F346928

General Info

Members Datasets Scaffolds Average Seq Length
234 135 468 613

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100012960|Ga0068858_1000129604
Length 647
Sequence MRRRMTLATWIVSVSVGTLLTLLLVEPVGTQQRTPATVGNDPSTSSGSSRAWSRDDWPMYRHDLAGTGYSPLTQINVKNVASLSRVWTYRLQSDAPAVAAPGGRGGPGGVNSEVTPIVVNRVMYLPAANRVVALDPENGKEIWRYPVAGGAPSRRGVAYWPGEGSTPPRIIFTAGRRLIALDARTGVLVPGFGKEGEMDMVVPYNSVPLVYRNVLVVGANTPPGAIGGVGNARAFDARTGAKLWEFSSVPQPGEVGHDTWEGDSWKGRLGVNAWPFYFTLDEQRRLLYLPLASPIGGAYGGDRKGANLFGNSVVAVDVQTGTYKWHFQTIHHDLWDADPPAPPALFDVVRNGRSIPALGLTTKSGYLYILNRETGQPIFGVEERPVAKSDVPGELAFPTQPFPVKPPPLARVSYKPEDLVTAADTTPEHARACEELVAKNGGVYNAGPFTPWRYRAEGTSPASALVFPGGLGGANWGGTAFDANSRYVFVVTQDVGALGWIEKARDGSPAPYDKTTGSGRGSFDVRIGDANWPCQKPPWGRLTAVNASTGDIAWQIRLGVTEQLPEGKQNTGRPALAGPIVTASGLLFIASTDDNRFRAFEAKSGRQLWVTTLERRGNADPITYRGGNGKQYVAVVATDTLAVYALP

