F347247

General Info

Members Datasets Scaffolds Average Seq Length
234 127 468 227

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10101840|Ga0307410_101018401
Length 253
Sequence MKLRGDSVAGTIRPDAPIRAQPPATLPMPTSKDLKRLVRGGQQKAGEAYTAGRAGLLEQKPAAAVSRAAVDYAKLAGRSDAVLKAKTGCTWERWVRALDHAQAYTWPHREIARHVREEYEVPGWWAQTVTVGYERIKGLRAVGQRRDGSFEANKSRTFAVPLVRLYRAFHDARTRAQWLPGVDLTVRTATRGKSMRITWPDRTSVAVGFSSRGAAKSQVAIQHGRLADRAAAARMKQYWAERLDALEEVLASE

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
51 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
52 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
53 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
54 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
55 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
61 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
62 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
63 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
64 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
68 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
69 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
70 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
71 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
72 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
73 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
74 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
75 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
76 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
77 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
78 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
79 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
80 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
81 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
82 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
83 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
84 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
85 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
95 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
96 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
97 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
98 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
99 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
100 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
101 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
102 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
103 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
104 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
105 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
106 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
107 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
108 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
111 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
112 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
113 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
114 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
121 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
122 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
123 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
126 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
127 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.54
Rhizosphere 88.46
Stem 0
Stem Tuber 0
Unclassified 27.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_10101840 3300031852 Bacteria 2060
2 Ga0065715_10095381 3300005293 Unclassified 4097
3 Ga0070680_100352831 3300005336 Unclassified 1251
