F346907
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 234 | 140 | 234 | 127 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100146933|Ga0068855_1001469336 |
| Length | 147 |
| Sequence | MPVQAIAKGVRISPRKVAVVAALVRGRTVEDALTILEHTPRSSAIAVRKVIESARANADHNHGFKPASLQIVEITVTHGPRTKRYRPAAHGRALPFQRRSSHIRVVVDGEKRPAAAKAMADQEVKKPVSAKATTGRPASDNKEKEEK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 19 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 20 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 21 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 22 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 23 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 24 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 25 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 26 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 27 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 28 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 29 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 31 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 32 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 33 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 34 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 41 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 42 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 76 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 77 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 78 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 79 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 80 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 81 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 82 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 83 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 84 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 85 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 86 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 87 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 88 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 89 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 90 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 91 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 92 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 93 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 94 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 95 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 96 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 97 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 98 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 99 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 100 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 101 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 102 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 103 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 104 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 105 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 106 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 107 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 108 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 109 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 110 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 111 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 112 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 113 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 114 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 115 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 116 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 117 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 118 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 119 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 120 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 121 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 122 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 123 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 124 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 125 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 126 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 127 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 128 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 129 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 130 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 131 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 132 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 133 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 134 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 135 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 136 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 137 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 138 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 139 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 140 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.57 |