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
98 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
99 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
100 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
101 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
102 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
103 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
104 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
105 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
106 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
107 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
108 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
120 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.56
Rhizosphere 97.01
Stem 0
Stem Tuber 0
Unclassified 6.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100012960 3300005842 Bacteria 7861
2 Ga0065712_10003534 3300005290 Bacteria 3667
3 Ga0065712_10077308 3300005290 Bacteria 3517
4 Ga0065715_10002889 3300005293 Bacteria 4389
5 Ga0065707_10094180 3300005295 Unclassified 3529
6 Ga0065707_10094452 3300005295 Unclassified 3494
7 Ga0070676_10010173 3300005328 Bacteria 5099
8 Ga0070676_10011246 3300005328 Bacteria 4867
9 Ga0070690_100017857 3300005330 Bacteria 4276
10 Ga0070670_100023370 3300005331 Bacteria 5321
11 Ga0070670_100027251 3300005331 Bacteria 4916
12 Ga0070670_100059546 3300005331 Bacteria 3278
13 Ga0070670_100074820 3300005331 Bacteria 2910
14 Ga0070666_10014156 3300005335 Bacteria 5075
15 Ga0068868_100033350 3300005338 Bacteria 3968
16 Ga0070691_10002107 3300005341 Bacteria 8804
17 Ga0070669_100017858 3300005353 Bacteria 5064
18 Ga0070669_100031240 3300005353 Bacteria 3847
19 Ga0070669_100038423 3300005353 Bacteria 3476
20 Ga0070675_100005040 3300005354 Bacteria 10082
21 Ga0070675_100008047 3300005354 Bacteria 8173
22 Ga0070675_100016817 3300005354 Bacteria 5807
23 Ga0070675_100040385 3300005354 Bacteria 3808
24 Ga0070675_100057270 3300005354 Bacteria 3212
25 Ga0070671_100004922 3300005355 Bacteria 10634
26 Ga0070674_100008033 3300005356 Bacteria 6256
27 Ga0070673_100009546 3300005364 Bacteria 6516
28 Ga0070673_100114475 3300005364 Unclassified 2241
29 Ga0070667_100071028 3300005367 Bacteria 2965
30 Ga0070705_100042914 3300005440 Bacteria 2589
31 Ga0070700_100004587 3300005441 Bacteria 7232
32 Ga0070708_100108277 3300005445 Bacteria 2552
33 Ga0070678_100006530 3300005456 Bacteria 6850
34 Ga0070662_100008013 3300005457 Bacteria 6875
35 Ga0070681_10035676 3300005458 Unclassified 4994
36 Ga0070685_10017887 3300005466 Unclassified 3804
37 Ga0070685_10020120 3300005466 Unclassified 3610
38 Ga0070707_100046096 3300005468 Bacteria 4171
39 Ga0070707_100090067 3300005468 Bacteria 2969
40 Ga0070698_100022991 3300005471 Bacteria 6519
41 Ga0070699_100028040 3300005518 Bacteria 4856
42 Ga0070697_100028419 3300005536 Bacteria 4478
43 Ga0070672_100058758 3300005543 Bacteria 3024
44 Ga0070686_100003074 3300005544 Bacteria 9140
45 Ga0070695_100012751 3300005545 Bacteria 5046
46 Ga0070696_100038966 3300005546 Bacteria 3282
47 Ga0070704_100024288 3300005549 Bacteria 3975
48 Ga0070664_100003410 3300005564 Bacteria 12830
49 Ga0070664_100007807 3300005564 Bacteria 8641
50 Ga0068854_100054485 3300005578 Unclassified 2876
51 Ga0068854_100094605 3300005578 Bacteria 2229
52 Ga0068856_100065441 3300005614 Bacteria 3593
53 Ga0070702_100006492 3300005615 Bacteria 5541
54 Ga0068864_100011515 3300005618 Bacteria 7308
55 Ga0068864_100064869 3300005618 Unclassified 3168
56 Ga0068861_100004934 3300005719 Bacteria 8984
