F347377

General Info

Members Datasets Scaffolds Average Seq Length
234 125 468 264

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0146865|Ga0466958_0146865_31_879
Length 274
Sequence MPVGIITGSGTYALPDFSEAVLEKVDTPFGTCEVNRGRYGAVEALHVSRHGPGHVRLSNQVNHRASIWALKELGASAVIGCTACGAVDPSLELGSLIVFDDLHFISNRLPDGSLCTFFIEPGDPRRAHWILHGGPFSEEVRGVLCRAAEAAGHPVRTTGTYGHVDGPRFNTPTEIAQLAGCGVSAVSQTAGPETVLCGELELPFGLIGFVTDYANEVKPGEPTPVATLIELMGRSTGLFADVLLRALPELEPASASAAGTVFRLEGRSPGVAGP

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
41 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
68 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
75 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
76 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
77 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
78 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
79 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
80 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
81 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
82 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
83 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
84 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
85 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
86 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
87 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
90 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
91 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
92 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
93 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
94 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
95 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
98 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
99 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
100 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
101 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
104 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
125 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 15.38
Rhizosphere 76.5
Stem 0
Stem Tuber 0
Unclassified 10.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0146865 3300045836 Bacteria 1486
2 Ga0070683_100014783 3300005329 Bacteria 6839
3 Ga0070690_100137835 3300005330 Bacteria 1654
4 Ga0070666_10181153 3300005335 Bacteria 1478
5 Ga0070682_100456487 3300005337 Bacteria 980
6 Ga0068868_100085309 3300005338 Bacteria 2537
7 Ga0068868_100277668 3300005338 Bacteria 1417
8 Ga0070691_10152755 3300005341 Bacteria 1185
9 Ga0070687_100040777 3300005343 Bacteria 2342
10 Ga0070692_10132183 3300005345 Bacteria 1404
11 Ga0070688_100140910 3300005365 Bacteria 1638
12 Ga0070659_100019656 3300005366 Bacteria 5124
13 Ga0070709_10108708 3300005434 Unclassified 1860
14 Ga0070714_100008380 3300005435 Bacteria 8067
15 Ga0070714_100328365 3300005435 Bacteria 1432
16 Ga0070714_100352996 3300005435 Unclassified 1381
17 Ga0070714_100454273 3300005435 Bacteria 1217
18 Ga0070714_100487122 3300005435 Bacteria 1175
19 Ga0070713_100215342 3300005436 Bacteria 1741
20 Ga0070711_100060847 3300005439 Unclassified 2626
21 Ga0070711_100185954 3300005439 Bacteria 1593
22 Ga0070684_100358046 3300005535 Bacteria 1343
23 Ga0070686_100007816 3300005544 Bacteria 5976
24 Ga0070695_100107502 3300005545 Bacteria 1888
25 Ga0070664_100322191 3300005564 Bacteria 1401
26 Ga0068857_100093666 3300005577 Bacteria 2690
27 Ga0070702_100094867 3300005615 Bacteria 1817
28 Ga0068866_10039466 3300005718 Bacteria 2331
29 Ga0068861_100004135 3300005719 Bacteria 9731
30 Ga0068861_100200740 3300005719 Bacteria 1674
31 Ga0068870_10192237 3300005840 Bacteria 1232
32 Ga0068870_10414710 3300005840 Bacteria 880
