F347377
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 234 | 125 | 468 | 264 |
Family's Representative Sequence
| Representative Sequence | 3300045836|Ga0466958_0146865|Ga0466958_0146865_31_879 |
| Length | 274 |
| Sequence | MPVGIITGSGTYALPDFSEAVLEKVDTPFGTCEVNRGRYGAVEALHVSRHGPGHVRLSNQVNHRASIWALKELGASAVIGCTACGAVDPSLELGSLIVFDDLHFISNRLPDGSLCTFFIEPGDPRRAHWILHGGPFSEEVRGVLCRAAEAAGHPVRTTGTYGHVDGPRFNTPTEIAQLAGCGVSAVSQTAGPETVLCGELELPFGLIGFVTDYANEVKPGEPTPVATLIELMGRSTGLFADVLLRALPELEPASASAAGTVFRLEGRSPGVAGP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 21 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 23 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 24 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 25 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 26 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 27 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 28 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 39 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 40 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 41 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 66 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 67 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 68 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 69 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 70 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 71 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 72 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 73 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 74 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 75 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 76 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 77 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 78 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 79 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 80 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 81 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 82 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 83 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 84 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 85 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 86 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 87 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 88 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 89 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 108 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 109 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 110 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 111 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 112 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 113 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 114 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 115 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 116 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 117 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 118 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 119 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 120 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 121 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 122 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 124 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 15.38 |