| Metatranscriptomes | 0.43 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.09 |
| Nodule | 0 |
| Rhizoplane | 1.71 |
| Rhizosphere | 77.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10000244 | 3300003320 | Bacteria | 697651 |
| 2 | Ga0058863_11756211 | 3300004799 | Bacteria | 2363 |
| 3 | Ga0070658_10000015 | 3300005327 | Bacteria | 230579 |
| 4 | Ga0070658_10331712 | 3300005327 | Bacteria | 1300 |
| 5 | Ga0070683_100143254 | 3300005329 | Bacteria | 2264 |
| 6 | Ga0070680_101664078 | 3300005336 | Unclassified | 553 |
| 7 | Ga0070682_100532263 | 3300005337 | Bacteria | 916 |
| 8 | Ga0070682_100732784 | 3300005337 | Bacteria | 796 |
| 9 | Ga0070660_100002817 | 3300005339 | Bacteria | 11964 |
| 10 | Ga0070660_101658426 | 3300005339 | Bacteria | 544 |
| 11 | Ga0070661_100198654 | 3300005344 | Unclassified | 1531 |
| 12 | Ga0070674_100014629 | 3300005356 | Bacteria | 4881 |
| 13 | Ga0070688_100237926 | 3300005365 | Bacteria | 1291 |
| 14 | Ga0070659_100195902 | 3300005366 | Bacteria | 1662 |
| 15 | Ga0070681_10002189 | 3300005458 | Bacteria | 17788 |
| 16 | Ga0070681_10198609 | 3300005458 | Bacteria | 1924 |
| 17 | Ga0070681_10489977 | 3300005458 | Bacteria | 1142 |
| 18 | Ga0070685_10002659 | 3300005466 | Bacteria | 9153 |
| 19 | Ga0070679_100002994 | 3300005530 | Bacteria | 15427 |
| 20 | Ga0070679_100025007 | 3300005530 | Bacteria | 5855 |
| 21 | Ga0070679_100137212 | 3300005530 | Bacteria | 2427 |
| 22 | Ga0070679_100220587 | 3300005530 | Archaea | 1857 |
| 23 | Ga0070679_100402896 | 3300005530 | Bacteria | 1314 |
| 24 | Ga0070679_100561398 | 3300005530 | Bacteria | 1085 |
| 25 | Ga0070679_100673507 | 3300005530 | Bacteria | 977 |
| 26 | Ga0070684_100255142 | 3300005535 | Bacteria | 1603 |
| 27 | Ga0070684_100428671 | 3300005535 | Bacteria | 1221 |
| 28 | Ga0070693_100320550 | 3300005547 | Unclassified | 1051 |
| 29 | Ga0070665_101492643 | 3300005548 | Bacteria | 684 |
| 30 | Ga0068855_100004673 | 3300005563 | Bacteria | 16726 |
| 31 | Ga0068855_100023229 | 3300005563 | Bacteria | 7428 |
| 32 | Ga0068855_100146933 | 3300005563 | Bacteria | 2683 |
| 33 | Ga0068855_100606424 | 3300005563 | Bacteria | 1180 |
| 34 | Ga0068857_100302687 | 3300005577 | Bacteria | 1474 |
| 35 | Ga0068854_100200292 | 3300005578 | Unclassified | 1569 |
| 36 | Ga0068856_100022566 | 3300005614 | Bacteria | 6119 |
| 37 | Ga0068856_100364764 | 3300005614 | Unclassified | 1463 |
| 38 | Ga0068856_100689310 | 3300005614 | Bacteria | 1042 |
| 39 | Ga0068856_101102455 | 3300005614 | Bacteria | 811 |
| 40 | Ga0068852_100210707 | 3300005616 | Bacteria | 1843 |
| 41 | Ga0068858_100022783 | 3300005842 | Bacteria | 5841 |
| 42 | Ga0075368_10000103 | 3300006042 | Bacteria | 21865 |
| 43 | Ga0075368_10219676 | 3300006042 | Bacteria | 807 |
| 44 | Ga0075363_100000006 | 3300006048 | Bacteria | 47292 |
| 45 | Ga0075363_101033275 | 3300006048 | Bacteria | 507 |
| 46 | Ga0075364_10000255 | 3300006051 | Bacteria | 25673 |
| 47 | Ga0075364_10279818 | 3300006051 | Bacteria | 1135 |
| 48 | Ga0075364_10764345 | 3300006051 | Bacteria | 659 |
| 49 | Ga0075367_10000021 | 3300006178 | Bacteria | 33969 |
| 50 | Ga0075367_10000146 | 3300006178 | Bacteria | 21661 |
| 51 | Ga0075366_10001116 | 3300006195 | Bacteria | 13216 |
| 52 | Ga0075366_10681411 | 3300006195 | Bacteria | 638 |
| 53 | Ga0097621_100000264 | 3300006237 | Bacteria | 35498 |
| 54 | Ga0075370_10015049 | 3300006353 | Bacteria | 4135 |
| 55 | Ga0068871_100000039 | 3300006358 | Bacteria | 69204 |
| 56 | Ga0075428_100003149 | 3300006844 | Bacteria | 18020 |
| 57 | Ga0075430_100014603 | 3300006846 | Bacteria | 6690 |
| 58 | Ga0105240_10120762 | 3300009093 | Bacteria | 3155 |
| 59 | Ga0105240_11166404 | 3300009093 | Bacteria | 817 |
| 60 | Ga0105245_10000002 | 3300009098 | Bacteria | 634374 |
| 61 | Ga0105245_10004821 | 3300009098 | Bacteria | 11893 |
| 62 | Ga0105245_10308298 | 3300009098 | Bacteria | 1556 |
| 63 | Ga0105241_10188144 | 3300009174 | Bacteria | 1717 |
| 64 | Ga0105241_10213598 | 3300009174 | Bacteria | 1617 |
| 65 | Ga0105241_11643473 | 3300009174 | Bacteria | 623 |
| 66 | Ga0105242_10007562 | 3300009176 | Bacteria | 8364 |
| 67 | Ga0105242_11224549 | 3300009176 | Bacteria | 771 |
| 68 | Ga0105238_10000579 | 3300009551 | Bacteria | 38459 |
| 69 | Ga0105238_10823816 | 3300009551 | Bacteria | 944 |
| 70 | Ga0105249_10921270 | 3300009553 | Bacteria | 941 |
| 71 | Ga0105033_100289 | 3300009986 | Bacteria | 3966 |
| 72 | Ga0105028_105991 | 3300009993 | Bacteria | 1266 |