33 Ga0068860_100836583 3300005843 Bacteria 935
34 Ga0081455_10005724 3300005937 Bacteria 13549
35 Ga0081539_10009859 3300005985 Bacteria 7880
36 Ga0070717_10013949 3300006028 Bacteria 6171
37 Ga0070717_10076677 3300006028 Bacteria 2798
38 Ga0070717_10161525 3300006028 Bacteria 1944
39 Ga0070717_10542188 3300006028 Bacteria 1053
40 Ga0105245_10070873 3300009098 Bacteria 3164
41 Ga0105245_10251120 3300009098 Bacteria 1718
42 Ga0105242_10257855 3300009176 Bacteria 1574
43 Ga0105242_10453484 3300009176 Bacteria 1209
44 Ga0105239_10244562 3300010375 Bacteria 2014
45 Ga0105246_10069379 3300011119 Bacteria 2475
46 Ga0105246_10496738 3300011119 Bacteria 1035
47 Ga0157372_10243057 3300013307 Bacteria 2089
48 Ga0157375_10124104 3300013308 Bacteria 2695
49 Ga0163163_10193156 3300014325 Bacteria 2084
50 Ga0157379_10004505 3300014968 Bacteria 11948
51 Ga0157379_10428713 3300014968 Bacteria 1218
52 Ga0157376_10632690 3300014969 Bacteria 1068
53 Ga0213874_10001910 3300021377 Bacteria 4382
54 Ga0213876_10032204 3300021384 Bacteria 2765
55 Ga0213876_10040766 3300021384 Unclassified 2453
56 Ga0213876_10082139 3300021384 Bacteria 1705
57 Ga0213875_10001672 3300021388 Bacteria 13961
58 Ga0213875_10012499 3300021388 Bacteria 4190
59 Ga0207656_10020292 3300025321 Bacteria 2640
60 Ga0207710_10165253 3300025900 Bacteria 1080
61 Ga0207647_10118774 3300025904 Bacteria 1560
62 Ga0207663_10121515 3300025916 Unclassified 1789
63 Ga0207662_10065890 3300025918 Bacteria 2181
64 Ga0207687_10034633 3300025927 Bacteria 3429
65 Ga0207700_10055696 3300025928 Bacteria 2973
66 Ga0207700_10608483 3300025928 Bacteria 973
67 Ga0207664_10149896 3300025929 Bacteria 1980
68 Ga0207664_10293810 3300025929 Unclassified 1428
69 Ga0207664_10378766 3300025929 Bacteria 1256
70 Ga0207644_10541861 3300025931 Bacteria 963
71 Ga0207706_10251025 3300025933 Bacteria 1545
72 Ga0207686_10016782 3300025934 Bacteria 4112
73 Ga0207709_10158502 3300025935 Bacteria 1576
74 Ga0207689_10034222 3300025942 Bacteria 4220
75 Ga0207661_10575436 3300025944 Bacteria 1033
76 Ga0207679_10300356 3300025945 Bacteria 1384
77 Ga0207677_10157940 3300026023 Bacteria 1758
78 Ga0207677_10512754 3300026023 Bacteria 1039
79 Ga0207702_10195322 3300026078 Bacteria 1873
80 Ga0207641_10070067 3300026088 Bacteria 3013
81 Ga0207648_10112488 3300026089 Bacteria 2390
82 Ga0207676_10601987 3300026095 Bacteria 1056
83 Ga0207674_10023709 3300026116 Bacteria 6568
84 Ga0207675_100049878 3300026118 Bacteria 3906
85 Ga0207675_100208629 3300026118 Bacteria 1878
86 Ga0207675_100627288 3300026118 Bacteria 1080
87 Ga0207683_10063211 3300026121 Bacteria 3261
88 Ga0207683_10298251 3300026121 Bacteria 1474
89 Ga0268265_10609821 3300028380 Bacteria 1044
90 Ga0307405_10344796 3300031731 Bacteria 1147
91 Ga0307415_100489456 3300032126 Bacteria 1073
92 Ga0307415_100572716 3300032126 Bacteria 1000
93 Ga0373924_0139329 3300035410 Bacteria 1058
94 Ga0373933_0030565 3300035724 Bacteria 3119
95 Ga0395899_0229640 3300037312 Bacteria 1282
96 Ga0395900_0638658 3300037418 Bacteria 1002
97 Ga0395898_0104867 3300037466 Bacteria 2711
98 Ga0436364_0014949 3300037853 Unclassified 1746
99 Ga0436364_0046247 3300037853 Bacteria 1416
100 Ga0436364_0384140 3300037853 Unclassified 1445
101 Ga0436364_0632249 3300037853 Bacteria 14129
102 Ga0436364_1093515 3300037853 Bacteria 2234
103 Ga0436364_1110567 3300037853 Unclassified 1177
104 Ga0395901_0121725 3300038443 Bacteria 2742
105 Ga0395901_0502637 3300038443 Bacteria 1234
106 Ga0436365_0125691 3300039437 Bacteria 4884
107 Ga0436365_0836366 3300039437 Bacteria 2707
108 Ga0436365_1166789 3300039437 Bacteria 6301
109 Ga0436365_1220022 3300039437 Bacteria 4375
110 Ga0436365_1765691 3300039437 Bacteria 2347
111 Ga0436365_1821214 3300039437 Bacteria 4016