| Rhizosphere | 76.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466958_0146865 | 3300045836 | Bacteria | 1486 |
| 2 | Ga0070683_100014783 | 3300005329 | Bacteria | 6839 |
| 3 | Ga0070690_100137835 | 3300005330 | Bacteria | 1654 |
| 4 | Ga0070666_10181153 | 3300005335 | Bacteria | 1478 |
| 5 | Ga0070682_100456487 | 3300005337 | Bacteria | 980 |
| 6 | Ga0068868_100085309 | 3300005338 | Bacteria | 2537 |
| 7 | Ga0068868_100277668 | 3300005338 | Bacteria | 1417 |
| 8 | Ga0070691_10152755 | 3300005341 | Bacteria | 1185 |
| 9 | Ga0070687_100040777 | 3300005343 | Bacteria | 2342 |
| 10 | Ga0070692_10132183 | 3300005345 | Bacteria | 1404 |
| 11 | Ga0070688_100140910 | 3300005365 | Bacteria | 1638 |
| 12 | Ga0070659_100019656 | 3300005366 | Bacteria | 5124 |
| 13 | Ga0070709_10108708 | 3300005434 | Unclassified | 1860 |
| 14 | Ga0070714_100008380 | 3300005435 | Bacteria | 8067 |
| 15 | Ga0070714_100328365 | 3300005435 | Bacteria | 1432 |
| 16 | Ga0070714_100352996 | 3300005435 | Unclassified | 1381 |
| 17 | Ga0070714_100454273 | 3300005435 | Bacteria | 1217 |
| 18 | Ga0070714_100487122 | 3300005435 | Bacteria | 1175 |
| 19 | Ga0070713_100215342 | 3300005436 | Bacteria | 1741 |
| 20 | Ga0070711_100060847 | 3300005439 | Unclassified | 2626 |
| 21 | Ga0070711_100185954 | 3300005439 | Bacteria | 1593 |
| 22 | Ga0070684_100358046 | 3300005535 | Bacteria | 1343 |
| 23 | Ga0070686_100007816 | 3300005544 | Bacteria | 5976 |
| 24 | Ga0070695_100107502 | 3300005545 | Bacteria | 1888 |
| 25 | Ga0070664_100322191 | 3300005564 | Bacteria | 1401 |
| 26 | Ga0068857_100093666 | 3300005577 | Bacteria | 2690 |
| 27 | Ga0070702_100094867 | 3300005615 | Bacteria | 1817 |
| 28 | Ga0068866_10039466 | 3300005718 | Bacteria | 2331 |
| 29 | Ga0068861_100004135 | 3300005719 | Bacteria | 9731 |
| 30 | Ga0068861_100200740 | 3300005719 | Bacteria | 1674 |
| 31 | Ga0068870_10192237 | 3300005840 | Bacteria | 1232 |
| 32 | Ga0068870_10414710 | 3300005840 | Bacteria | 880 |
| 33 | Ga0068860_100836583 | 3300005843 | Bacteria | 935 |
| 34 | Ga0081455_10005724 | 3300005937 | Bacteria | 13549 |
| 35 | Ga0081539_10009859 | 3300005985 | Bacteria | 7880 |
| 36 | Ga0070717_10013949 | 3300006028 | Bacteria | 6171 |
| 37 | Ga0070717_10076677 | 3300006028 | Bacteria | 2798 |
| 38 | Ga0070717_10161525 | 3300006028 | Bacteria | 1944 |
| 39 | Ga0070717_10542188 | 3300006028 | Bacteria | 1053 |
| 40 | Ga0105245_10070873 | 3300009098 | Bacteria | 3164 |
| 41 | Ga0105245_10251120 | 3300009098 | Bacteria | 1718 |
| 42 | Ga0105242_10257855 | 3300009176 | Bacteria | 1574 |
| 43 | Ga0105242_10453484 | 3300009176 | Bacteria | 1209 |
| 44 | Ga0105239_10244562 | 3300010375 | Bacteria | 2014 |
| 45 | Ga0105246_10069379 | 3300011119 | Bacteria | 2475 |
| 46 | Ga0105246_10496738 | 3300011119 | Bacteria | 1035 |
| 47 | Ga0157372_10243057 | 3300013307 | Bacteria | 2089 |
| 48 | Ga0157375_10124104 | 3300013308 | Bacteria | 2695 |
| 49 | Ga0163163_10193156 | 3300014325 | Bacteria | 2084 |
| 50 | Ga0157379_10004505 | 3300014968 | Bacteria | 11948 |
| 51 | Ga0157379_10428713 | 3300014968 | Bacteria | 1218 |
| 52 | Ga0157376_10632690 | 3300014969 | Bacteria | 1068 |
| 53 | Ga0213874_10001910 | 3300021377 | Bacteria | 4382 |
| 54 | Ga0213876_10032204 | 3300021384 | Bacteria | 2765 |