4 Ga0070689_100104095 3300005340 Bacteria 2250
5 Ga0070688_100329389 3300005365 Bacteria 1112
6 Ga0070709_10301096 3300005434 Bacteria 1171
7 Ga0070705_100336008 3300005440 Unclassified 1096
8 Ga0070700_100502037 3300005441 Unclassified 933
9 Ga0070708_100049281 3300005445 Bacteria 3725
10 Ga0070662_100225299 3300005457 Unclassified 1498
11 Ga0070681_10513084 3300005458 Unclassified 1112
12 Ga0070706_100146196 3300005467 Bacteria 2207
13 Ga0070706_100158225 3300005467 Bacteria 2115
14 Ga0070707_100106836 3300005468 Unclassified 2715
15 Ga0070698_100052465 3300005471 Bacteria 4148
16 Ga0070699_100067735 3300005518 Bacteria 3100
17 Ga0070699_100122912 3300005518 Bacteria 2283
18 Ga0070699_100268413 3300005518 Unclassified 1527
19 Ga0070699_100384468 3300005518 Bacteria 1267
20 Ga0070699_100500515 3300005518 Bacteria 1104
21 Ga0070679_100094683 3300005530 Unclassified 2974
22 Ga0070697_100141882 3300005536 Unclassified 2021
23 Ga0070697_100317715 3300005536 Bacteria 1341
24 Ga0070695_100033273 3300005545 Unclassified 3225
25 Ga0070696_100010622 3300005546 Bacteria 6166
26 Ga0070696_100044183 3300005546 Unclassified 3085
27 Ga0070696_100459856 3300005546 Bacteria 1006
28 Ga0070704_100184504 3300005549 Bacteria 1672
29 Ga0068855_100668604 3300005563 Unclassified 1114
30 Ga0068859_100096841 3300005617 Unclassified 3003
31 Ga0068864_100174794 3300005618 Unclassified 1960
32 Ga0068861_100864399 3300005719 Bacteria 854
33 Ga0075428_100354327 3300006844 Unclassified 1575
34 Ga0075428_100400706 3300006844 Bacteria 1471
35 Ga0075430_100010898 3300006846 Bacteria 7701
36 Ga0075430_100203730 3300006846 Bacteria 1642
37 Ga0075430_100680991 3300006846 Unclassified 848
38 Ga0075431_100002358 3300006847 Bacteria 18140
39 Ga0075431_100002967 3300006847 Bacteria 16414
40 Ga0075431_100011540 3300006847 Bacteria 8913
41 Ga0075431_100014308 3300006847 Bacteria 8024
42 Ga0075431_100174102 3300006847 Unclassified 2211
43 Ga0075433_10001535 3300006852 Bacteria 17060
44 Ga0075433_10047228 3300006852 Bacteria 3744
45 Ga0075434_100018831 3300006871 Bacteria 6673
46 Ga0075434_100076809 3300006871 Bacteria 3335
47 Ga0075434_100156067 3300006871 Bacteria 2301
48 Ga0075434_100236397 3300006871 Bacteria 1847
49 Ga0075434_100260016 3300006871 Bacteria 1755
50 Ga0075429_100031448 3300006880 Bacteria 4613
51 Ga0075429_100089398 3300006880 Bacteria 2685
52 Ga0075436_100123951 3300006914 Unclassified 1809
53 Ga0075436_100590962 3300006914 Bacteria 817
54 Ga0097620_100096843 3300006931 Unclassified 3003
55 Ga0075435_100181308 3300007076 Bacteria 1780
56 Ga0111539_10066876 3300009094 Bacteria 4245
57 Ga0111539_10268995 3300009094 Bacteria 1984
58 Ga0111539_10585799 3300009094 Unclassified 1299
59 Ga0111539_10849606 3300009094 Unclassified 1062
60 Ga0114129_10047955 3300009147 Bacteria 6001
61 Ga0114129_10051131 3300009147 Bacteria 5803
62 Ga0114129_10081811 3300009147 Bacteria 4489
63 Ga0114129_10253149 3300009147 Bacteria 2363
64 Ga0114129_10824190 3300009147 Bacteria 1182
65 Ga0114129_10874161 3300009147 Bacteria 1141
66 Ga0114129_11068543 3300009147 Unclassified 1012
67 Ga0105242_10711199 3300009176 Bacteria 984
68 Ga0105237_10700305 3300009545 Unclassified 1020
69 Ga0105239_10070632 3300010375 Unclassified 3836
70 Ga0163163_10065999 3300014325 Unclassified 3593
71 Ga0157380_10131960 3300014326 Bacteria 2133
72 Ga0207653_10099375 3300025885 Bacteria 1027
73 Ga0207646_10059315 3300025922 Bacteria 3418
74 Ga0207690_10027968 3300025932 Unclassified 3569
75 Ga0207706_10077858 3300025933 Bacteria 2916
76 Ga0207670_10073790 3300025936 Bacteria 2366
77 Ga0207689_10042982 3300025942 Bacteria 3736