112 Ga0436363_0609902 3300039450 Bacteria 19913
113 Ga0436362_0224955 3300039453 Bacteria 1632
114 Ga0436362_0426688 3300039453 Unclassified 988
115 Ga0436362_1159079 3300039453 Bacteria 3113
116 Ga0466969_0004574 3300044656 Bacteria 7369
117 Ga0466969_0154881 3300044656 Bacteria 1055
118 Ga0466966_0020605 3300044684 Bacteria 4333
119 Ga0466966_0088554 3300044684 Bacteria 1924
120 Ga0466966_0109674 3300044684 Bacteria 1702
121 Ga0466966_0130942 3300044684 Bacteria 1536
122 Ga0466966_0225153 3300044684 Unclassified 1132
123 Ga0466961_0001927 3300044693 Bacteria 12921
124 Ga0466961_0031637 3300044693 Bacteria 3402
125 Ga0466961_0053875 3300044693 Bacteria 2566
126 Ga0466961_0242349 3300044693 Bacteria 1108
127 Ga0466961_0249638 3300044693 Bacteria 1090
128 Ga0466963_0002205 3300044694 Bacteria 10770
129 Ga0466963_0011212 3300044694 Bacteria 5455
130 Ga0466963_0018535 3300044694 Bacteria 4354
131 Ga0466963_0019689 3300044694 Bacteria 4237
132 Ga0466963_0057459 3300044694 Bacteria 2591
133 Ga0466963_0108280 3300044694 Unclassified 1906
134 Ga0466964_0156509 3300044706 Bacteria 1061
135 Ga0466971_0037354 3300044719 Bacteria 2176
136 Ga0466971_0068433 3300044719 Unclassified 1610
137 Ga0466968_0136450 3300044735 Bacteria 1119
138 Ga0466970_0057925 3300044765 Bacteria 2073
139 Ga0466970_0288591 3300044765 Bacteria 924
140 Ga0466970_0289644 3300044765 Bacteria 922
141 Ga0466957_0001648 3300044842 Bacteria 11713
142 Ga0466957_0023789 3300044842 Bacteria 3624
143 Ga0466957_0026801 3300044842 Bacteria 3421
144 Ga0466957_0132758 3300044842 Unclassified 1597
145 Ga0466957_0240919 3300044842 Unclassified 1200
146 Ga0466957_0538251 3300044842 Bacteria 813
147 Ga0466960_0021895 3300044901 Bacteria 2852
148 Ga0466960_0246658 3300044901 Bacteria 991
149 Ga0466959_0024437 3300045049 Bacteria 4476
150 Ga0466959_0026555 3300045049 Bacteria 4291
151 Ga0466959_0030613 3300045049 Bacteria 3985
152 Ga0466959_0040642 3300045049 Bacteria 3435
153 Ga0466959_0049759 3300045049 Bacteria 3078
154 Ga0466959_0108226 3300045049 Bacteria 1986
155 Ga0466959_0191689 3300045049 Bacteria 1426
156 Ga0466959_0241904 3300045049 Bacteria 1246
157 Ga0466959_0259967 3300045049 Bacteria 1195
158 Ga0466958_0000546 3300045836 Bacteria 16007
159 Ga0466958_0004355 3300045836 Bacteria 7468
160 Ga0466958_0007885 3300045836 Bacteria 5885
161 Ga0466958_0015464 3300045836 Unclassified 4373
162 Ga0466958_0026443 3300045836 Bacteria 3429
163 Ga0466958_0052176 3300045836 Bacteria 2478
164 Ga0466958_0077362 3300045836 Bacteria 2043
165 Ga0466958_0229540 3300045836 Bacteria 1185
166 Ga0466967_0007702 3300045976 Bacteria 7804
167 Ga0466967_0024401 3300045976 Bacteria 4971
168 Ga0466967_0026771 3300045976 Bacteria 4784
169 Ga0466967_0074237 3300045976 Bacteria 3054
170 Ga0466967_0258713 3300045976 Bacteria 1665
171 Ga0466967_0454837 3300045976 Bacteria 1252
172 Ga0495590_0079884 3300046457 Bacteria 1152
173 Ga0495629_0238353 3300046459 Bacteria 1253
174 Ga0495582_0242044 3300046473 Bacteria 1034
175 Ga0495662_0098253 3300046476 Bacteria 1432
176 Ga0495664_0191964 3300046477 Unclassified 1238
177 Ga0495608_0011844 3300046511 Bacteria 6068
178 Ga0495608_0055750 3300046511 Bacteria 2612
179 Ga0495618_0011291 3300046514 Bacteria 5414
180 Ga0495628_0029411 3300046516 Unclassified 4454
181 Ga0495652_0079675 3300046529 Bacteria 2707
182 Ga0495587_0025609 3300046536 Bacteria 3605
183 Ga0495634_0154911 3300046642 Bacteria 1447
184 Ga0495657_0030164 3300046675 Bacteria 3799
185 Ga0495623_0067000 3300046679 Unclassified 2242
186 Ga0495623_0413280 3300046679 Unclassified 724
187 Ga0495613_0018012 3300046689 Bacteria 5264
188 Ga0495600_0017594 3300046809 Bacteria 4549
189 Ga0495581_0149425 3300047315 Bacteria 1364