| 55 | Ga0213876_10040766 | 3300021384 | Unclassified | 2453 |
| 56 | Ga0213876_10082139 | 3300021384 | Bacteria | 1705 |
| 57 | Ga0213875_10001672 | 3300021388 | Bacteria | 13961 |
| 58 | Ga0213875_10012499 | 3300021388 | Bacteria | 4190 |
| 59 | Ga0207656_10020292 | 3300025321 | Bacteria | 2640 |
| 60 | Ga0207710_10165253 | 3300025900 | Bacteria | 1080 |
| 61 | Ga0207647_10118774 | 3300025904 | Bacteria | 1560 |
| 62 | Ga0207663_10121515 | 3300025916 | Unclassified | 1789 |
| 63 | Ga0207662_10065890 | 3300025918 | Bacteria | 2181 |
| 64 | Ga0207687_10034633 | 3300025927 | Bacteria | 3429 |
| 65 | Ga0207700_10055696 | 3300025928 | Bacteria | 2973 |
| 66 | Ga0207700_10608483 | 3300025928 | Bacteria | 973 |
| 67 | Ga0207664_10149896 | 3300025929 | Bacteria | 1980 |
| 68 | Ga0207664_10293810 | 3300025929 | Unclassified | 1428 |
| 69 | Ga0207664_10378766 | 3300025929 | Bacteria | 1256 |
| 70 | Ga0207644_10541861 | 3300025931 | Bacteria | 963 |
| 71 | Ga0207706_10251025 | 3300025933 | Bacteria | 1545 |
| 72 | Ga0207686_10016782 | 3300025934 | Bacteria | 4112 |
| 73 | Ga0207709_10158502 | 3300025935 | Bacteria | 1576 |
| 74 | Ga0207689_10034222 | 3300025942 | Bacteria | 4220 |
| 75 | Ga0207661_10575436 | 3300025944 | Bacteria | 1033 |
| 76 | Ga0207679_10300356 | 3300025945 | Bacteria | 1384 |
| 77 | Ga0207677_10157940 | 3300026023 | Bacteria | 1758 |
| 78 | Ga0207677_10512754 | 3300026023 | Bacteria | 1039 |
| 79 | Ga0207702_10195322 | 3300026078 | Bacteria | 1873 |
| 80 | Ga0207641_10070067 | 3300026088 | Bacteria | 3013 |
| 81 | Ga0207648_10112488 | 3300026089 | Bacteria | 2390 |
| 82 | Ga0207676_10601987 | 3300026095 | Bacteria | 1056 |
| 83 | Ga0207674_10023709 | 3300026116 | Bacteria | 6568 |
| 84 | Ga0207675_100049878 | 3300026118 | Bacteria | 3906 |
| 85 | Ga0207675_100208629 | 3300026118 | Bacteria | 1878 |
| 86 | Ga0207675_100627288 | 3300026118 | Bacteria | 1080 |
| 87 | Ga0207683_10063211 | 3300026121 | Bacteria | 3261 |
| 88 | Ga0207683_10298251 | 3300026121 | Bacteria | 1474 |
| 89 | Ga0268265_10609821 | 3300028380 | Bacteria | 1044 |
| 90 | Ga0307405_10344796 | 3300031731 | Bacteria | 1147 |
| 91 | Ga0307415_100489456 | 3300032126 | Bacteria | 1073 |
| 92 | Ga0307415_100572716 | 3300032126 | Bacteria | 1000 |
| 93 | Ga0373924_0139329 | 3300035410 | Bacteria | 1058 |
| 94 | Ga0373933_0030565 | 3300035724 | Bacteria | 3119 |
| 95 | Ga0395899_0229640 | 3300037312 | Bacteria | 1282 |
| 96 | Ga0395900_0638658 | 3300037418 | Bacteria | 1002 |
| 97 | Ga0395898_0104867 | 3300037466 | Bacteria | 2711 |
| 98 | Ga0436364_0014949 | 3300037853 | Unclassified | 1746 |
| 99 | Ga0436364_0046247 | 3300037853 | Bacteria | 1416 |
| 100 | Ga0436364_0384140 | 3300037853 | Unclassified | 1445 |
| 101 | Ga0436364_0632249 | 3300037853 | Bacteria | 14129 |
| 102 | Ga0436364_1093515 | 3300037853 | Bacteria | 2234 |
| 103 | Ga0436364_1110567 | 3300037853 | Unclassified | 1177 |
| 104 | Ga0395901_0121725 | 3300038443 | Bacteria | 2742 |
| 105 | Ga0395901_0502637 | 3300038443 | Bacteria | 1234 |
| 106 | Ga0436365_0125691 | 3300039437 | Bacteria | 4884 |
| 107 | Ga0436365_0836366 | 3300039437 | Bacteria | 2707 |
| 108 | Ga0436365_1166789 | 3300039437 | Bacteria | 6301 |
| 109 | Ga0436365_1220022 | 3300039437 | Bacteria | 4375 |
| 110 | Ga0436365_1765691 | 3300039437 | Bacteria | 2347 |
| 111 | Ga0436365_1821214 | 3300039437 | Bacteria | 4016 |