78 Ga0207667_10876459 3300025949 Unclassified 891
79 Ga0207667_10962177 3300025949 Unclassified 843
80 Ga0207641_10271411 3300026088 Unclassified 1592
81 Ga0207676_10010126 3300026095 Bacteria 6710
82 Ga0307408_100019935 3300031548 Bacteria 4519
83 Ga0307408_100200886 3300031548 Bacteria 1613
84 Ga0307408_100655178 3300031548 Unclassified 939
85 Ga0307405_10025768 3300031731 Bacteria 3381
86 Ga0307413_10054120 3300031824 Bacteria 2433
87 Ga0307413_10133434 3300031824 Bacteria 1703
88 Ga0307413_10277018 3300031824 Bacteria 1259
89 Ga0307410_10015682 3300031852 Bacteria 4502
90 Ga0307410_10070992 3300031852 Bacteria 2414
91 Ga0307410_10111940 3300031852 Bacteria 1976
92 Ga0307410_10241666 3300031852 Bacteria 1399
93 Ga0307406_10016914 3300031901 Bacteria 4244
94 Ga0307406_10113620 3300031901 Unclassified 1869
95 Ga0307407_10010552 3300031903 Bacteria 4364
96 Ga0307412_10079945 3300031911 Bacteria 2257
97 Ga0307412_10290885 3300031911 Unclassified 1287
98 Ga0307412_10484213 3300031911 Unclassified 1027
99 Ga0307409_100008425 3300031995 Bacteria 6257
100 Ga0307409_100041195 3300031995 Bacteria 3447
101 Ga0307409_100045219 3300031995 Bacteria 3322
102 Ga0307409_100621031 3300031995 Unclassified 1071
103 Ga0307416_100010718 3300032002 Bacteria 6073
104 Ga0307416_100030862 3300032002 Bacteria 4027
105 Ga0307416_100032602 3300032002 Bacteria 3939
106 Ga0307416_100061013 3300032002 Bacteria 3075
107 Ga0307416_100156201 3300032002 Bacteria 2100
108 Ga0307411_10006355 3300032005 Bacteria 5907
109 Ga0307411_10031503 3300032005 Bacteria 3264
110 Ga0307411_10644062 3300032005 Bacteria 917
111 Ga0307415_100009636 3300032126 Bacteria 5429
112 Ga0307415_100040271 3300032126 Bacteria 3094
113 Ga0373959_0041120 3300034820 Bacteria 970
114 Ga0373929_0038653 3300035085 Unclassified 1051
115 Ga0373949_0012881 3300035090 Unclassified 1853
116 Ga0373961_0045146 3300035241 Unclassified 1288
117 Ga0373961_0078790 3300035241 Unclassified 1033
118 Ga0373931_0017781 3300035691 Unclassified 3522
119 Ga0373931_0053920 3300035691 Unclassified 2147
120 Ga0395900_0535231 3300037418 Bacteria 1118
121 Ga0395905_0182941 3300037471 Bacteria 1967
122 Ga0395905_0452400 3300037471 Bacteria 1182
123 Ga0395905_0912818 3300037471 Unclassified 781
124 Ga0242420_005228 3300038996 Unclassified 2001
125 Ga0439448_0013058 3300042005 Bacteria 2493
126 Ga0451577_0244692 3300042876 Bacteria 1623
127 Ga0451576_1152150 3300045051 Bacteria 810
128 Ga0495670_0096641 3300046691 Bacteria 1517
129 Ga0496101_0104056 3300048904 Bacteria 2129
130 Ga0496102_0011746 3300048905 Bacteria 7557
131 Ga0496102_0125387 3300048905 Bacteria 2400
132 Ga0496103_0109459 3300048906 Unclassified 1754
133 Ga0496104_0009161 3300048907 Bacteria 8804
134 Ga0496104_0011926 3300048907 Bacteria 7797
135 Ga0496105_0027360 3300048908 Bacteria 4658
136 Ga0496105_0053979 3300048908 Unclassified 3319
137 Ga0496107_0043778 3300048910 Bacteria 3217
138 Ga0496108_0001706 3300048911 Bacteria 17414
139 Ga0496108_0002619 3300048911 Bacteria 14410
140 Ga0496108_0029946 3300048911 Unclassified 4511
141 Ga0496109_0001344 3300048912 Bacteria 20334
142 Ga0496109_0005586 3300048912 Bacteria 10523
143 Ga0496109_0009943 3300048912 Bacteria 8123
144 Ga0496109_0381624 3300048912 Bacteria 1331
145 Ga0496110_0009624 3300048913 Bacteria 7824
146 Ga0496110_0036284 3300048913 Bacteria 4280
147 Ga0496110_0040909 3300048913 Unclassified 4042
148 Ga0496111_0012265 3300048914 Bacteria 5798
149 Ga0496111_0226852 3300048914 Bacteria 1387
150 Ga0496112_0007755 3300048915 Bacteria 9552
151 Ga0496112_0015445 3300048915 Bacteria 7129
152 Ga0496112_0210153 3300048915 Unclassified 1903