190 Ga0495674_0277973 3300047319 Bacteria 1372
191 Ga0495593_0027286 3300047673 Unclassified 3144
192 Ga0496100_0208604 3300048903 Bacteria 1428
193 Ga0496100_0234202 3300048903 Bacteria 1352
194 Ga0496103_0038804 3300048906 Bacteria 2925
195 Ga0496103_0434086 3300048906 Bacteria 843
196 Ga0496104_0007288 3300048907 Bacteria 9760
197 Ga0496105_0006678 3300048908 Bacteria 8881
198 Ga0496105_0012223 3300048908 Bacteria 6797
199 Ga0496105_0028955 3300048908 Bacteria 4532
200 Ga0496105_0150480 3300048908 Unclassified 1913
201 Ga0496105_0200989 3300048908 Bacteria 1627
202 Ga0496106_0027878 3300048909 Bacteria 4205
203 Ga0496107_0001173 3300048910 Bacteria 15902
204 Ga0496108_0082109 3300048911 Bacteria 2732
205 Ga0496108_0130834 3300048911 Bacteria 2157
206 Ga0496108_0141897 3300048911 Bacteria 2070
207 Ga0496108_0154927 3300048911 Bacteria 1978
208 Ga0496108_0546477 3300048911 Bacteria 1011
209 Ga0496109_0000437 3300048912 Bacteria 36293
210 Ga0496109_0000682 3300048912 Bacteria 28239
211 Ga0496109_0075013 3300048912 Bacteria 3110
212 Ga0496109_0120160 3300048912 Bacteria 2447
213 Ga0496110_0002572 3300048913 Bacteria 13640
214 Ga0496110_0010370 3300048913 Bacteria 7574
215 Ga0496110_0138725 3300048913 Unclassified 2198
216 Ga0496110_0373675 3300048913 Bacteria 1299
217 Ga0496111_0018316 3300048914 Bacteria 4850
218 Ga0496111_0212369 3300048914 Bacteria 1437
219 Ga0496112_0014290 3300048915 Bacteria 7356
220 Ga0496112_0142925 3300048915 Bacteria 2362
221 Ga0496112_0219675 3300048915 Bacteria 1856
222 Ga0496112_0431290 3300048915 Bacteria 1256
223 Ga0496112_0520667 3300048915 Unclassified 1124
224 Ga0496113_0137978 3300048916 Bacteria 1917
225 Ga0496114_0089102 3300048917 Bacteria 2618
226 Ga0496115_0139357 3300048918 Bacteria 2001
227 Ga0496115_0284170 3300048918 Bacteria 1358
228 Ga0501031_0078820 3300049568 Bacteria 2146
229 Ga0501047_0215428 3300049581 Bacteria 1777
230 nmdc:mga08y16_724288_c1 3300050511 Bacteria 993
231 Ga0495595_0047243 3300053084 Unclassified 1985
232 Ga0466962_0007152 3300061719 Bacteria 5347
233 Ga0466962_0030038 3300061719 Bacteria 2602
234 Ga0466962_0140019 3300061719 Archaea 1172
235 Ga0466958_0146865
236 Ga0070683_100014783
237 Ga0070690_100137835
238 Ga0070666_10181153
239 Ga0070682_100456487
240 Ga0068868_100085309
241 Ga0068868_100277668
242 Ga0070691_10152755
243 Ga0070687_100040777
244 Ga0070692_10132183
245 Ga0070688_100140910
246 Ga0070659_100019656
247 Ga0070709_10108708
248 Ga0070714_100008380
249 Ga0070714_100328365
250 Ga0070714_100352996
251 Ga0070714_100454273
252 Ga0070714_100487122
253 Ga0070713_100215342
254 Ga0070711_100060847
255 Ga0070711_100185954
256 Ga0070684_100358046
257 Ga0070686_100007816
258 Ga0070695_100107502
259 Ga0070664_100322191
260 Ga0068857_100093666
261 Ga0070702_100094867
262 Ga0068866_10039466
263 Ga0068861_100004135
264 Ga0068861_100200740
265 Ga0068870_10192237
266 Ga0068870_10414710
267 Ga0068860_100836583
268 Ga0081455_10005724
269 Ga0081539_10009859
270 Ga0070717_10013949
271 Ga0070717_10076677
272 Ga0070717_10161525
273 Ga0070717_10542188
274 Ga0105245_10070873
275 Ga0105245_10251120
276 Ga0105242_10257855
277 Ga0105242_10453484
278 Ga0105239_10244562
279 Ga0105246_10069379
280 Ga0105246_10496738
281 Ga0157372_10243057
282 Ga0157375_10124104
283 Ga0163163_10193156
284 Ga0157379_10004505
285 Ga0157379_10428713
286 Ga0157376_10632690
287 Ga0213874_10001910
288 Ga0213876_10032204
289 Ga0213876_10040766
290 Ga0213876_10082139
291 Ga0213875_10001672
292 Ga0213875_10012499
293 Ga0207656_10020292
294 Ga0207710_10165253
295 Ga0207647_10118774
296 Ga0207663_10121515
297 Ga0207662_10065890
298 Ga0207687_10034633
299 Ga0207700_10055696
300 Ga0207700_10608483
301 Ga0207664_10149896