57 Ga0068861_100047362 3300005719 Bacteria 3245
58 Ga0068861_100096063 3300005719 Bacteria 2348
59 Ga0068870_10017938 3300005840 Bacteria 3408
60 Ga0068870_10019993 3300005840 Bacteria 3254
61 Ga0068863_100008464 3300005841 Bacteria 10049
62 Ga0068862_100017819 3300005844 Bacteria 5912
63 Ga0068862_100054104 3300005844 Bacteria 3437
64 Ga0081455_10015076 3300005937 Bacteria 7524
65 Ga0068871_100032580 3300006358 Bacteria 4119
66 Ga0068871_100063319 3300006358 Bacteria 3024
67 Ga0075428_100000010 3300006844 Bacteria 213631
68 Ga0075428_100044313 3300006844 Bacteria 4889
69 Ga0075430_100004499 3300006846 Bacteria 11746
70 Ga0075430_100032382 3300006846 Unclassified 4438
71 Ga0075430_100056946 3300006846 Unclassified 3287
72 Ga0075430_100073715 3300006846 Bacteria 2862
73 Ga0075431_100001821 3300006847 Bacteria 20130
74 Ga0075431_100017001 3300006847 Bacteria 7387
75 Ga0075431_100143997 3300006847 Bacteria 2456
76 Ga0075433_10009531 3300006852 Bacteria 7762
77 Ga0075433_10030223 3300006852 Bacteria 4621
78 Ga0075434_100001433 3300006871 Bacteria 20031
79 Ga0075429_100002329 3300006880 Bacteria 15954
80 Ga0075429_100050597 3300006880 Bacteria 3614
81 Ga0075429_100105397 3300006880 Bacteria 2462
82 Ga0075436_100001448 3300006914 Bacteria 16119
83 Ga0075436_100055899 3300006914 Bacteria 2726
84 Ga0075436_100056544 3300006914 Bacteria 2709
85 Ga0075435_100000190 3300007076 Bacteria 36880
86 Ga0075435_100000522 3300007076 Bacteria 23546
87 Ga0075435_100031680 3300007076 Unclassified 4168
88 Ga0075435_100069733 3300007076 Bacteria 2867
89 Ga0075435_100073475 3300007076 Bacteria 2795
90 Ga0075435_100076232 3300007076 Bacteria 2747
91 Ga0075435_100097601 3300007076 Bacteria 2432
92 Ga0105240_10014714 3300009093 Bacteria 10672
93 Ga0111539_10000001 3300009094 Bacteria 1035431
94 Ga0111539_10006833 3300009094 Bacteria 14661
95 Ga0111539_10027329 3300009094 Bacteria 6968
96 Ga0111539_10031394 3300009094 Bacteria 6453
97 Ga0111539_10033345 3300009094 Bacteria 6251
98 Ga0111539_10257971 3300009094 Unclassified 2030
99 Ga0105247_10008180 3300009101 Bacteria 6387
100 Ga0114129_10006204 3300009147 Bacteria 16952
101 Ga0114129_10037217 3300009147 Bacteria 6870
102 Ga0114129_10072679 3300009147 Bacteria 4795
103 Ga0114129_10103405 3300009147 Bacteria 3938
104 Ga0114129_10161071 3300009147 Bacteria 3065
105 Ga0114129_10176791 3300009147 Bacteria 2907
106 Ga0114129_10217887 3300009147 Bacteria 2577
107 Ga0105243_10050464 3300009148 Bacteria 3286
108 Ga0105248_10018254 3300009177 Bacteria 7746
109 Ga0105248_10039657 3300009177 Bacteria 5278
110 Ga0105248_10042330 3300009177 Bacteria 5107
111 Ga0105248_10052265 3300009177 Bacteria 4585
112 Ga0105248_10092940 3300009177 Bacteria 3397
113 Ga0105238_10113026 3300009551 Bacteria 2695
114 Ga0105249_10028944 3300009553 Bacteria 5001
115 Ga0163162_10031814 3300013306 Bacteria 5235
116 Ga0163162_10088105 3300013306 Bacteria 3184
117 Ga0157375_10030856 3300013308 Bacteria 5059
118 Ga0157375_10125581 3300013308 Bacteria 2680
119 Ga0163163_10035642 3300014325 Bacteria 4828
120 Ga0157380_10165504 3300014326 Bacteria 1926
121 Ga0157377_10014803 3300014745 Bacteria 3976
122 Ga0157379_10005237 3300014968 Bacteria 11140
123 Ga0157379_10012466 3300014968 Bacteria 7422
124 Ga0157379_10015781 3300014968 Bacteria 6637
125 Ga0157379_10026290 3300014968 Bacteria 5181
126 Ga0157376_10045287 3300014969 Bacteria 3621
127 Ga0213875_10018042 3300021388 Bacteria 3404
128 Ga0207697_10001576 3300025315 Bacteria 12322
129 Ga0207688_10010079 3300025901 Bacteria 5139