| 73 | Ga0105239_10032725 | 3300010375 | Bacteria | 5713 |
| 74 | Ga0157373_10276398 | 3300013100 | Bacteria | 1190 |
| 75 | Ga0157369_10467584 | 3300013105 | Bacteria | 1306 |
| 76 | Ga0157369_11792555 | 3300013105 | Bacteria | 623 |
| 77 | Ga0157374_10000031 | 3300013296 | Bacteria | 204840 |
| 78 | Ga0157374_10007401 | 3300013296 | Bacteria | 9365 |
| 79 | Ga0157380_10344182 | 3300014326 | Bacteria | 1392 |
| 80 | Ga0157379_11408466 | 3300014968 | Unclassified | 676 |
| 81 | Ga0157379_12161551 | 3300014968 | Unclassified | 552 |
| 82 | Ga0207705_10000011 | 3300025909 | Bacteria | 517768 |
| 83 | Ga0207705_10083261 | 3300025909 | Bacteria | 2334 |
| 84 | Ga0207705_10160104 | 3300025909 | Unclassified | 1691 |
| 85 | Ga0207654_10202435 | 3300025911 | Bacteria | 1308 |
| 86 | Ga0207654_10206024 | 3300025911 | Bacteria | 1297 |
| 87 | Ga0207707_10279802 | 3300025912 | Bacteria | 1445 |
| 88 | Ga0207707_10297187 | 3300025912 | Bacteria | 1397 |
| 89 | Ga0207695_10802017 | 3300025913 | Bacteria | 822 |
| 90 | Ga0207671_10431677 | 3300025914 | Bacteria | 1048 |
| 91 | Ga0207660_10421337 | 3300025917 | Bacteria | 1077 |
| 92 | Ga0207660_11223008 | 3300025917 | Bacteria | 611 |
| 93 | Ga0207660_11512461 | 3300025917 | Unclassified | 542 |
| 94 | Ga0207657_10006928 | 3300025919 | Bacteria | 11684 |
| 95 | Ga0207649_10771153 | 3300025920 | Bacteria | 749 |
| 96 | Ga0207652_10007005 | 3300025921 | Bacteria | 9087 |
| 97 | Ga0207652_10075557 | 3300025921 | Bacteria | 2937 |
| 98 | Ga0207652_10310938 | 3300025921 | Bacteria | 1422 |
| 99 | Ga0207652_10595896 | 3300025921 | Bacteria | 991 |
| 100 | Ga0207652_10879229 | 3300025921 | Bacteria | 792 |
| 101 | Ga0207652_10961222 | 3300025921 | Unclassified | 752 |
| 102 | Ga0207652_11418331 | 3300025921 | Bacteria | 598 |
| 103 | Ga0207652_11730276 | 3300025921 | Unclassified | 530 |
| 104 | Ga0207694_10000232 | 3300025924 | Bacteria | 53672 |
| 105 | Ga0207687_10000001 | 3300025927 | Bacteria | 1130810 |
| 106 | Ga0207687_10000030 | 3300025927 | Bacteria | 155548 |
| 107 | Ga0207687_10015188 | 3300025927 | Bacteria | 5046 |
| 108 | Ga0207687_10190578 | 3300025927 | Bacteria | 1595 |
| 109 | Ga0207687_10220400 | 3300025927 | Bacteria | 1493 |
| 110 | Ga0207687_11664757 | 3300025927 | Bacteria | 547 |
| 111 | Ga0207664_10003229 | 3300025929 | Bacteria | 10836 |
| 112 | Ga0207664_11247870 | 3300025929 | Bacteria | 662 |
| 113 | Ga0207690_10361785 | 3300025932 | Bacteria | 1150 |
| 114 | Ga0207690_10513227 | 3300025932 | Bacteria | 971 |
| 115 | Ga0207686_10005025 | 3300025934 | Bacteria | 7120 |
| 116 | Ga0207669_10017111 | 3300025937 | Bacteria | 3708 |
| 117 | Ga0207661_10262103 | 3300025944 | Bacteria | 1540 |
| 118 | Ga0207661_11460679 | 3300025944 | Bacteria | 627 |
| 119 | Ga0207667_10000299 | 3300025949 | Bacteria | 68595 |
| 120 | Ga0207667_10031938 | 3300025949 | Bacteria | 5679 |
| 121 | Ga0207667_10050173 | 3300025949 | Bacteria | 4404 |
| 122 | Ga0207667_10138733 | 3300025949 | Bacteria | 2503 |
| 123 | Ga0207651_10826825 | 3300025960 | Bacteria | 822 |
| 124 | Ga0207712_10456523 | 3300025961 | Bacteria | 1084 |
| 125 | Ga0207640_10257897 | 3300025981 | Bacteria | 1357 |
| 126 | Ga0207703_10076947 | 3300026035 | Bacteria | 2769 |
| 127 | Ga0207639_10001800 | 3300026041 | Bacteria | 14423 |
| 128 | Ga0207702_10034254 | 3300026078 | Bacteria | 4245 |
| 129 | Ga0207641_10036604 | 3300026088 | Bacteria | 4097 |
| 130 | Ga0207674_10012488 | 3300026116 | Bacteria | 9490 |
| 131 | Ga0209813_10000009 | 3300027866 | Bacteria | 102315 |
| 132 | Ga0268266_10003734 | 3300028379 | Bacteria | 14969 |
| 133 | Ga0265326_10017045 | 3300028558 | Bacteria | 2098 |
| 134 | Ga0265319_1181332 | 3300028563 | Bacteria | 649 |
| 135 | Ga0265334_10051233 | 3300028573 | Bacteria | 1583 |
| 136 | Ga0265322_10078246 | 3300028654 | Bacteria | 938 |
| 137 | Ga0265338_10028695 | 3300028800 | Bacteria | 5543 |
| 138 | Ga0265338_10260487 | 3300028800 | Bacteria | 1275 |
| 139 | Ga0265338_10304951 | 3300028800 | Bacteria | 1156 |
| 140 | Ga0265338_10356938 | 3300028800 | Bacteria | 1049 |
| 141 | Ga0265324_10015771 | 3300029957 | Bacteria | 2773 |
| 142 | Ga0265339_10129328 | 3300031249 | Bacteria | 1293 |
| 143 | Ga0265327_10000017 | 3300031251 | Bacteria | 445264 |
| 144 | Ga0265327_10005878 | 3300031251 | Bacteria | 10026 |
| 145 | Ga0265327_10010524 | 3300031251 | Bacteria | 6491 |
| 146 | Ga0265327_10031602 | 3300031251 | Bacteria | 2972 |
| 147 | Ga0265327_10306583 | 3300031251 | Bacteria | 698 |
| 148 | Ga0265316_10050606 | 3300031344 | Bacteria | 3266 |
| 149 | Ga0265316_10451107 | 3300031344 | Bacteria | 922 |
| 150 | Ga0395899_0009875 | 3300037312 | Bacteria | 7318 |
| 151 | Ga0395900_0001412 | 3300037418 | Bacteria | 28734 |
| 152 | Ga0395900_0012262 | 3300037418 | Bacteria | 8765 |
