pigB02 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.6588 88 240 2.60.120.560
ID Description Score Start End GO Terms
AF-A0A2S2DWG9-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9018 32 240 GO:0016787
AF-U7US81-F1-model_v4 deleted 0.8987 32 240
AF-A0A1V5YZX4-F1-model_v4 GDSL-like Lipase/Acylhydrolase 0.8946 29 239 GO:0016787
AF-A0A3D4NZV5-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.8941 32 240 GO:0016787
AF-A0A3L7SX29-F1-model_v4 DUF1080 domain-containing protein 0.8936 23 246 GO:0016787

Feature Viewer

pLDDT pTM Quality
87.35 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map