130 Ga0207688_10014839 3300025901 Bacteria 4228
131 Ga0207680_10008828 3300025903 Bacteria 4966
132 Ga0207645_10010008 3300025907 Bacteria 6529
133 Ga0207643_10000790 3300025908 Bacteria 19295
134 Ga0207643_10014881 3300025908 Bacteria 4231
135 Ga0207643_10070773 3300025908 Bacteria 2007
136 Ga0207662_10003072 3300025918 Bacteria 8516
137 Ga0207662_10062542 3300025918 Unclassified 2237
138 Ga0207657_10088942 3300025919 Bacteria 2581
139 Ga0207646_10020769 3300025922 Bacteria 6081
140 Ga0207646_10131001 3300025922 Bacteria 2257
141 Ga0207681_10011583 3300025923 Bacteria 5418
142 Ga0207681_10044469 3300025923 Bacteria 2976
143 Ga0207681_10063143 3300025923 Unclassified 2553
144 Ga0207650_10011318 3300025925 Bacteria 6139
145 Ga0207659_10010633 3300025926 Bacteria 5786
146 Ga0207659_10045069 3300025926 Bacteria 3106
147 Ga0207659_10046140 3300025926 Bacteria 3076
148 Ga0207644_10027380 3300025931 Bacteria 3937
149 Ga0207706_10009728 3300025933 Bacteria 8823
150 Ga0207706_10012838 3300025933 Bacteria 7626
151 Ga0207670_10057163 3300025936 Bacteria 2645
152 Ga0207669_10075829 3300025937 Bacteria 2132
153 Ga0207691_10004415 3300025940 Bacteria 13632
154 Ga0207691_10027278 3300025940 Bacteria 5356
155 Ga0207691_10075829 3300025940 Bacteria 3031
156 Ga0207711_10069517 3300025941 Bacteria 3052
157 Ga0207689_10022479 3300025942 Bacteria 5302
158 Ga0207667_10154540 3300025949 Bacteria 2361
159 Ga0207668_10025480 3300025972 Bacteria 3829
160 Ga0207640_10006269 3300025981 Bacteria 6521
161 Ga0207640_10054990 3300025981 Bacteria 2605
162 Ga0207658_10016883 3300025986 Bacteria 5024
163 Ga0207658_10032965 3300025986 Bacteria 3692
164 Ga0207703_10007535 3300026035 Bacteria 8634
165 Ga0207708_10001791 3300026075 Bacteria 15838
166 Ga0207708_10031381 3300026075 Bacteria 4032
167 Ga0207708_10065488 3300026075 Bacteria 2778
168 Ga0207641_10001739 3300026088 Bacteria 21027
169 Ga0207675_100024708 3300026118 Bacteria 5588
170 Ga0207675_100062381 3300026118 Bacteria 3481
171 Ga0207683_10003414 3300026121 Bacteria 13831
172 Ga0207683_10007732 3300026121 Bacteria 9205
173 Ga0207683_10044714 3300026121 Bacteria 3871
174 Ga0207428_10000002 3300027907 Bacteria 854851
175 Ga0207428_10002220 3300027907 Bacteria 19491
176 Ga0207428_10030973 3300027907 Unclassified 4419
177 Ga0268265_10026766 3300028380 Bacteria 4106
178 Ga0373948_0000224 3300034817 Bacteria 6680
179 Ga0373958_0000899 3300034819 Bacteria 3838
180 Ga0373959_0003721 3300034820 Bacteria 2439
181 Ga0373929_0001094 3300035085 Bacteria 5269
182 Ga0373934_0001732 3300035086 Bacteria 8013
183 Ga0373951_0001540 3300035091 Bacteria 6030
184 Ga0373952_0000779 3300035092 Bacteria 5738
185 Ga0373932_0002250 3300035112 Bacteria 4941
186 Ga0373941_0001924 3300035115 Bacteria 4498
187 Ga0373954_0026878 3300035118 Bacteria 2640
188 Ga0373954_0048776 3300035118 Bacteria 1984
189 Ga0373960_0000352 3300035121 Bacteria 8887
190 Ga0373942_0000156 3300035207 Bacteria 16511
191 Ga0373931_0009106 3300035691 Bacteria 4737
192 Ga0373935_0013582 3300035692 Bacteria 4916
193 Ga0373927_0029487 3300035695 Bacteria 3577
194 Ga0373937_0112728 3300036401 Bacteria 2530
195 Ga0439435_0008820 3300042436 Bacteria 2349
196 Ga0451576_0051696 3300045051 Bacteria 4308
197 Ga0451576_0093949 3300045051 Bacteria 3118
198 Ga0495651_0084823 3300046462 Bacteria 2386
199 Ga0495580_0001961 3300046472 Bacteria 18073
200 Ga0495580_0090782 3300046472 Bacteria 2127
201 Ga0495628_0107567 3300046516 Bacteria 2147
202 Ga0495586_0090752 3300046535 Bacteria 1688
203 Ga0495659_0025632 3300046664 Bacteria 2020