| 153 | Ga0395900_0245759 | 3300037418 | Bacteria | 1793 |
| 154 | Ga0395900_0963774 | 3300037418 | Bacteria | 774 |
| 155 | Ga0395898_0002536 | 3300037466 | Bacteria | 21416 |
| 156 | Ga0395905_0008237 | 3300037471 | Bacteria | 10294 |
| 157 | Ga0395905_0090915 | 3300037471 | Bacteria | 2862 |
| 158 | Ga0395905_0599614 | 3300037471 | Bacteria | 1003 |
| 159 | Ga0395905_1540554 | 3300037471 | Bacteria | 569 |
| 160 | Ga0395901_0021849 | 3300038443 | Bacteria | 6557 |
| 161 | Ga0395901_0027323 | 3300038443 | Bacteria | 5862 |
| 162 | Ga0395901_0049827 | 3300038443 | Bacteria | 4352 |
| 163 | Ga0451804_0448241 | 3300041463 | Bacteria | 808 |
| 164 | Ga0451833_0025125 | 3300041491 | Bacteria | 685 |
| 165 | Ga0466963_0795473 | 3300044694 | Unclassified | 667 |
| 166 | Ga0466967_0327555 | 3300045976 | Bacteria | 1479 |
| 167 | Ga0496100_0036246 | 3300048903 | Bacteria | 3109 |
| 168 | Ga0496101_0974895 | 3300048904 | Bacteria | 667 |
| 169 | Ga0496112_0002149 | 3300048915 | Bacteria | 15656 |
| 170 | Ga0501031_0004386 | 3300049568 | Bacteria | 9142 |
| 171 | Ga0501032_0009702 | 3300049569 | Bacteria | 6971 |
| 172 | Ga0501033_0230599 | 3300049570 | Bacteria | 1316 |
| 173 | Ga0501034_0020539 | 3300049571 | Bacteria | 6745 |
| 174 | Ga0501034_0028473 | 3300049571 | Bacteria | 5686 |
| 175 | Ga0501036_0029140 | 3300049572 | Bacteria | 4666 |
| 176 | Ga0501036_0287630 | 3300049572 | Bacteria | 1375 |
| 177 | Ga0501037_0000133 | 3300049573 | Bacteria | 69741 |
| 178 | Ga0501038_0213009 | 3300049574 | Bacteria | 1545 |
| 179 | Ga0501040_0183932 | 3300049576 | Bacteria | 1482 |
| 180 | Ga0501042_0054606 | 3300049578 | Bacteria | 2850 |
| 181 | Ga0501043_0000404 | 3300049579 | Bacteria | 38801 |
| 182 | Ga0501046_0000038 | 3300049580 | Bacteria | 159193 |
| 183 | Ga0501046_0174800 | 3300049580 | Unclassified | 1609 |
| 184 | Ga0501047_0000229 | 3300049581 | Bacteria | 66412 |
| 185 | Ga0501047_0006066 | 3300049581 | Bacteria | 11360 |
| 186 | Ga0501048_0000033 | 3300049582 | Bacteria | 64896 |
| 187 | Ga0501048_0106238 | 3300049582 | Bacteria | 1981 |
| 188 | Ga0501069_0275799 | 3300049585 | Bacteria | 983 |
| 189 | Ga0501070_0191453 | 3300049586 | Bacteria | 1681 |
| 190 | Ga0501070_0251922 | 3300049586 | Bacteria | 1444 |
| 191 | Ga0501070_0738750 | 3300049586 | Bacteria | 776 |
| 192 | Ga0501074_0976956 | 3300049590 | Bacteria | 595 |
| 193 | Ga0501080_0001402 | 3300049742 | Bacteria | 20194 |
| 194 | Ga0501083_0026580 | 3300049744 | Bacteria | 4000 |
| 195 | Ga0501035_0000033 | 3300049822 | Bacteria | 175087 |
| 196 | Ga0501035_0000562 | 3300049822 | Bacteria | 41104 |
| 197 | Ga0501044_0028311 | 3300049823 | Bacteria | 5914 |
| 198 | nmdc:mga03n38_19_c1 | 3300050490 | Bacteria | 41192 |
| 199 | nmdc:mga03n38_950823_c1 | 3300050490 | Bacteria | 507 |
| 200 | nmdc:mga00v17_1627_c1 | 3300050491 | Bacteria | 11750 |
| 201 | nmdc:mga00v17_568106_c1 | 3300050491 | Bacteria | 733 |
| 202 | nmdc:mga0k408_1480_c1 | 3300050493 | Bacteria | 12680 |
| 203 | nmdc:mga0k408_328574_c1 | 3300050493 | Bacteria | 912 |
| 204 | nmdc:mga06z11_14_c1 | 3300050494 | Bacteria | 96662 |
| 205 | nmdc:mga06z11_193_c1 | 3300050494 | Bacteria | 21686 |
| 206 | nmdc:mga04h51_10_c1 | 3300050495 | Bacteria | 102434 |
| 207 | nmdc:mga04h51_1402_c1 | 3300050495 | Bacteria | 5569 |
| 208 | nmdc:mga07m45_18647_c1 | 3300050496 | Bacteria | 3751 |
| 209 | nmdc:mga0qj67_13713_c1 | 3300050509 | Bacteria | 6116 |
| 210 | nmdc:mga0a205_1050397_c1 | 3300050515 | Bacteria | 662 |
| 211 | nmdc:mga0sz30_447801_c1 | 3300050516 | Unclassified | 579 |
| 212 | Ga0500610_0000001 | 3300053079 | Bacteria | 185468 |
| 213 | Ga0500610_0049137 | 3300053079 | Bacteria | 2194 |
| 214 | Ga0500643_000010 | 3300053087 | Bacteria | 408084 |
| 215 | Ga0500643_022206 | 3300053087 | Bacteria | 2046 |
| 216 | Ga0500643_092588 | 3300053087 | Bacteria | 824 |
| 217 | Ga0500644_0000365 | 3300053088 | Bacteria | 22175 |
| 218 | Ga0500644_0024522 | 3300053088 | Bacteria | 1845 |
| 219 | Ga0500583_0030631 | 3300053092 | Bacteria | 2358 |
| 220 | Ga0500651_0000416 | 3300053093 | Bacteria | 22899 |
| 221 | Ga0500651_0137106 | 3300053093 | Bacteria | 1477 |
| 222 | Ga0500650_0000001 | 3300053098 | Bacteria | 818797 |
| 223 | Ga0500555_000002 | 3300053103 | Bacteria | 1314346 |
| 224 | Ga0500562_000002 | 3300053108 | Bacteria | 977234 |
| 225 | Ga0500562_020713 | 3300053108 | Bacteria | 1708 |
| 226 | Ga0500594_0000001 | 3300053118 | Bacteria | 1178472 |
| 227 | Ga0500614_000512 | 3300053123 | Bacteria | 10049 |
| 228 | Ga0500652_000084 | 3300053131 | Bacteria | 39562 |
| 229 | Ga0500655_032946 | 3300053133 | Bacteria | 1001 |
| 230 | Ga0500568_0008745 | 3300053139 | Bacteria | 4856 |
| 231 | Ga0500568_0011379 | 3300053139 | Bacteria | 4135 |
| 232 | Ga0500579_021018 | 3300053143 | Bacteria | 4233 |