153 Ga0496113_0002798 3300048916 Bacteria 10266
154 Ga0496113_0040288 3300048916 Bacteria 3442
155 Ga0496115_0048836 3300048918 Unclassified 3386
156 Ga0501031_0071426 3300049568 Bacteria 2261
157 Ga0501031_0278426 3300049568 Bacteria 1085
158 Ga0501036_0033820 3300049572 Bacteria 4324
159 Ga0501037_0624819 3300049573 Bacteria 722
160 Ga0501038_0095579 3300049574 Bacteria 2482
161 Ga0501040_0060600 3300049576 Bacteria 2601
162 Ga0501040_0209127 3300049576 Bacteria 1387
163 Ga0501041_0013716 3300049577 Bacteria 4807
164 Ga0501041_0029666 3300049577 Bacteria 3300
165 Ga0501043_0109984 3300049579 Bacteria 2164
166 Ga0501046_0011910 3300049580 Bacteria 7419
167 Ga0501046_0053829 3300049580 Bacteria 3168
168 Ga0501048_0052869 3300049582 Bacteria 2890
169 Ga0501048_0405364 3300049582 Bacteria 975
170 Ga0501068_0030037 3300049584 Bacteria 3222
171 Ga0501071_0004866 3300049587 Bacteria 8562
172 Ga0501072_0022434 3300049588 Bacteria 4897
173 Ga0501072_0516389 3300049588 Unclassified 944
174 Ga0501073_0352594 3300049589 Bacteria 1016
175 Ga0501074_0197092 3300049590 Unclassified 1435
176 Ga0501074_0232065 3300049590 Bacteria 1313
177 Ga0501075_0048108 3300049591 Bacteria 3205
178 Ga0501075_0067213 3300049591 Bacteria 2706
179 Ga0501076_0091991 3300049592 Bacteria 2440
180 Ga0501076_0119865 3300049592 Bacteria 2130
181 Ga0501076_0152981 3300049592 Bacteria 1877
182 Ga0501077_0002934 3300049593 Bacteria 10236
183 Ga0501077_0042811 3300049593 Bacteria 2878
184 Ga0501216_015249 3300049660 Bacteria 1294
185 Ga0501239_003834 3300049672 Bacteria 1449
186 Ga0501243_016398 3300049675 Bacteria 1196
187 Ga0501247_002480 3300049677 Unclassified 1919
188 Ga0501221_004300 3300049704 Unclassified 2360
189 Ga0501225_0075601 3300049705 Bacteria 962
190 Ga0501234_011428 3300049707 Bacteria 1388
191 Ga0501079_0010684 3300049741 Bacteria 6991
192 Ga0501079_0114722 3300049741 Unclassified 2094
193 Ga0501079_0143226 3300049741 Unclassified 1862
194 Ga0501080_0093376 3300049742 Bacteria 2794
195 Ga0501081_0125860 3300049743 Bacteria 1828
196 Ga0501083_0312889 3300049744 Unclassified 1021
197 Ga0501268_002964 3300049765 Unclassified 2286
198 Ga0501204_027480 3300049850 Bacteria 775
199 nmdc:mga05p37_202073_c1 3300050507 Bacteria 2406
200 nmdc:mga05p37_548448_c1 3300050507 Bacteria 1317
201 nmdc:mga05p37_7516_c1 3300050507 Bacteria 12848
202 nmdc:mga09592_11204_c1 3300050508 Bacteria 7296
203 nmdc:mga09592_279699_c1 3300050508 Unclassified 1447
204 nmdc:mga09592_31831_c1 3300050508 Unclassified 4396
205 nmdc:mga09592_98781_c1 3300050508 Bacteria 2499
206 nmdc:mga0qj67_15543_c1 3300050509 Bacteria 5763
207 nmdc:mga0qj67_207216_c1 3300050509 Bacteria 1592
208 nmdc:mga06r32_14928_c1 3300050510 Bacteria 7051
209 nmdc:mga06r32_1550_c1 3300050510 Bacteria 20714
210 nmdc:mga06r32_200543_c1 3300050510 Unclassified 1983
211 nmdc:mga06r32_20066_c1 3300050510 Bacteria 6146
212 nmdc:mga06r32_372176_c1 3300050510 Unclassified 1412
213 nmdc:mga06r32_574372_c1 3300050510 Unclassified 1100
214 nmdc:mga06r32_8492_c1 3300050510 Bacteria 9258
215 nmdc:mga08y16_50960_c1 3300050511 Bacteria 4331
216 nmdc:mga08y16_56693_c1 3300050511 Bacteria 4094
217 nmdc:mga08y16_9179_c1 3300050511 Bacteria 10380
218 nmdc:mga0n895_15984_c1 3300050512 Bacteria 6870
219 nmdc:mga0n895_377897_c1 3300050512 Bacteria 1434
220 nmdc:mga0n895_550114_c1 3300050512 Bacteria 1160
221 nmdc:mga0rr50_53981_c1 3300050513 Unclassified 2991
222 nmdc:mga08x19_129112_c1 3300050514 Unclassified 1699
223 nmdc:mga0a205_108762_c1 3300050515 Bacteria 2671
224 nmdc:mga0a205_1443_c1 3300050515 Bacteria 20243