204 Ga0495604_0085715 3300047317 Bacteria 2350
205 Ga0496101_0001568 3300048904 Bacteria 13712
206 Ga0496104_0051435 3300048907 Bacteria 3888
207 Ga0496104_0088858 3300048907 Bacteria 2952
208 Ga0496106_0007793 3300048909 Bacteria 7924
209 Ga0496109_0028957 3300048912 Bacteria 4959
210 Ga0496114_0007113 3300048917 Bacteria 8828
211 nmdc:mga05p37_102527_c1 3300050507 Bacteria 3524
212 nmdc:mga05p37_145442_c1 3300050507 Bacteria 2903
213 nmdc:mga05p37_185759_c1 3300050507 Bacteria 2527
214 nmdc:mga05p37_26782_c1 3300050507 Bacteria 7011
215 nmdc:mga09592_42928_c1 3300050508 Bacteria 3804
216 nmdc:mga09592_46568_c1 3300050508 Bacteria 3653
217 nmdc:mga0qj67_4440_c1 3300050509 Bacteria 10159
218 nmdc:mga0qj67_66945_c1 3300050509 Bacteria 2861
219 nmdc:mga06r32_131589_c1 3300050510 Bacteria 2474
220 nmdc:mga06r32_29579_c1 3300050510 Bacteria 5136
221 nmdc:mga06r32_8438_c1 3300050510 Bacteria 9285
222 nmdc:mga08y16_124655_c1 3300050511 Bacteria 2680
223 nmdc:mga08y16_16021_c1 3300050511 Bacteria 7880
224 nmdc:mga08y16_215033_c1 3300050511 Bacteria 1990
225 nmdc:mga08y16_22114_c1 3300050511 Bacteria 6713
226 nmdc:mga08y16_29327_c1 3300050511 Bacteria 5797
227 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
228 nmdc:mga08y16_4481_c1 3300050511 Bacteria 14598
229 nmdc:mga0n895_49_c1 3300050512 Bacteria 73512
230 nmdc:mga0rr50_1217_c1 3300050513 Bacteria 13987
231 nmdc:mga0rr50_16_c1 3300050513 Bacteria 175739
232 nmdc:mga08x19_475_c1 3300050514 Bacteria 27117
233 nmdc:mga0a205_22962_c1 3300050515 Bacteria 5915
234 Ga0495619_0023974 3300053085 Bacteria 3913
235 Ga0068858_100012960
236 Ga0065712_10003534
237 Ga0065712_10077308
238 Ga0065715_10002889
239 Ga0065707_10094180
240 Ga0065707_10094452
241 Ga0070676_10010173
242 Ga0070676_10011246
243 Ga0070690_100017857
244 Ga0070670_100023370
245 Ga0070670_100027251
246 Ga0070670_100059546
247 Ga0070670_100074820
248 Ga0070666_10014156
249 Ga0068868_100033350
250 Ga0070691_10002107
251 Ga0070669_100017858
252 Ga0070669_100031240
253 Ga0070669_100038423
254 Ga0070675_100005040
255 Ga0070675_100008047
256 Ga0070675_100016817
257 Ga0070675_100040385
258 Ga0070675_100057270
259 Ga0070671_100004922
260 Ga0070674_100008033
261 Ga0070673_100009546
262 Ga0070673_100114475
263 Ga0070667_100071028
264 Ga0070705_100042914
265 Ga0070700_100004587
266 Ga0070708_100108277
267 Ga0070678_100006530
268 Ga0070662_100008013
269 Ga0070681_10035676
270 Ga0070685_10017887
271 Ga0070685_10020120
272 Ga0070707_100046096
273 Ga0070707_100090067
274 Ga0070698_100022991
275 Ga0070699_100028040
276 Ga0070697_100028419
277 Ga0070672_100058758
278 Ga0070686_100003074
279 Ga0070695_100012751
280 Ga0070696_100038966
281 Ga0070704_100024288
282 Ga0070664_100003410
283 Ga0070664_100007807
284 Ga0068854_100054485
285 Ga0068854_100094605
286 Ga0068856_100065441
287 Ga0070702_100006492
288 Ga0068864_100011515
289 Ga0068864_100064869
290 Ga0068861_100004934
291 Ga0068861_100047362
292 Ga0068861_100096063
293 Ga0068870_10017938
294 Ga0068870_10019993
295 Ga0068863_100008464
296 Ga0068862_100017819
297 Ga0068862_100054104
298 Ga0081455_10015076
299 Ga0068871_100032580
300 Ga0068871_100063319
301 Ga0075428_100000010
302 Ga0075428_100044313
303 Ga0075430_100004499
304 Ga0075430_100032382
305 Ga0075430_100056946
306 Ga0075430_100073715
307 Ga0075431_100001821
308 Ga0075431_100017001
309 Ga0075431_100143997
310 Ga0075433_10009531
311 Ga0075433_10030223
312 Ga0075434_100001433
313 Ga0075429_100002329
314 Ga0075429_100050597
315 Ga0075429_100105397
316 Ga0075436_100001448
317 Ga0075436_100055899