| 112 | Ga0436363_0609902 | 3300039450 | Bacteria | 19913 |
| 113 | Ga0436362_0224955 | 3300039453 | Bacteria | 1632 |
| 114 | Ga0436362_0426688 | 3300039453 | Unclassified | 988 |
| 115 | Ga0436362_1159079 | 3300039453 | Bacteria | 3113 |
| 116 | Ga0466969_0004574 | 3300044656 | Bacteria | 7369 |
| 117 | Ga0466969_0154881 | 3300044656 | Bacteria | 1055 |
| 118 | Ga0466966_0020605 | 3300044684 | Bacteria | 4333 |
| 119 | Ga0466966_0088554 | 3300044684 | Bacteria | 1924 |
| 120 | Ga0466966_0109674 | 3300044684 | Bacteria | 1702 |
| 121 | Ga0466966_0130942 | 3300044684 | Bacteria | 1536 |
| 122 | Ga0466966_0225153 | 3300044684 | Unclassified | 1132 |
| 123 | Ga0466961_0001927 | 3300044693 | Bacteria | 12921 |
| 124 | Ga0466961_0031637 | 3300044693 | Bacteria | 3402 |
| 125 | Ga0466961_0053875 | 3300044693 | Bacteria | 2566 |
| 126 | Ga0466961_0242349 | 3300044693 | Bacteria | 1108 |
| 127 | Ga0466961_0249638 | 3300044693 | Bacteria | 1090 |
| 128 | Ga0466963_0002205 | 3300044694 | Bacteria | 10770 |
| 129 | Ga0466963_0011212 | 3300044694 | Bacteria | 5455 |
| 130 | Ga0466963_0018535 | 3300044694 | Bacteria | 4354 |
| 131 | Ga0466963_0019689 | 3300044694 | Bacteria | 4237 |
| 132 | Ga0466963_0057459 | 3300044694 | Bacteria | 2591 |
| 133 | Ga0466963_0108280 | 3300044694 | Unclassified | 1906 |
| 134 | Ga0466964_0156509 | 3300044706 | Bacteria | 1061 |
| 135 | Ga0466971_0037354 | 3300044719 | Bacteria | 2176 |
| 136 | Ga0466971_0068433 | 3300044719 | Unclassified | 1610 |
| 137 | Ga0466968_0136450 | 3300044735 | Bacteria | 1119 |
| 138 | Ga0466970_0057925 | 3300044765 | Bacteria | 2073 |
| 139 | Ga0466970_0288591 | 3300044765 | Bacteria | 924 |
| 140 | Ga0466970_0289644 | 3300044765 | Bacteria | 922 |
| 141 | Ga0466957_0001648 | 3300044842 | Bacteria | 11713 |
| 142 | Ga0466957_0023789 | 3300044842 | Bacteria | 3624 |
| 143 | Ga0466957_0026801 | 3300044842 | Bacteria | 3421 |
| 144 | Ga0466957_0132758 | 3300044842 | Unclassified | 1597 |
| 145 | Ga0466957_0240919 | 3300044842 | Unclassified | 1200 |
| 146 | Ga0466957_0538251 | 3300044842 | Bacteria | 813 |
| 147 | Ga0466960_0021895 | 3300044901 | Bacteria | 2852 |
| 148 | Ga0466960_0246658 | 3300044901 | Bacteria | 991 |
| 149 | Ga0466959_0024437 | 3300045049 | Bacteria | 4476 |
| 150 | Ga0466959_0026555 | 3300045049 | Bacteria | 4291 |
| 151 | Ga0466959_0030613 | 3300045049 | Bacteria | 3985 |
| 152 | Ga0466959_0040642 | 3300045049 | Bacteria | 3435 |
| 153 | Ga0466959_0049759 | 3300045049 | Bacteria | 3078 |
| 154 | Ga0466959_0108226 | 3300045049 | Bacteria | 1986 |
| 155 | Ga0466959_0191689 | 3300045049 | Bacteria | 1426 |
| 156 | Ga0466959_0241904 | 3300045049 | Bacteria | 1246 |
| 157 | Ga0466959_0259967 | 3300045049 | Bacteria | 1195 |
| 158 | Ga0466958_0000546 | 3300045836 | Bacteria | 16007 |
| 159 | Ga0466958_0004355 | 3300045836 | Bacteria | 7468 |
| 160 | Ga0466958_0007885 | 3300045836 | Bacteria | 5885 |
| 161 | Ga0466958_0015464 | 3300045836 | Unclassified | 4373 |
| 162 | Ga0466958_0026443 | 3300045836 | Bacteria | 3429 |
| 163 | Ga0466958_0052176 | 3300045836 | Bacteria | 2478 |
| 164 | Ga0466958_0077362 | 3300045836 | Bacteria | 2043 |
| 165 | Ga0466958_0229540 | 3300045836 | Bacteria | 1185 |
| 166 | Ga0466967_0007702 | 3300045976 | Bacteria | 7804 |
| 167 | Ga0466967_0024401 | 3300045976 | Bacteria | 4971 |
| 168 | Ga0466967_0026771 | 3300045976 | Bacteria | 4784 |