225 nmdc:mga0a205_211916_c1 3300050515 Bacteria 1825
226 nmdc:mga0a205_383054_c1 3300050515 Bacteria 1271
227 nmdc:mga0a205_7882_c1 3300050515 Bacteria 9670
228 Ga0501084_0004735 3300054114 Bacteria 11120
229 Ga0501084_0023610 3300054114 Bacteria 5129
230 Ga0501084_0247523 3300054114 Bacteria 1505
231 Ga0590071_013610 3300059421 Bacteria 1905
232 Ga0590075_070024 3300059424 Bacteria 906
233 Ga0501082_0012164 3300060353 Bacteria 7395
234 Ga0501082_0245349 3300060353 Bacteria 1559
235 Ga0307410_10101840
236 Ga0065715_10095381
237 Ga0070680_100352831
238 Ga0070689_100104095
239 Ga0070688_100329389
240 Ga0070709_10301096
241 Ga0070705_100336008
242 Ga0070700_100502037
243 Ga0070708_100049281
244 Ga0070662_100225299
245 Ga0070681_10513084
246 Ga0070706_100146196
247 Ga0070706_100158225
248 Ga0070707_100106836
249 Ga0070698_100052465
250 Ga0070699_100067735
251 Ga0070699_100122912
252 Ga0070699_100268413
253 Ga0070699_100384468
254 Ga0070699_100500515
255 Ga0070679_100094683
256 Ga0070697_100141882
257 Ga0070697_100317715
258 Ga0070695_100033273
259 Ga0070696_100010622
260 Ga0070696_100044183
261 Ga0070696_100459856
262 Ga0070704_100184504
263 Ga0068855_100668604
264 Ga0068859_100096841
265 Ga0068864_100174794
266 Ga0068861_100864399
267 Ga0075428_100354327
268 Ga0075428_100400706
269 Ga0075430_100010898
270 Ga0075430_100203730
271 Ga0075430_100680991
272 Ga0075431_100002358
273 Ga0075431_100002967
274 Ga0075431_100011540
275 Ga0075431_100014308
276 Ga0075431_100174102
277 Ga0075433_10001535
278 Ga0075433_10047228
279 Ga0075434_100018831
280 Ga0075434_100076809
281 Ga0075434_100156067
282 Ga0075434_100236397
283 Ga0075434_100260016
284 Ga0075429_100031448
285 Ga0075429_100089398
286 Ga0075436_100123951
287 Ga0075436_100590962
288 Ga0097620_100096843
289 Ga0075435_100181308
290 Ga0111539_10066876
291 Ga0111539_10268995
292 Ga0111539_10585799
293 Ga0111539_10849606
294 Ga0114129_10047955
295 Ga0114129_10051131
296 Ga0114129_10081811
297 Ga0114129_10253149
298 Ga0114129_10824190
299 Ga0114129_10874161
300 Ga0114129_11068543
301 Ga0105242_10711199
302 Ga0105237_10700305
303 Ga0105239_10070632
304 Ga0163163_10065999
305 Ga0157380_10131960
306 Ga0207653_10099375
307 Ga0207646_10059315
308 Ga0207690_10027968
309 Ga0207706_10077858
310 Ga0207670_10073790
311 Ga0207689_10042982
312 Ga0207667_10876459
313 Ga0207667_10962177
314 Ga0207641_10271411
315 Ga0207676_10010126
316 Ga0307408_100019935
317 Ga0307408_100200886
318 Ga0307408_100655178
319 Ga0307405_10025768
320 Ga0307413_10054120
321 Ga0307413_10133434
322 Ga0307413_10277018
323 Ga0307410_10015682
324 Ga0307410_10070992
325 Ga0307410_10111940
326 Ga0307410_10241666
327 Ga0307406_10016914
328 Ga0307406_10113620
329 Ga0307407_10010552
330 Ga0307412_10079945
331 Ga0307412_10290885
332 Ga0307412_10484213
333 Ga0307409_100008425
334 Ga0307409_100041195
335 Ga0307409_100045219
336 Ga0307409_100621031
337 Ga0307416_100010718
338 Ga0307416_100030862
339 Ga0307416_100032602
340 Ga0307416_100061013
341 Ga0307416_100156201
342 Ga0307411_10006355
343 Ga0307411_10031503
344 Ga0307411_10644062
345 Ga0307415_100009636
346 Ga0307415_100040271
347 Ga0373959_0041120
348 Ga0373929_0038653
349 Ga0373949_0012881
350 Ga0373961_0045146
351 Ga0373961_0078790
352 Ga0373931_0017781
353 Ga0373931_0053920
354 Ga0395900_0535231
355 Ga0395905_0182941
356 Ga0395905_0452400
357 Ga0395905_0912818
358 Ga0242420_005228
359 Ga0439448_0013058
360 Ga0451577_0244692
361 Ga0451576_1152150
362 Ga0495670_0096641
363 Ga0496101_0104056
364 Ga0496102_0011746
365 Ga0496102_0125387
366 Ga0496103_0109459
367 Ga0496104_0009161
368 Ga0496104_0011926
369 Ga0496105_0027360