318 Ga0075436_100056544
319 Ga0075435_100000190
320 Ga0075435_100000522
321 Ga0075435_100031680
322 Ga0075435_100069733
323 Ga0075435_100073475
324 Ga0075435_100076232
325 Ga0075435_100097601
326 Ga0105240_10014714
327 Ga0111539_10000001
328 Ga0111539_10006833
329 Ga0111539_10027329
330 Ga0111539_10031394
331 Ga0111539_10033345
332 Ga0111539_10257971
333 Ga0105247_10008180
334 Ga0114129_10006204
335 Ga0114129_10037217
336 Ga0114129_10072679
337 Ga0114129_10103405
338 Ga0114129_10161071
339 Ga0114129_10176791
340 Ga0114129_10217887
341 Ga0105243_10050464
342 Ga0105248_10018254
343 Ga0105248_10039657
344 Ga0105248_10042330
345 Ga0105248_10052265
346 Ga0105248_10092940
347 Ga0105238_10113026
348 Ga0105249_10028944
349 Ga0163162_10031814
350 Ga0163162_10088105
351 Ga0157375_10030856
352 Ga0157375_10125581
353 Ga0163163_10035642
354 Ga0157380_10165504
355 Ga0157377_10014803
356 Ga0157379_10005237
357 Ga0157379_10012466
358 Ga0157379_10015781
359 Ga0157379_10026290
360 Ga0157376_10045287
361 Ga0213875_10018042
362 Ga0207697_10001576
363 Ga0207688_10010079
364 Ga0207688_10014839
365 Ga0207680_10008828
366 Ga0207645_10010008
367 Ga0207643_10000790
368 Ga0207643_10014881
369 Ga0207643_10070773
370 Ga0207662_10003072
371 Ga0207662_10062542
372 Ga0207657_10088942
373 Ga0207646_10020769
374 Ga0207646_10131001
375 Ga0207681_10011583
376 Ga0207681_10044469
377 Ga0207681_10063143
378 Ga0207650_10011318
379 Ga0207659_10010633
380 Ga0207659_10045069
381 Ga0207659_10046140
382 Ga0207644_10027380
383 Ga0207706_10009728
384 Ga0207706_10012838
385 Ga0207670_10057163
386 Ga0207669_10075829
387 Ga0207691_10004415
388 Ga0207691_10027278
389 Ga0207691_10075829
390 Ga0207711_10069517
391 Ga0207689_10022479
392 Ga0207667_10154540
393 Ga0207668_10025480
394 Ga0207640_10006269
395 Ga0207640_10054990
396 Ga0207658_10016883
397 Ga0207658_10032965
398 Ga0207703_10007535
399 Ga0207708_10001791
400 Ga0207708_10031381
401 Ga0207708_10065488
402 Ga0207641_10001739
403 Ga0207675_100024708
404 Ga0207675_100062381
405 Ga0207683_10003414
406 Ga0207683_10007732
407 Ga0207683_10044714
408 Ga0207428_10000002
409 Ga0207428_10002220
410 Ga0207428_10030973
411 Ga0268265_10026766
412 Ga0373948_0000224
413 Ga0373958_0000899
414 Ga0373959_0003721
415 Ga0373929_0001094
416 Ga0373934_0001732
417 Ga0373951_0001540
418 Ga0373952_0000779
419 Ga0373932_0002250
420 Ga0373941_0001924
421 Ga0373954_0026878
422 Ga0373954_0048776
423 Ga0373960_0000352
424 Ga0373942_0000156
425 Ga0373931_0009106
426 Ga0373935_0013582
427 Ga0373927_0029487
428 Ga0373937_0112728
429 Ga0439435_0008820
430 Ga0451576_0051696
431 Ga0451576_0093949
432 Ga0495651_0084823
433 Ga0495580_0001961
434 Ga0495580_0090782
435 Ga0495628_0107567
436 Ga0495586_0090752
437 Ga0495659_0025632
438 Ga0495604_0085715
439 Ga0496101_0001568
440 Ga0496104_0051435
441 Ga0496104_0088858
442 Ga0496106_0007793
443 Ga0496109_0028957
444 Ga0496114_0007113
445 nmdc:mga05p37_102527_c1
446 nmdc:mga05p37_145442_c1
447 nmdc:mga05p37_185759_c1
448 nmdc:mga05p37_26782_c1
449 nmdc:mga09592_42928_c1
450 nmdc:mga09592_46568_c1
451 nmdc:mga0qj67_4440_c1
452 nmdc:mga0qj67_66945_c1
453 nmdc:mga06r32_131589_c1
454 nmdc:mga06r32_29579_c1
455 nmdc:mga06r32_8438_c1
456 nmdc:mga08y16_124655_c1
457 nmdc:mga08y16_16021_c1
458 nmdc:mga08y16_215033_c1
459 nmdc:mga08y16_22114_c1
460 nmdc:mga08y16_29327_c1
461 nmdc:mga08y16_3_c1
462 nmdc:mga08y16_4481_c1
463 nmdc:mga0n895_49_c1
464 nmdc:mga0rr50_1217_c1
465 nmdc:mga0rr50_16_c1
466 nmdc:mga08x19_475_c1
467 nmdc:mga0a205_22962_c1
468 Ga0495619_0023974