| 233 | Ga0500570_000045 | 3300053724 | Bacteria | 31120 |
| 234 | Ga0501082_0245057 | 3300060353 | Bacteria | 1560 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028573 | Ga0265334_10051233 | Ga0265334_100512332 | 114 |
| 2 | 3300031251 | Ga0265327_10005878 | Ga0265327_1000587813 | 114 |
| 3 | 3300053724 | Ga0500570_000045 | Ga0500570_000045_22258_22617 | 114 |
| 4 | 3300005458 | Ga0070681_10002189 | Ga0070681_1000218918 | 118 |
| 5 | 3300049586 | Ga0501070_0251922 | Ga0501070_0251922_924_1334 | 118 |
| 6 | 3300005356 | Ga0070674_100014629 | Ga0070674_10001462910 | 119 |
| 7 | 3300005365 | Ga0070688_100237926 | Ga0070688_1002379262 | 119 |
| 8 | 3300005466 | Ga0070685_10002659 | Ga0070685_1000265910 | 119 |
| 9 | 3300005548 | Ga0070665_101492643 | Ga0070665_1014926432 | 119 |
| 10 | 3300025937 | Ga0207669_10017111 | Ga0207669_100171117 | 119 |
| 11 | 3300028379 | Ga0268266_10003734 | Ga0268266_100037343 | 119 |
| 12 | 3300049568 | Ga0501031_0004386 | Ga0501031_0004386_3909_4319 | 119 |
| 13 | 3300049569 | Ga0501032_0009702 | Ga0501032_0009702_5476_5886 | 119 |
| 14 | 3300049571 | Ga0501034_0020539 | Ga0501034_0020539_5187_5597 | 119 |
| 15 | 3300049572 | Ga0501036_0029140 | Ga0501036_0029140_1758_2168 | 119 |
| 16 | 3300049573 | Ga0501037_0000133 | Ga0501037_0000133_32915_33325 | 119 |
| 17 | 3300049574 | Ga0501038_0213009 | Ga0501038_0213009_1022_1432 | 119 |
| 18 | 3300049576 | Ga0501040_0183932 | Ga0501040_0183932_939_1349 | 119 |
| 19 | 3300049578 | Ga0501042_0054606 | Ga0501042_0054606_1772_2182 | 119 |
| 20 | 3300049579 | Ga0501043_0000404 | Ga0501043_0000404_32084_32494 | 119 |
| 21 | 3300049580 | Ga0501046_0000038 | Ga0501046_0000038_116864_117274 | 119 |
| 22 | 3300049581 | Ga0501047_0006066 | Ga0501047_0006066_8843_9253 | 119 |
| 23 | 3300049582 | Ga0501048_0000033 | Ga0501048_0000033_47289_47699 | 119 |
| 24 | 3300049585 | Ga0501069_0275799 | Ga0501069_0275799_128_538 | 119 |
| 25 | 3300049590 | Ga0501074_0976956 | Ga0501074_0976956_13_423 | 119 |
| 26 | 3300049744 | Ga0501083_0026580 | Ga0501083_0026580_3488_3898 | 119 |
| 27 | 3300049822 | Ga0501035_0000562 | Ga0501035_0000562_36014_36424 | 119 |
| 28 | 3300049823 | Ga0501044_0028311 | Ga0501044_0028311_44_454 | 119 |
| 29 | 3300060353 | Ga0501082_0245057 | Ga0501082_0245057_966_1376 | 119 |
| 30 | 3300005366 | Ga0070659_100195902 | Ga0070659_1001959022 | 120 |
| 31 | 3300005458 | Ga0070681_10198609 | Ga0070681_101986093 | 120 |
| 32 | 3300005530 | Ga0070679_100025007 | Ga0070679_1000250073 | 120 |
| 33 | 3300005614 | Ga0068856_100022566 | Ga0068856_1000225666 | 120 |
| 34 | 3300025932 | Ga0207690_10513227 | Ga0207690_105132272 | 120 |
| 35 | 3300026078 | Ga0207702_10034254 | Ga0207702_100342546 | 120 |
| 36 | 3300026088 | Ga0207641_10036604 | Ga0207641_100366042 | 120 |
| 37 | 3300048915 | Ga0496112_0002149 | Ga0496112_0002149_11479_11871 | 120 |
| 38 | 3300010375 | Ga0105239_10032725 | Ga0105239_100327252 | 121 |
| 39 | 3300025912 | Ga0207707_10297187 | Ga0207707_102971872 | 121 |
| 40 | 3300025921 | Ga0207652_10007005 | Ga0207652_1000700516 | 121 |
| 41 | 3300038443 | Ga0395901_0049827 | Ga0395901_0049827_1308_1700 | 121 |
| 42 | 3300048903 | Ga0496100_0036246 | Ga0496100_0036246_1931_2323 | 121 |
| 43 | 3300048904 | Ga0496101_0974895 | Ga0496101_0974895_163_555 | 121 |
| 44 | 3300053079 | Ga0500610_0049137 | Ga0500610_0049137_362_763 | 121 |
| 45 | 3300053088 | Ga0500644_0024522 | Ga0500644_0024522_1318_1719 | 121 |
| 46 | 3300053092 | Ga0500583_0030631 | Ga0500583_0030631_391_792 | 121 |
| 47 | 3300053098 | Ga0500650_0000001 | Ga0500650_0000001_518452_518853 | 121 |
| 48 | 3300053118 | Ga0500594_0000001 | Ga0500594_0000001_2567_2968 | 121 |
| 49 | 3300053133 | Ga0500655_032946 | Ga0500655_032946_380_781 | 121 |
| 50 | 3300053143 | Ga0500579_021018 | Ga0500579_021018_3497_3898 | 121 |
| 51 | 3300005337 | Ga0070682_100532263 | Ga0070682_1005322632 | 122 |
| 52 | 3300028800 | Ga0265338_10260487 | Ga0265338_102604873 | 122 |
| 53 | 3300037471 | Ga0395905_0090915 | Ga0395905_0090915_2167_2559 | 122 |
| 54 | 3300049571 | Ga0501034_0028473 | Ga0501034_0028473_3768_4199 | 122 |
| 55 | 3300049572 | Ga0501036_0287630 | Ga0501036_0287630_313_744 | 122 |
| 56 | 3300049581 | Ga0501047_0000229 | Ga0501047_0000229_62820_63251 | 122 |
| 57 | 3300049582 | Ga0501048_0106238 | Ga0501048_0106238_64_495 | 122 |
| 58 | 3300049586 | Ga0501070_0738750 | Ga0501070_0738750_102_533 | 122 |
| 59 | 3300049822 | Ga0501035_0000033 | Ga0501035_0000033_160864_161295 | 122 |
| 60 | 3300005327 | Ga0070658_10331712 | Ga0070658_103317123 | 123 |
| 61 | 3300005614 | Ga0068856_101102455 | Ga0068856_1011024551 | 123 |
| 62 | 3300006042 | Ga0075368_10000103 | Ga0075368_1000010316 | 123 |
| 63 | 3300006048 | Ga0075363_100000006 | Ga0075363_10000000613 | 123 |