| 169 | Ga0466967_0074237 | 3300045976 | Bacteria | 3054 |
| 170 | Ga0466967_0258713 | 3300045976 | Bacteria | 1665 |
| 171 | Ga0466967_0454837 | 3300045976 | Bacteria | 1252 |
| 172 | Ga0495590_0079884 | 3300046457 | Bacteria | 1152 |
| 173 | Ga0495629_0238353 | 3300046459 | Bacteria | 1253 |
| 174 | Ga0495582_0242044 | 3300046473 | Bacteria | 1034 |
| 175 | Ga0495662_0098253 | 3300046476 | Bacteria | 1432 |
| 176 | Ga0495664_0191964 | 3300046477 | Unclassified | 1238 |
| 177 | Ga0495608_0011844 | 3300046511 | Bacteria | 6068 |
| 178 | Ga0495608_0055750 | 3300046511 | Bacteria | 2612 |
| 179 | Ga0495618_0011291 | 3300046514 | Bacteria | 5414 |
| 180 | Ga0495628_0029411 | 3300046516 | Unclassified | 4454 |
| 181 | Ga0495652_0079675 | 3300046529 | Bacteria | 2707 |
| 182 | Ga0495587_0025609 | 3300046536 | Bacteria | 3605 |
| 183 | Ga0495634_0154911 | 3300046642 | Bacteria | 1447 |
| 184 | Ga0495657_0030164 | 3300046675 | Bacteria | 3799 |
| 185 | Ga0495623_0067000 | 3300046679 | Unclassified | 2242 |
| 186 | Ga0495623_0413280 | 3300046679 | Unclassified | 724 |
| 187 | Ga0495613_0018012 | 3300046689 | Bacteria | 5264 |
| 188 | Ga0495600_0017594 | 3300046809 | Bacteria | 4549 |
| 189 | Ga0495581_0149425 | 3300047315 | Bacteria | 1364 |
| 190 | Ga0495674_0277973 | 3300047319 | Bacteria | 1372 |
| 191 | Ga0495593_0027286 | 3300047673 | Unclassified | 3144 |
| 192 | Ga0496100_0208604 | 3300048903 | Bacteria | 1428 |
| 193 | Ga0496100_0234202 | 3300048903 | Bacteria | 1352 |
| 194 | Ga0496103_0038804 | 3300048906 | Bacteria | 2925 |
| 195 | Ga0496103_0434086 | 3300048906 | Bacteria | 843 |
| 196 | Ga0496104_0007288 | 3300048907 | Bacteria | 9760 |
| 197 | Ga0496105_0006678 | 3300048908 | Bacteria | 8881 |
| 198 | Ga0496105_0012223 | 3300048908 | Bacteria | 6797 |
| 199 | Ga0496105_0028955 | 3300048908 | Bacteria | 4532 |
| 200 | Ga0496105_0150480 | 3300048908 | Unclassified | 1913 |
| 201 | Ga0496105_0200989 | 3300048908 | Bacteria | 1627 |
| 202 | Ga0496106_0027878 | 3300048909 | Bacteria | 4205 |
| 203 | Ga0496107_0001173 | 3300048910 | Bacteria | 15902 |
| 204 | Ga0496108_0082109 | 3300048911 | Bacteria | 2732 |
| 205 | Ga0496108_0130834 | 3300048911 | Bacteria | 2157 |
| 206 | Ga0496108_0141897 | 3300048911 | Bacteria | 2070 |
| 207 | Ga0496108_0154927 | 3300048911 | Bacteria | 1978 |
| 208 | Ga0496108_0546477 | 3300048911 | Bacteria | 1011 |
| 209 | Ga0496109_0000437 | 3300048912 | Bacteria | 36293 |
| 210 | Ga0496109_0000682 | 3300048912 | Bacteria | 28239 |
| 211 | Ga0496109_0075013 | 3300048912 | Bacteria | 3110 |
| 212 | Ga0496109_0120160 | 3300048912 | Bacteria | 2447 |
| 213 | Ga0496110_0002572 | 3300048913 | Bacteria | 13640 |
| 214 | Ga0496110_0010370 | 3300048913 | Bacteria | 7574 |
| 215 | Ga0496110_0138725 | 3300048913 | Unclassified | 2198 |
| 216 | Ga0496110_0373675 | 3300048913 | Bacteria | 1299 |
| 217 | Ga0496111_0018316 | 3300048914 | Bacteria | 4850 |
| 218 | Ga0496111_0212369 | 3300048914 | Bacteria | 1437 |
| 219 | Ga0496112_0014290 | 3300048915 | Bacteria | 7356 |
| 220 | Ga0496112_0142925 | 3300048915 | Bacteria | 2362 |
| 221 | Ga0496112_0219675 | 3300048915 | Bacteria | 1856 |
| 222 | Ga0496112_0431290 | 3300048915 | Bacteria | 1256 |
| 223 | Ga0496112_0520667 | 3300048915 | Unclassified | 1124 |
| 224 | Ga0496113_0137978 | 3300048916 | Bacteria | 1917 |