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01011

PQQ

PQQ enzyme repeat

120

157

0.83

PF13360

PQQ_2

PQQ-like domain

538

646

0.74

PF13360

PQQ_2

PQQ-like domain

74

161

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yms-assembly1.cif.gz_A structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.7945 92 226
7tt4-assembly1.cif.gz_B bamabcde bound to substrate espp class 6 0.7658 50 601
4xga-assembly1.cif.gz_A crystal structure of bamb and bama p3-5 complex from e.coli 0.7657 50 602
2yms-assembly1.cif.gz_A structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.7589 92 226
4xga-assembly1.cif.gz_A crystal structure of bamb and bama p3-5 complex from e.coli 0.7554 50 602
ID Description Score Start End Superfamily
af_Q60282_716_812_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8451 99 216 2.40.128.630
af_Q9VLL0_923_1012_2.40.10.480 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.831 544 601 2.40.10.480
af_Q60282_716_812_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8217 99 216 2.40.128.630
af_A0A0P0WC96_1_125_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8068 100 161 2.130.10.10
af_P15877_153_794_2.140.10.10 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.7946 30 605 2.140.10.10
ID Description Score Start End GO Terms
AF-A0A6L8GJZ6-F1-model_v4 PQQ-binding-like beta-propeller repeat protein 0.9869 499 605
AF-A0A257XCK8-F1-model_v4 PQQ-dependent dehydrogenase, methanol/ethanol family 0.9771 511 593
AF-A0A2V8ICW1-F1-model_v4 Uncharacterized protein 0.9755 490 605
AF-A0A1F2RJQ1-F1-model_v4 Uncharacterized protein 0.9665 501 605
AF-A0A6L7WST9-F1-model_v4 PQQ-binding-like beta-propeller repeat protein 0.9579 371 605

Map