302 Ga0207664_10293810
303 Ga0207664_10378766
304 Ga0207644_10541861
305 Ga0207706_10251025
306 Ga0207686_10016782
307 Ga0207709_10158502
308 Ga0207689_10034222
309 Ga0207661_10575436
310 Ga0207679_10300356
311 Ga0207677_10157940
312 Ga0207677_10512754
313 Ga0207702_10195322
314 Ga0207641_10070067
315 Ga0207648_10112488
316 Ga0207676_10601987
317 Ga0207674_10023709
318 Ga0207675_100049878
319 Ga0207675_100208629
320 Ga0207675_100627288
321 Ga0207683_10063211
322 Ga0207683_10298251
323 Ga0268265_10609821
324 Ga0307405_10344796
325 Ga0307415_100489456
326 Ga0307415_100572716
327 Ga0373924_0139329
328 Ga0373933_0030565
329 Ga0395899_0229640
330 Ga0395900_0638658
331 Ga0395898_0104867
332 Ga0436364_0014949
333 Ga0436364_0046247
334 Ga0436364_0384140
335 Ga0436364_0632249
336 Ga0436364_1093515
337 Ga0436364_1110567
338 Ga0395901_0121725
339 Ga0395901_0502637
340 Ga0436365_0125691
341 Ga0436365_0836366
342 Ga0436365_1166789
343 Ga0436365_1220022
344 Ga0436365_1765691
345 Ga0436365_1821214
346 Ga0436363_0609902
347 Ga0436362_0224955
348 Ga0436362_0426688
349 Ga0436362_1159079
350 Ga0466969_0004574
351 Ga0466969_0154881
352 Ga0466966_0020605
353 Ga0466966_0088554
354 Ga0466966_0109674
355 Ga0466966_0130942
356 Ga0466966_0225153
357 Ga0466961_0001927
358 Ga0466961_0031637
359 Ga0466961_0053875
360 Ga0466961_0242349
361 Ga0466961_0249638
362 Ga0466963_0002205
363 Ga0466963_0011212
364 Ga0466963_0018535
365 Ga0466963_0019689
366 Ga0466963_0057459
367 Ga0466963_0108280
368 Ga0466964_0156509
369 Ga0466971_0037354
370 Ga0466971_0068433
371 Ga0466968_0136450
372 Ga0466970_0057925
373 Ga0466970_0288591
374 Ga0466970_0289644
375 Ga0466957_0001648
376 Ga0466957_0023789
377 Ga0466957_0026801
378 Ga0466957_0132758
379 Ga0466957_0240919
380 Ga0466957_0538251
381 Ga0466960_0021895
382 Ga0466960_0246658
383 Ga0466959_0024437
384 Ga0466959_0026555
385 Ga0466959_0030613
386 Ga0466959_0040642
387 Ga0466959_0049759
388 Ga0466959_0108226
389 Ga0466959_0191689
390 Ga0466959_0241904
391 Ga0466959_0259967
392 Ga0466958_0000546
393 Ga0466958_0004355
394 Ga0466958_0007885
395 Ga0466958_0015464
396 Ga0466958_0026443
397 Ga0466958_0052176
398 Ga0466958_0077362
399 Ga0466958_0229540
400 Ga0466967_0007702
401 Ga0466967_0024401
402 Ga0466967_0026771
403 Ga0466967_0074237
404 Ga0466967_0258713
405 Ga0466967_0454837
406 Ga0495590_0079884
407 Ga0495629_0238353
408 Ga0495582_0242044
409 Ga0495662_0098253
410 Ga0495664_0191964
411 Ga0495608_0011844
412 Ga0495608_0055750
413 Ga0495618_0011291
414 Ga0495628_0029411
415 Ga0495652_0079675
416 Ga0495587_0025609
417 Ga0495634_0154911
418 Ga0495657_0030164
419 Ga0495623_0067000
420 Ga0495623_0413280
421 Ga0495613_0018012
422 Ga0495600_0017594
423 Ga0495581_0149425
424 Ga0495674_0277973
425 Ga0495593_0027286
426 Ga0496100_0208604
427 Ga0496100_0234202
428 Ga0496103_0038804
429 Ga0496103_0434086
430 Ga0496104_0007288
431 Ga0496105_0006678
432 Ga0496105_0012223
433 Ga0496105_0028955
434 Ga0496105_0150480
435 Ga0496105_0200989
436 Ga0496106_0027878
437 Ga0496107_0001173
438 Ga0496108_0082109
439 Ga0496108_0130834
440 Ga0496108_0141897
441 Ga0496108_0154927
442 Ga0496108_0546477
443 Ga0496109_0000437
444 Ga0496109_0000682
445 Ga0496109_0075013
446 Ga0496109_0120160
447 Ga0496110_0002572
448 Ga0496110_0010370
449 Ga0496110_0138725
450 Ga0496110_0373675
451 Ga0496111_0018316
452 Ga0496111_0212369
453 Ga0496112_0014290
454 Ga0496112_0142925
455 Ga0496112_0219675
456 Ga0496112_0431290
457 Ga0496112_0520667
458 Ga0496113_0137978
459 Ga0496114_0089102
460 Ga0496115_0139357
461 Ga0496115_0284170
462 Ga0501031_0078820
463 Ga0501047_0215428
464 nmdc:mga08y16_724288_c1
465 Ga0495595_0047243
466 Ga0466962_0007152
467 Ga0466962_0030038
468 Ga0466962_0140019