| 64 | 3300006048 | Ga0075363_101033275 | Ga0075363_1010332751 | 123 |
| 65 | 3300006178 | Ga0075367_10000021 | Ga0075367_1000002147 | 123 |
| 66 | 3300006353 | Ga0075370_10015049 | Ga0075370_100150497 | 123 |
| 67 | 3300006844 | Ga0075428_100003149 | Ga0075428_10000314914 | 123 |
| 68 | 3300006846 | Ga0075430_100014603 | Ga0075430_1000146034 | 123 |
| 69 | 3300009098 | Ga0105245_10004821 | Ga0105245_1000482112 | 123 |
| 70 | 3300009176 | Ga0105242_10007562 | Ga0105242_100075622 | 123 |
| 71 | 3300009176 | Ga0105242_11224549 | Ga0105242_112245492 | 123 |
| 72 | 3300013100 | Ga0157373_10276398 | Ga0157373_102763981 | 123 |
| 73 | 3300014968 | Ga0157379_11408466 | Ga0157379_114084662 | 123 |
| 74 | 3300025927 | Ga0207687_10015188 | Ga0207687_100151882 | 123 |
| 75 | 3300025927 | Ga0207687_11664757 | Ga0207687_116647571 | 123 |
| 76 | 3300025934 | Ga0207686_10005025 | Ga0207686_100050252 | 123 |
| 77 | 3300025960 | Ga0207651_10826825 | Ga0207651_108268252 | 123 |
| 78 | 3300027866 | Ga0209813_10000009 | Ga0209813_1000000928 | 123 |
| 79 | 3300041491 | Ga0451833_0025125 | Ga0451833_0025125_157_534 | 123 |
| 80 | 3300049580 | Ga0501046_0174800 | Ga0501046_0174800_467_841 | 123 |
| 81 | 3300050490 | nmdc:mga03n38_19_c1 | nmdc:mga03n38_19_c1_4594_4971 | 123 |
| 82 | 3300050490 | nmdc:mga03n38_950823_c1 | nmdc:mga03n38_950823_c1_95_478 | 123 |
| 83 | 3300050494 | nmdc:mga06z11_14_c1 | nmdc:mga06z11_14_c1_36312_36689 | 123 |
| 84 | 3300050495 | nmdc:mga04h51_10_c1 | nmdc:mga04h51_10_c1_30609_30986 | 123 |
| 85 | 3300050496 | nmdc:mga07m45_18647_c1 | nmdc:mga07m45_18647_c1_2964_3341 | 123 |
| 86 | 3300050509 | nmdc:mga0qj67_13713_c1 | nmdc:mga0qj67_13713_c1_250_624 | 123 |
| 87 | 3300005327 | Ga0070658_10000015 | Ga0070658_1000001532 | 124 |
| 88 | 3300005339 | Ga0070660_100002817 | Ga0070660_10000281717 | 124 |
| 89 | 3300005530 | Ga0070679_100002994 | Ga0070679_10000299424 | 124 |
| 90 | 3300006042 | Ga0075368_10219676 | Ga0075368_102196762 | 124 |
| 91 | 3300006051 | Ga0075364_10764345 | Ga0075364_107643452 | 124 |
| 92 | 3300006178 | Ga0075367_10000146 | Ga0075367_1000014623 | 124 |
| 93 | 3300006195 | Ga0075366_10001116 | Ga0075366_100011166 | 124 |
| 94 | 3300009553 | Ga0105249_10921270 | Ga0105249_109212702 | 124 |
| 95 | 3300013105 | Ga0157369_10467584 | Ga0157369_104675842 | 124 |
| 96 | 3300013105 | Ga0157369_11792555 | Ga0157369_117925552 | 124 |
| 97 | 3300025909 | Ga0207705_10000011 | Ga0207705_10000011314 | 124 |
| 98 | 3300025909 | Ga0207705_10160104 | Ga0207705_101601042 | 124 |
| 99 | 3300025917 | Ga0207660_10421337 | Ga0207660_104213373 | 124 |
| 100 | 3300025919 | Ga0207657_10006928 | Ga0207657_1000692810 | 124 |
| 101 | 3300025921 | Ga0207652_10075557 | Ga0207652_100755572 | 124 |
| 102 | 3300025961 | Ga0207712_10456523 | Ga0207712_104565233 | 124 |
| 103 | 3300037418 | Ga0395900_0001412 | Ga0395900_0001412_19449_19829 | 124 |
| 104 | 3300037418 | Ga0395900_0963774 | Ga0395900_0963774_149_535 | 124 |
| 105 | 3300037471 | Ga0395905_0599614 | Ga0395905_0599614_399_779 | 124 |
| 106 | 3300037471 | Ga0395905_1540554 | Ga0395905_1540554_44_430 | 124 |
| 107 | 3300038443 | Ga0395901_0027323 | Ga0395901_0027323_990_1370 | 124 |
| 108 | 3300041463 | Ga0451804_0448241 | Ga0451804_0448241_247_633 | 124 |
| 109 | 3300049570 | Ga0501033_0230599 | Ga0501033_0230599_219_653 | 124 |
| 110 | 3300050491 | nmdc:mga00v17_568106_c1 | nmdc:mga00v17_568106_c1_100_474 | 124 |
| 111 | 3300050493 | nmdc:mga0k408_1480_c1 | nmdc:mga0k408_1480_c1_11313_11687 | 124 |
| 112 | 3300050494 | nmdc:mga06z11_193_c1 | nmdc:mga06z11_193_c1_232_606 | 124 |
| 113 | 3300050495 | nmdc:mga04h51_1402_c1 | nmdc:mga04h51_1402_c1_190_564 | 124 |
| 114 | 3300050515 | nmdc:mga0a205_1050397_c1 | nmdc:mga0a205_1050397_c1_77_469 | 124 |
| 115 | 3300053087 | Ga0500643_000010 | Ga0500643_000010_335875_336252 | 124 |
| 116 | 3300053087 | Ga0500643_092588 | Ga0500643_092588_148_534 | 124 |
| 117 | 3300053093 | Ga0500651_0000416 | Ga0500651_0000416_21441_21845 | 124 |
| 118 | 3300053093 | Ga0500651_0137106 | Ga0500651_0137106_19_423 | 124 |
| 119 | 3300053123 | Ga0500614_000512 | Ga0500614_000512_85_489 | 124 |
| 120 | 3300053139 | Ga0500568_0008745 | Ga0500568_0008745_601_978 | 124 |
| 121 | 3300053139 | Ga0500568_0011379 | Ga0500568_0011379_1703_2089 | 124 |
| 122 | 3300003320 | rootH2_10000244 | rootH2_10000244366 | 125 |
| 123 | 3300004799 | Ga0058863_11756211 | Ga0058863_117562111 | 125 |
| 124 | 3300005329 | Ga0070683_100143254 | Ga0070683_1001432544 | 125 |
| 125 | 3300005336 | Ga0070680_101664078 | Ga0070680_1016640781 | 125 |
| 126 | 3300005337 | Ga0070682_100732784 | Ga0070682_1007327842 | 125 |
| 127 | 3300005339 | Ga0070660_101658426 | Ga0070660_1016584261 | 125 |
| 128 | 3300005344 | Ga0070661_100198654 | Ga0070661_1001986543 | 125 |