| 225 | Ga0496114_0089102 | 3300048917 | Bacteria | 2618 |
| 226 | Ga0496115_0139357 | 3300048918 | Bacteria | 2001 |
| 227 | Ga0496115_0284170 | 3300048918 | Bacteria | 1358 |
| 228 | Ga0501031_0078820 | 3300049568 | Bacteria | 2146 |
| 229 | Ga0501047_0215428 | 3300049581 | Bacteria | 1777 |
| 230 | nmdc:mga08y16_724288_c1 | 3300050511 | Bacteria | 993 |
| 231 | Ga0495595_0047243 | 3300053084 | Unclassified | 1985 |
| 232 | Ga0466962_0007152 | 3300061719 | Bacteria | 5347 |
| 233 | Ga0466962_0030038 | 3300061719 | Bacteria | 2602 |
| 234 | Ga0466962_0140019 | 3300061719 | Archaea | 1172 |
| 235 | Ga0466958_0146865 | |||
| 236 | Ga0070683_100014783 | |||
| 237 | Ga0070690_100137835 | |||
| 238 | Ga0070666_10181153 | |||
| 239 | Ga0070682_100456487 | |||
| 240 | Ga0068868_100085309 | |||
| 241 | Ga0068868_100277668 | |||
| 242 | Ga0070691_10152755 | |||
| 243 | Ga0070687_100040777 | |||
| 244 | Ga0070692_10132183 | |||
| 245 | Ga0070688_100140910 | |||
| 246 | Ga0070659_100019656 | |||
| 247 | Ga0070709_10108708 | |||
| 248 | Ga0070714_100008380 | |||
| 249 | Ga0070714_100328365 | |||
| 250 | Ga0070714_100352996 | |||
| 251 | Ga0070714_100454273 | |||
| 252 | Ga0070714_100487122 | |||
| 253 | Ga0070713_100215342 | |||
| 254 | Ga0070711_100060847 | |||
| 255 | Ga0070711_100185954 | |||
| 256 | Ga0070684_100358046 | |||
| 257 | Ga0070686_100007816 | |||
| 258 | Ga0070695_100107502 | |||
| 259 | Ga0070664_100322191 | |||
| 260 | Ga0068857_100093666 | |||
| 261 | Ga0070702_100094867 | |||
| 262 | Ga0068866_10039466 | |||
| 263 | Ga0068861_100004135 | |||
| 264 | Ga0068861_100200740 | |||
| 265 | Ga0068870_10192237 | |||
| 266 | Ga0068870_10414710 | |||
| 267 | Ga0068860_100836583 | |||
| 268 | Ga0081455_10005724 | |||
| 269 | Ga0081539_10009859 | |||
| 270 | Ga0070717_10013949 | |||
| 271 | Ga0070717_10076677 | |||
| 272 | Ga0070717_10161525 | |||
| 273 | Ga0070717_10542188 | |||
| 274 | Ga0105245_10070873 | |||
| 275 | Ga0105245_10251120 | |||
| 276 | Ga0105242_10257855 | |||
| 277 | Ga0105242_10453484 | |||
| 278 | Ga0105239_10244562 | |||
| 279 | Ga0105246_10069379 | |||
| 280 | Ga0105246_10496738 | |||
| 281 | Ga0157372_10243057 | |||
| 282 | Ga0157375_10124104 | |||
| 283 | Ga0163163_10193156 | |||
| 284 | Ga0157379_10004505 | |||
| 285 | Ga0157379_10428713 | |||
| 286 | Ga0157376_10632690 | |||
| 287 | Ga0213874_10001910 | |||
| 288 | Ga0213876_10032204 | |||
| 289 | Ga0213876_10040766 | |||
| 290 | Ga0213876_10082139 | |||
| 291 | Ga0213875_10001672 | |||
| 292 | Ga0213875_10012499 | |||
| 293 | Ga0207656_10020292 | |||
| 294 | Ga0207710_10165253 | |||
| 295 | Ga0207647_10118774 | |||
| 296 | Ga0207663_10121515 | |||
| 297 | Ga0207662_10065890 | |||
| 298 | Ga0207687_10034633 | |||
| 299 | Ga0207700_10055696 | |||
| 300 | Ga0207700_10608483 | |||
| 301 | Ga0207664_10149896 | |||
| 302 | Ga0207664_10293810 | |||
| 303 | Ga0207664_10378766 | |||
| 304 | Ga0207644_10541861 | |||
| 305 | Ga0207706_10251025 | |||
| 306 | Ga0207686_10016782 | |||
| 307 | Ga0207709_10158502 | |||
| 308 | Ga0207689_10034222 | |||
| 309 | Ga0207661_10575436 | |||
| 310 | Ga0207679_10300356 | |||
| 311 | Ga0207677_10157940 | |||
| 312 | Ga0207677_10512754 | |||
| 313 | Ga0207702_10195322 | |||
| 314 | Ga0207641_10070067 | |||
| 315 | Ga0207648_10112488 | |||
| 316 | Ga0207676_10601987 | |||
| 317 | Ga0207674_10023709 | |||
| 318 | Ga0207675_100049878 | |||
| 319 | Ga0207675_100208629 | |||
| 320 | Ga0207675_100627288 | |||
| 321 | Ga0207683_10063211 | |||
| 322 | Ga0207683_10298251 | |||
| 323 | Ga0268265_10609821 | |||
| 324 | Ga0307405_10344796 | |||
| 325 | Ga0307415_100489456 | |||
| 326 | Ga0307415_100572716 | |||
| 327 | Ga0373924_0139329 | |||
| 328 | Ga0373933_0030565 | |||
| 329 | Ga0395899_0229640 | |||
| 330 | Ga0395900_0638658 | |||
| 331 | Ga0395898_0104867 | |||
| 332 | Ga0436364_0014949 | |||
| 333 | Ga0436364_0046247 | |||
| 334 | Ga0436364_0384140 | |||
| 335 | Ga0436364_0632249 | |||
| 336 | Ga0436364_1093515 | |||
| 337 | Ga0436364_1110567 | |||
| 338 | Ga0395901_0121725 | |||
| 339 | Ga0395901_0502637 | |||
| 340 | Ga0436365_0125691 | |||
| 341 | Ga0436365_0836366 | |||
| 342 | Ga0436365_1166789 | |||
| 343 | Ga0436365_1220022 | |||
| 344 | Ga0436365_1765691 | |||
| 345 | Ga0436365_1821214 | |||
| 346 | Ga0436363_0609902 | |||
| 347 | Ga0436362_0224955 | |||
| 348 | Ga0436362_0426688 | |||
| 349 | Ga0436362_1159079 | |||
| 350 | Ga0466969_0004574 | |||
| 351 | Ga0466969_0154881 | |||
| 352 | Ga0466966_0020605 | |||
| 353 | Ga0466966_0088554 | |||
| 354 | Ga0466966_0109674 | |||
| 355 | Ga0466966_0130942 | |||
| 356 | Ga0466966_0225153 | |||
| 357 | Ga0466961_0001927 | |||
| 358 | Ga0466961_0031637 | |||
| 359 | Ga0466961_0053875 | |||
| 360 | Ga0466961_0242349 | |||
| 361 | Ga0466961_0249638 | |||
| 362 | Ga0466963_0002205 | |||
| 363 | Ga0466963_0011212 | |||
| 364 | Ga0466963_0018535 | |||
| 365 | Ga0466963_0019689 | |||
| 366 | Ga0466963_0057459 | |||
| 367 | Ga0466963_0108280 | |||
| 368 | Ga0466964_0156509 | |||
| 369 | Ga0466971_0037354 | |||
| 370 | Ga0466971_0068433 | |||
| 371 | Ga0466968_0136450 | |||
| 372 | Ga0466970_0057925 | |||
| 373 | Ga0466970_0288591 | |||
| 374 | Ga0466970_0289644 | |||
| 375 | Ga0466957_0001648 | |||
| 376 | Ga0466957_0023789 | |||
| 377 | Ga0466957_0026801 | |||
| 378 | Ga0466957_0132758 | |||
| 379 | Ga0466957_0240919 | |||
| 380 | Ga0466957_0538251 | |||
| 381 | Ga0466960_0021895 | |||
| 382 | Ga0466960_0246658 | |||
| 383 | Ga0466959_0024437 | |||
| 384 | Ga0466959_0026555 | |||
| 385 | Ga0466959_0030613 | |||
| 386 | Ga0466959_0040642 | |||
| 387 | Ga0466959_0049759 | |||
| 388 | Ga0466959_0108226 | |||
| 389 | Ga0466959_0191689 | |||
| 390 | Ga0466959_0241904 | |||
| 391 | Ga0466959_0259967 | |||
| 392 | Ga0466958_0000546 | |||
| 393 | Ga0466958_0004355 | |||
| 394 | Ga0466958_0007885 | |||
| 395 | Ga0466958_0015464 | |||
| 396 | Ga0466958_0026443 | |||
| 397 | Ga0466958_0052176 | |||
| 398 | Ga0466958_0077362 | |||
| 399 | Ga0466958_0229540 | |||
| 400 | Ga0466967_0007702 | |||
| 401 | Ga0466967_0024401 | |||
| 402 | Ga0466967_0026771 | |||
| 403 | Ga0466967_0074237 | |||
| 404 | Ga0466967_0258713 | |||
| 405 | Ga0466967_0454837 | |||
| 406 | Ga0495590_0079884 | |||
| 407 | Ga0495629_0238353 | |||
| 408 | Ga0495582_0242044 | |||
| 409 | Ga0495662_0098253 | |||
| 410 | Ga0495664_0191964 | |||
| 411 | Ga0495608_0011844 | |||
| 412 | Ga0495608_0055750 | |||
| 413 | Ga0495618_0011291 | |||
| 414 | Ga0495628_0029411 | |||
| 415 | Ga0495652_0079675 | |||
| 416 | Ga0495587_0025609 | |||
| 417 | Ga0495634_0154911 | |||
| 418 | Ga0495657_0030164 | |||
| 419 | Ga0495623_0067000 | |||
| 420 | Ga0495623_0413280 | |||
| 421 | Ga0495613_0018012 | |||
| 422 | Ga0495600_0017594 | |||