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01048

PNP_UDP_1

Phosphorylase superfamily

2

248

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sd2-assembly1.cif.gz_A structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with 5'-methylthiotubercidin 0.9123 2 246
3oze-assembly2.cif.gz_E crystal structure of human 5'-deoxy-5'-methyladenosine phosphorylase 0.9122 2 246
3t94-assembly1.cif.gz_A crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase (mtap) ii complexed with 5'-deoxy-5'-methylthioadenosine and sulfate 0.9097 2 248
3oze-assembly1.cif.gz_B crystal structure of human 5'-deoxy-5'-methyladenosine phosphorylase 0.9081 2 246
3oze-assembly2.cif.gz_D crystal structure of human 5'-deoxy-5'-methyladenosine phosphorylase 0.9071 2 246
ID Description Score Start End Superfamily
3t94A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9097 2 248 3.40.50.1580
af_Q60367_1_252_3.40.50.1580 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.8892 1 244 3.40.50.1580
af_O06401_3_259_3.40.50.1580 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.8881 2 248 3.40.50.1580
af_Q09438_1_274_3.40.50.1580 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.887 2 246 3.40.50.1580
af_Q7ZV22_6_280_3.40.50.1580 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.8782 2 246 3.40.50.1580
ID Description Score Start End GO Terms
AF-A0A1F2UNI4-F1-model_v4 Nucleoside phosphorylase domain-containing protein 0.9699 1 261 GO:0005829
GO:0009116
GO:0017061
GO:0019509
AF-A0A7Y5XC66-F1-model_v4 deleted 0.9671 50 261
AF-A0A1F2UNI4-F1-model_v4 Nucleoside phosphorylase domain-containing protein 0.9663 1 261 GO:0005829
GO:0009116
GO:0017061
GO:0019509
AF-A0A2N1UXA6-F1-model_v4 Phosphorylase 0.9646 2 261 GO:0005829
GO:0009116
GO:0017061
GO:0019509
AF-A0A7Y5XC66-F1-model_v4 deleted 0.9582 50 261

Map