| 129 | 3300005458 | Ga0070681_10489977 | Ga0070681_104899772 | 125 |
| 130 | 3300005530 | Ga0070679_100137212 | Ga0070679_1001372122 | 125 |
| 131 | 3300005530 | Ga0070679_100220587 | Ga0070679_1002205871 | 125 |
| 132 | 3300005530 | Ga0070679_100402896 | Ga0070679_1004028961 | 125 |
| 133 | 3300005530 | Ga0070679_100561398 | Ga0070679_1005613982 | 125 |
| 134 | 3300005530 | Ga0070679_100673507 | Ga0070679_1006735072 | 125 |
| 135 | 3300005535 | Ga0070684_100255142 | Ga0070684_1002551422 | 125 |
| 136 | 3300005535 | Ga0070684_100428671 | Ga0070684_1004286712 | 125 |
| 137 | 3300005547 | Ga0070693_100320550 | Ga0070693_1003205502 | 125 |
| 138 | 3300005563 | Ga0068855_100004673 | Ga0068855_10000467316 | 125 |
| 139 | 3300005563 | Ga0068855_100023229 | Ga0068855_1000232299 | 125 |
| 140 | 3300005563 | Ga0068855_100146933 | Ga0068855_1001469336 | 125 |
| 141 | 3300005563 | Ga0068855_100606424 | Ga0068855_1006064242 | 125 |
| 142 | 3300005577 | Ga0068857_100302687 | Ga0068857_1003026873 | 125 |
| 143 | 3300005578 | Ga0068854_100200292 | Ga0068854_1002002923 | 125 |
| 144 | 3300005614 | Ga0068856_100364764 | Ga0068856_1003647642 | 125 |
| 145 | 3300005614 | Ga0068856_100689310 | Ga0068856_1006893102 | 125 |
| 146 | 3300005616 | Ga0068852_100210707 | Ga0068852_1002107074 | 125 |
| 147 | 3300005842 | Ga0068858_100022783 | Ga0068858_1000227835 | 125 |
| 148 | 3300006051 | Ga0075364_10000255 | Ga0075364_1000025517 | 125 |
| 149 | 3300006051 | Ga0075364_10279818 | Ga0075364_102798183 | 125 |
| 150 | 3300006195 | Ga0075366_10681411 | Ga0075366_106814112 | 125 |
| 151 | 3300006237 | Ga0097621_100000264 | Ga0097621_10000026425 | 125 |
| 152 | 3300006358 | Ga0068871_100000039 | Ga0068871_10000003984 | 125 |
| 153 | 3300009093 | Ga0105240_10120762 | Ga0105240_101207624 | 125 |
| 154 | 3300009093 | Ga0105240_11166404 | Ga0105240_111664042 | 125 |
| 155 | 3300009098 | Ga0105245_10000002 | Ga0105245_10000002242 | 125 |
| 156 | 3300009098 | Ga0105245_10308298 | Ga0105245_103082982 | 125 |
| 157 | 3300009174 | Ga0105241_10188144 | Ga0105241_101881442 | 125 |
| 158 | 3300009174 | Ga0105241_10213598 | Ga0105241_102135983 | 125 |
| 159 | 3300009174 | Ga0105241_11643473 | Ga0105241_116434731 | 125 |
| 160 | 3300009551 | Ga0105238_10000579 | Ga0105238_1000057928 | 125 |
| 161 | 3300009551 | Ga0105238_10823816 | Ga0105238_108238162 | 125 |
| 162 | 3300009986 | Ga0105033_100289 | Ga0105033_1002893 | 125 |
| 163 | 3300009993 | Ga0105028_105991 | Ga0105028_1059912 | 125 |
| 164 | 3300013296 | Ga0157374_10000031 | Ga0157374_10000031129 | 125 |
| 165 | 3300013296 | Ga0157374_10007401 | Ga0157374_1000740114 | 125 |
| 166 | 3300014326 | Ga0157380_10344182 | Ga0157380_103441823 | 125 |
| 167 | 3300014968 | Ga0157379_12161551 | Ga0157379_121615512 | 125 |
| 168 | 3300025909 | Ga0207705_10083261 | Ga0207705_100832613 | 125 |
| 169 | 3300025911 | Ga0207654_10202435 | Ga0207654_102024352 | 125 |
| 170 | 3300025911 | Ga0207654_10206024 | Ga0207654_102060242 | 125 |
| 171 | 3300025912 | Ga0207707_10279802 | Ga0207707_102798022 | 125 |
| 172 | 3300025913 | Ga0207695_10802017 | Ga0207695_108020172 | 125 |
| 173 | 3300025914 | Ga0207671_10431677 | Ga0207671_104316772 | 125 |
| 174 | 3300025917 | Ga0207660_11223008 | Ga0207660_112230081 | 125 |
| 175 | 3300025917 | Ga0207660_11512461 | Ga0207660_115124611 | 125 |
| 176 | 3300025920 | Ga0207649_10771153 | Ga0207649_107711532 | 125 |
| 177 | 3300025921 | Ga0207652_10310938 | Ga0207652_103109382 | 125 |
| 178 | 3300025921 | Ga0207652_10595896 | Ga0207652_105958962 | 125 |
| 179 | 3300025921 | Ga0207652_10879229 | Ga0207652_108792291 | 125 |
| 180 | 3300025921 | Ga0207652_10961222 | Ga0207652_109612222 | 125 |
| 181 | 3300025921 | Ga0207652_11418331 | Ga0207652_114183312 | 125 |
| 182 | 3300025921 | Ga0207652_11730276 | Ga0207652_117302761 | 125 |
| 183 | 3300025924 | Ga0207694_10000232 | Ga0207694_1000023237 | 125 |
| 184 | 3300025927 | Ga0207687_10000001 | Ga0207687_10000001969 | 125 |
| 185 | 3300025927 | Ga0207687_10000030 | Ga0207687_10000030100 | 125 |
| 186 | 3300025927 | Ga0207687_10190578 | Ga0207687_101905783 | 125 |
| 187 | 3300025927 | Ga0207687_10220400 | Ga0207687_102204003 | 125 |
| 188 | 3300025929 | Ga0207664_10003229 | Ga0207664_1000322914 | 125 |
| 189 | 3300025929 | Ga0207664_11247870 | Ga0207664_112478702 | 125 |
| 190 | 3300025932 | Ga0207690_10361785 | Ga0207690_103617852 | 125 |
| 191 | 3300025944 | Ga0207661_10262103 | Ga0207661_102621032 | 125 |
| 192 | 3300025944 | Ga0207661_11460679 | Ga0207661_114606792 | 125 |
| 193 | 3300025949 | Ga0207667_10000299 | Ga0207667_1000029918 | 125 |
| 194 | 3300025949 | Ga0207667_10031938 | Ga0207667_100319384 | 125 |
| 195 | 3300025949 | Ga0207667_10050173 | Ga0207667_100501739 | 125 |
| 196 | 3300025949 | Ga0207667_10138733 | Ga0207667_101387335 | 125 |