| 423 | Ga0495581_0149425 | |||
| 424 | Ga0495674_0277973 | |||
| 425 | Ga0495593_0027286 | |||
| 426 | Ga0496100_0208604 | |||
| 427 | Ga0496100_0234202 | |||
| 428 | Ga0496103_0038804 | |||
| 429 | Ga0496103_0434086 | |||
| 430 | Ga0496104_0007288 | |||
| 431 | Ga0496105_0006678 | |||
| 432 | Ga0496105_0012223 | |||
| 433 | Ga0496105_0028955 | |||
| 434 | Ga0496105_0150480 | |||
| 435 | Ga0496105_0200989 | |||
| 436 | Ga0496106_0027878 | |||
| 437 | Ga0496107_0001173 | |||
| 438 | Ga0496108_0082109 | |||
| 439 | Ga0496108_0130834 | |||
| 440 | Ga0496108_0141897 | |||
| 441 | Ga0496108_0154927 | |||
| 442 | Ga0496108_0546477 | |||
| 443 | Ga0496109_0000437 | |||
| 444 | Ga0496109_0000682 | |||
| 445 | Ga0496109_0075013 | |||
| 446 | Ga0496109_0120160 | |||
| 447 | Ga0496110_0002572 | |||
| 448 | Ga0496110_0010370 | |||
| 449 | Ga0496110_0138725 | |||
| 450 | Ga0496110_0373675 | |||
| 451 | Ga0496111_0018316 | |||
| 452 | Ga0496111_0212369 | |||
| 453 | Ga0496112_0014290 | |||
| 454 | Ga0496112_0142925 | |||
| 455 | Ga0496112_0219675 | |||
| 456 | Ga0496112_0431290 | |||
| 457 | Ga0496112_0520667 | |||
| 458 | Ga0496113_0137978 | |||
| 459 | Ga0496114_0089102 | |||
| 460 | Ga0496115_0139357 | |||
| 461 | Ga0496115_0284170 | |||
| 462 | Ga0501031_0078820 | |||
| 463 | Ga0501047_0215428 | |||
| 464 | nmdc:mga08y16_724288_c1 | |||
| 465 | Ga0495595_0047243 | |||
| 466 | Ga0466962_0007152 | |||
| 467 | Ga0466962_0030038 | |||
| 468 | Ga0466962_0140019 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1sd2-assembly1.cif.gz_A | structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with 5'-methylthiotubercidin | 0.9123 | 2 | 246 |
| 3oze-assembly2.cif.gz_E | crystal structure of human 5'-deoxy-5'-methyladenosine phosphorylase | 0.9122 | 2 | 246 |
| 3t94-assembly1.cif.gz_A | crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase (mtap) ii complexed with 5'-deoxy-5'-methylthioadenosine and sulfate | 0.9097 | 2 | 248 |
| 3oze-assembly1.cif.gz_B | crystal structure of human 5'-deoxy-5'-methyladenosine phosphorylase | 0.9081 | 2 | 246 |
| 3oze-assembly2.cif.gz_D | crystal structure of human 5'-deoxy-5'-methyladenosine phosphorylase | 0.9071 | 2 | 246 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3t94A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.9097 | 2 | 248 | 3.40.50.1580 |
| af_Q60367_1_252_3.40.50.1580 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.8892 | 1 | 244 | 3.40.50.1580 |
| af_O06401_3_259_3.40.50.1580 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.8881 | 2 | 248 | 3.40.50.1580 |
| af_Q09438_1_274_3.40.50.1580 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.887 | 2 | 246 | 3.40.50.1580 |
| af_Q7ZV22_6_280_3.40.50.1580 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.8782 | 2 | 246 | 3.40.50.1580 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F2UNI4-F1-model_v4 | Nucleoside phosphorylase domain-containing protein | 0.9699 | 1 | 261 |
GO:0005829
GO:0009116 GO:0017061 GO:0019509 |
| AF-A0A7Y5XC66-F1-model_v4 | deleted | 0.9671 | 50 | 261 |
|
| AF-A0A1F2UNI4-F1-model_v4 | Nucleoside phosphorylase domain-containing protein | 0.9663 | 1 | 261 |
GO:0005829
GO:0009116 GO:0017061 GO:0019509 |
| AF-A0A2N1UXA6-F1-model_v4 | Phosphorylase | 0.9646 | 2 | 261 |
GO:0005829
GO:0009116 GO:0017061 GO:0019509 |
| AF-A0A7Y5XC66-F1-model_v4 | deleted | 0.9582 | 50 | 261 |
|