370 Ga0496105_0053979
371 Ga0496107_0043778
372 Ga0496108_0001706
373 Ga0496108_0002619
374 Ga0496108_0029946
375 Ga0496109_0001344
376 Ga0496109_0005586
377 Ga0496109_0009943
378 Ga0496109_0381624
379 Ga0496110_0009624
380 Ga0496110_0036284
381 Ga0496110_0040909
382 Ga0496111_0012265
383 Ga0496111_0226852
384 Ga0496112_0007755
385 Ga0496112_0015445
386 Ga0496112_0210153
387 Ga0496113_0002798
388 Ga0496113_0040288
389 Ga0496115_0048836
390 Ga0501031_0071426
391 Ga0501031_0278426
392 Ga0501036_0033820
393 Ga0501037_0624819
394 Ga0501038_0095579
395 Ga0501040_0060600
396 Ga0501040_0209127
397 Ga0501041_0013716
398 Ga0501041_0029666
399 Ga0501043_0109984
400 Ga0501046_0011910
401 Ga0501046_0053829
402 Ga0501048_0052869
403 Ga0501048_0405364
404 Ga0501068_0030037
405 Ga0501071_0004866
406 Ga0501072_0022434
407 Ga0501072_0516389
408 Ga0501073_0352594
409 Ga0501074_0197092
410 Ga0501074_0232065
411 Ga0501075_0048108
412 Ga0501075_0067213
413 Ga0501076_0091991
414 Ga0501076_0119865
415 Ga0501076_0152981
416 Ga0501077_0002934
417 Ga0501077_0042811
418 Ga0501216_015249
419 Ga0501239_003834
420 Ga0501243_016398
421 Ga0501247_002480
422 Ga0501221_004300
423 Ga0501225_0075601
424 Ga0501234_011428
425 Ga0501079_0010684
426 Ga0501079_0114722
427 Ga0501079_0143226
428 Ga0501080_0093376
429 Ga0501081_0125860
430 Ga0501083_0312889
431 Ga0501268_002964
432 Ga0501204_027480
433 nmdc:mga05p37_202073_c1
434 nmdc:mga05p37_548448_c1
435 nmdc:mga05p37_7516_c1
436 nmdc:mga09592_11204_c1
437 nmdc:mga09592_279699_c1
438 nmdc:mga09592_31831_c1
439 nmdc:mga09592_98781_c1
440 nmdc:mga0qj67_15543_c1
441 nmdc:mga0qj67_207216_c1
442 nmdc:mga06r32_14928_c1
443 nmdc:mga06r32_1550_c1
444 nmdc:mga06r32_200543_c1
445 nmdc:mga06r32_20066_c1
446 nmdc:mga06r32_372176_c1
447 nmdc:mga06r32_574372_c1
448 nmdc:mga06r32_8492_c1
449 nmdc:mga08y16_50960_c1
450 nmdc:mga08y16_56693_c1
451 nmdc:mga08y16_9179_c1
452 nmdc:mga0n895_15984_c1
453 nmdc:mga0n895_377897_c1
454 nmdc:mga0n895_550114_c1
455 nmdc:mga0rr50_53981_c1
456 nmdc:mga08x19_129112_c1
457 nmdc:mga0a205_108762_c1
458 nmdc:mga0a205_1443_c1
459 nmdc:mga0a205_211916_c1
460 nmdc:mga0a205_383054_c1
461 nmdc:mga0a205_7882_c1
462 Ga0501084_0004735
463 Ga0501084_0023610
464 Ga0501084_0247523
465 Ga0590071_013610
466 Ga0590075_070024
467 Ga0501082_0012164
468 Ga0501082_0245349

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.8352 138 242
2nn5-assembly1.cif.gz_A structure of conserved protein of unknown function ef2215 from enterococcus faecalis 0.8179 131 242
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.8178 136 240
3oqu-assembly1.cif.gz_A crystal structure of native abscisic acid receptor pyl9 with aba 0.8138 132 236
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.81 138 240
ID Description Score Start End Superfamily
2nn5A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8179 131 242 3.30.530.20
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8162 136 242 3.30.530.20
af_Q4E5D5_198_328_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8134 138 238 3.30.530.20
af_I6X666_8_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.811 137 240 3.30.530.20
3ni8A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8089 138 238 3.30.530.20
ID Description Score Start End GO Terms
AF-K0IL34-F1-model_v4 Uncharacterized protein 0.9846 140 236
AF-A0A7W0GP80-F1-model_v4 SRPBCC domain-containing protein 0.9684 141 237
AF-A0A7V9E3P4-F1-model_v4 SRPBCC domain-containing protein 0.9672 85 239
AF-A0A357KTS4-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.964 136 236
AF-K0IL34-F1-model_v4 Uncharacterized protein 0.9551 140 236

Map