| 197 | 3300025981 | Ga0207640_10257897 | Ga0207640_102578972 | 125 |
| 198 | 3300026035 | Ga0207703_10076947 | Ga0207703_100769475 | 125 |
| 199 | 3300026041 | Ga0207639_10001800 | Ga0207639_1000180019 | 125 |
| 200 | 3300026116 | Ga0207674_10012488 | Ga0207674_1001248810 | 125 |
| 201 | 3300028558 | Ga0265326_10017045 | Ga0265326_100170454 | 125 |
| 202 | 3300028563 | Ga0265319_1181332 | Ga0265319_11813322 | 125 |
| 203 | 3300028654 | Ga0265322_10078246 | Ga0265322_100782462 | 125 |
| 204 | 3300028800 | Ga0265338_10028695 | Ga0265338_100286953 | 125 |
| 205 | 3300028800 | Ga0265338_10304951 | Ga0265338_103049512 | 125 |
| 206 | 3300028800 | Ga0265338_10356938 | Ga0265338_103569382 | 125 |
| 207 | 3300029957 | Ga0265324_10015771 | Ga0265324_100157713 | 125 |
| 208 | 3300031249 | Ga0265339_10129328 | Ga0265339_101293282 | 125 |
| 209 | 3300031251 | Ga0265327_10000017 | Ga0265327_10000017167 | 125 |
| 210 | 3300031251 | Ga0265327_10010524 | Ga0265327_1001052411 | 125 |
| 211 | 3300031251 | Ga0265327_10031602 | Ga0265327_100316027 | 125 |
| 212 | 3300031251 | Ga0265327_10306583 | Ga0265327_103065832 | 125 |
| 213 | 3300031344 | Ga0265316_10050606 | Ga0265316_100506066 | 125 |
| 214 | 3300031344 | Ga0265316_10451107 | Ga0265316_104511072 | 125 |
| 215 | 3300037312 | Ga0395899_0009875 | Ga0395899_0009875_1442_1834 | 125 |
| 216 | 3300037418 | Ga0395900_0012262 | Ga0395900_0012262_2889_3281 | 125 |
| 217 | 3300037418 | Ga0395900_0245759 | Ga0395900_0245759_669_1046 | 125 |
| 218 | 3300037466 | Ga0395898_0002536 | Ga0395898_0002536_8051_8443 | 125 |
| 219 | 3300037471 | Ga0395905_0008237 | Ga0395905_0008237_5385_5777 | 125 |
| 220 | 3300038443 | Ga0395901_0021849 | Ga0395901_0021849_3630_4022 | 125 |
| 221 | 3300044694 | Ga0466963_0795473 | Ga0466963_0795473_167_553 | 125 |
| 222 | 3300045976 | Ga0466967_0327555 | Ga0466967_0327555_40_426 | 125 |
| 223 | 3300049586 | Ga0501070_0191453 | Ga0501070_0191453_1069_1461 | 125 |
| 224 | 3300049742 | Ga0501080_0001402 | Ga0501080_0001402_3840_4229 | 125 |
| 225 | 3300050491 | nmdc:mga00v17_1627_c1 | nmdc:mga00v17_1627_c1_2261_2647 | 125 |
| 226 | 3300050493 | nmdc:mga0k408_328574_c1 | nmdc:mga0k408_328574_c1_215_601 | 125 |
| 227 | 3300050516 | nmdc:mga0sz30_447801_c1 | nmdc:mga0sz30_447801_c1_138_521 | 125 |
| 228 | 3300053079 | Ga0500610_0000001 | Ga0500610_0000001_54794_55183 | 125 |
| 229 | 3300053087 | Ga0500643_022206 | Ga0500643_022206_923_1312 | 125 |
| 230 | 3300053088 | Ga0500644_0000365 | Ga0500644_0000365_10711_11100 | 125 |
| 231 | 3300053103 | Ga0500555_000002 | Ga0500555_000002_470105_470494 | 125 |
| 232 | 3300053108 | Ga0500562_000002 | Ga0500562_000002_938537_938914 | 125 |
| 233 | 3300053108 | Ga0500562_020713 | Ga0500562_020713_789_1178 | 125 |
| 234 | 3300053131 | Ga0500652_000084 | Ga0500652_000084_22025_22414 | 125 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c93-assembly1.cif.gz_S | cryo-em captures early ribosome assembly in action | 0.9518 | 1 | 110 |
| 8c8z-assembly1.cif.gz_S | cryo-em captures early ribosome assembly in action | 0.9486 | 1 | 110 |
| 8c93-assembly1.cif.gz_S | cryo-em captures early ribosome assembly in action | 0.9425 | 1 | 110 |
| 8c96-assembly1.cif.gz_S | cryo-em captures early ribosome assembly in action | 0.9421 | 1 | 108 |
| 6pvk-assembly1.cif.gz_S | bacterial 45srbga ribosomal particle class a | 0.9409 | 3 | 110 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P56795_7_145_3.90.470.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.9172 | 2 | 109 | 3.90.470.10 |
| af_Q54J88_309_423_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.9123 | 29 | 57 | 1.25.10.10 |
| af_Q4DYB8_108_251_3.90.470.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.9107 | 2 | 110 | 3.90.470.10 |
| 4g5uS00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.9104 | 1 | 110 | 3.90.470.10 |
| 5mmiT00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.9013 | 2 | 110 | 3.90.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J6I173-F1-model_v4 | Large ribosomal subunit protein uL22c (50S ribosomal protein L22, chloroplastic) | 0.9619 | 2 | 109 |
GO:0003735
GO:0006412 GO:0009536 GO:0015934 GO:0015935 GO:0016740 GO:0019843 |
| AF-A0A251THC5-F1-model_v4 | Large ribosomal subunit protein uL22c (Small ribosomal subunit protein uS3c) | 0.9385 | 2 | 109 |
GO:0003735
GO:0006412 GO:0015934 GO:0019843 GO:0022627 |
| AF-A0A6A5L0W0-F1-model_v4 | deleted | 0.9213 | 2 | 109 |
|
| AF-A8W3M1-F1-model_v4 | Large ribosomal subunit protein uL22c (50S ribosomal protein L22, plastid) | 0.9206 | 1 | 109 |
GO:0003735
GO:0006412 GO:0009536 GO:0015934 GO:0019843 |
| AF-A0A411L2I7-F1-model_v4 | Large ribosomal subunit protein uL22c | 0.9198 | 2 | 109 |
GO:0003735
GO:0006412 GO:0009507 GO:0015934 GO:0019843 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar