F346907

General Info

Members Datasets Scaffolds Average Seq Length
234 140 234 127

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100146933|Ga0068855_1001469336
Length 147
Sequence MPVQAIAKGVRISPRKVAVVAALVRGRTVEDALTILEHTPRSSAIAVRKVIESARANADHNHGFKPASLQIVEITVTHGPRTKRYRPAAHGRALPFQRRSSHIRVVVDGEKRPAAAKAMADQEVKKPVSAKATTGRPASDNKEKEEK

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
41 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
76 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
77 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
78 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
90 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
94 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
95 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
114 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
117 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
118 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
119 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
120 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
121 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
122 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
123 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
124 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
125 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
126 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
127 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
128 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
129 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
130 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
131 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
132 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
133 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
134 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
135 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
136 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
137 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
138 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
139 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.09
Nodule 0
Rhizoplane 1.71
Rhizosphere 77.35
Stem 0
Stem Tuber 0
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10000244 3300003320 Bacteria 697651
2 Ga0058863_11756211 3300004799 Bacteria 2363
3 Ga0070658_10000015 3300005327 Bacteria 230579
4 Ga0070658_10331712 3300005327 Bacteria 1300
5 Ga0070683_100143254 3300005329 Bacteria 2264
6 Ga0070680_101664078 3300005336 Unclassified 553
7 Ga0070682_100532263 3300005337 Bacteria 916
8 Ga0070682_100732784 3300005337 Bacteria 796
9 Ga0070660_100002817 3300005339 Bacteria 11964
10 Ga0070660_101658426 3300005339 Bacteria 544
11 Ga0070661_100198654 3300005344 Unclassified 1531
12 Ga0070674_100014629 3300005356 Bacteria 4881
13 Ga0070688_100237926 3300005365 Bacteria 1291
14 Ga0070659_100195902 3300005366 Bacteria 1662
15 Ga0070681_10002189 3300005458 Bacteria 17788
16 Ga0070681_10198609 3300005458 Bacteria 1924
17 Ga0070681_10489977 3300005458 Bacteria 1142
18 Ga0070685_10002659 3300005466 Bacteria 9153
19 Ga0070679_100002994 3300005530 Bacteria 15427
20 Ga0070679_100025007 3300005530 Bacteria 5855
21 Ga0070679_100137212 3300005530 Bacteria 2427
22 Ga0070679_100220587 3300005530 Archaea 1857
23 Ga0070679_100402896 3300005530 Bacteria 1314
24 Ga0070679_100561398 3300005530 Bacteria 1085
25 Ga0070679_100673507 3300005530 Bacteria 977
26 Ga0070684_100255142 3300005535 Bacteria 1603
27 Ga0070684_100428671 3300005535 Bacteria 1221
28 Ga0070693_100320550 3300005547 Unclassified 1051
29 Ga0070665_101492643 3300005548 Bacteria 684
30 Ga0068855_100004673 3300005563 Bacteria 16726
31 Ga0068855_100023229 3300005563 Bacteria 7428
32 Ga0068855_100146933 3300005563 Bacteria 2683
33 Ga0068855_100606424 3300005563 Bacteria 1180
34 Ga0068857_100302687 3300005577 Bacteria 1474
35 Ga0068854_100200292 3300005578 Unclassified 1569
36 Ga0068856_100022566 3300005614 Bacteria 6119
37 Ga0068856_100364764 3300005614 Unclassified 1463
38 Ga0068856_100689310 3300005614 Bacteria 1042
39 Ga0068856_101102455 3300005614 Bacteria 811
40 Ga0068852_100210707 3300005616 Bacteria 1843
41 Ga0068858_100022783 3300005842 Bacteria 5841
42 Ga0075368_10000103 3300006042 Bacteria 21865
43 Ga0075368_10219676 3300006042 Bacteria 807
44 Ga0075363_100000006 3300006048 Bacteria 47292
45 Ga0075363_101033275 3300006048 Bacteria 507
46 Ga0075364_10000255 3300006051 Bacteria 25673
47 Ga0075364_10279818 3300006051 Bacteria 1135
48 Ga0075364_10764345 3300006051 Bacteria 659
49 Ga0075367_10000021 3300006178 Bacteria 33969
50 Ga0075367_10000146 3300006178 Bacteria 21661
51 Ga0075366_10001116 3300006195 Bacteria 13216
52 Ga0075366_10681411 3300006195 Bacteria 638
53 Ga0097621_100000264 3300006237 Bacteria 35498
54 Ga0075370_10015049 3300006353 Bacteria 4135
55 Ga0068871_100000039 3300006358 Bacteria 69204
56 Ga0075428_100003149 3300006844 Bacteria 18020
57 Ga0075430_100014603 3300006846 Bacteria 6690
58 Ga0105240_10120762 3300009093 Bacteria 3155
59 Ga0105240_11166404 3300009093 Bacteria 817
60 Ga0105245_10000002 3300009098 Bacteria 634374
61 Ga0105245_10004821 3300009098 Bacteria 11893
62 Ga0105245_10308298 3300009098 Bacteria 1556
63 Ga0105241_10188144 3300009174 Bacteria 1717
64 Ga0105241_10213598 3300009174 Bacteria 1617
65 Ga0105241_11643473 3300009174 Bacteria 623
66 Ga0105242_10007562 3300009176 Bacteria 8364
67 Ga0105242_11224549 3300009176 Bacteria 771
68 Ga0105238_10000579 3300009551 Bacteria 38459
69 Ga0105238_10823816 3300009551 Bacteria 944
70 Ga0105249_10921270 3300009553 Bacteria 941
71 Ga0105033_100289 3300009986 Bacteria 3966
72 Ga0105028_105991 3300009993 Bacteria 1266
73 Ga0105239_10032725 3300010375 Bacteria 5713
74 Ga0157373_10276398 3300013100 Bacteria 1190
75 Ga0157369_10467584 3300013105 Bacteria 1306
76 Ga0157369_11792555 3300013105 Bacteria 623
77 Ga0157374_10000031 3300013296 Bacteria 204840
78 Ga0157374_10007401 3300013296 Bacteria 9365
79 Ga0157380_10344182 3300014326 Bacteria 1392
80 Ga0157379_11408466 3300014968 Unclassified 676
81 Ga0157379_12161551 3300014968 Unclassified 552
82 Ga0207705_10000011 3300025909 Bacteria 517768
83 Ga0207705_10083261 3300025909 Bacteria 2334
84 Ga0207705_10160104 3300025909 Unclassified 1691
85 Ga0207654_10202435 3300025911 Bacteria 1308
86 Ga0207654_10206024 3300025911 Bacteria 1297
87 Ga0207707_10279802 3300025912 Bacteria 1445
88 Ga0207707_10297187 3300025912 Bacteria 1397
89 Ga0207695_10802017 3300025913 Bacteria 822
90 Ga0207671_10431677 3300025914 Bacteria 1048
91 Ga0207660_10421337 3300025917 Bacteria 1077
92 Ga0207660_11223008 3300025917 Bacteria 611
93 Ga0207660_11512461 3300025917 Unclassified 542
94 Ga0207657_10006928 3300025919 Bacteria 11684
95 Ga0207649_10771153 3300025920 Bacteria 749
96 Ga0207652_10007005 3300025921 Bacteria 9087
97 Ga0207652_10075557 3300025921 Bacteria 2937
98 Ga0207652_10310938 3300025921 Bacteria 1422
99 Ga0207652_10595896 3300025921 Bacteria 991
100 Ga0207652_10879229 3300025921 Bacteria 792
101 Ga0207652_10961222 3300025921 Unclassified 752
102 Ga0207652_11418331 3300025921 Bacteria 598
103 Ga0207652_11730276 3300025921 Unclassified 530
104 Ga0207694_10000232 3300025924 Bacteria 53672
105 Ga0207687_10000001 3300025927 Bacteria 1130810
106 Ga0207687_10000030 3300025927 Bacteria 155548
107 Ga0207687_10015188 3300025927 Bacteria 5046
108 Ga0207687_10190578 3300025927 Bacteria 1595
109 Ga0207687_10220400 3300025927 Bacteria 1493
110 Ga0207687_11664757 3300025927 Bacteria 547
111 Ga0207664_10003229 3300025929 Bacteria 10836
112 Ga0207664_11247870 3300025929 Bacteria 662
113 Ga0207690_10361785 3300025932 Bacteria 1150
114 Ga0207690_10513227 3300025932 Bacteria 971
115 Ga0207686_10005025 3300025934 Bacteria 7120
116 Ga0207669_10017111 3300025937 Bacteria 3708
117 Ga0207661_10262103 3300025944 Bacteria 1540
118 Ga0207661_11460679 3300025944 Bacteria 627
119 Ga0207667_10000299 3300025949 Bacteria 68595
120 Ga0207667_10031938 3300025949 Bacteria 5679
121 Ga0207667_10050173 3300025949 Bacteria 4404
122 Ga0207667_10138733 3300025949 Bacteria 2503
123 Ga0207651_10826825 3300025960 Bacteria 822
124 Ga0207712_10456523 3300025961 Bacteria 1084
125 Ga0207640_10257897 3300025981 Bacteria 1357
126 Ga0207703_10076947 3300026035 Bacteria 2769
127 Ga0207639_10001800 3300026041 Bacteria 14423
128 Ga0207702_10034254 3300026078 Bacteria 4245
129 Ga0207641_10036604 3300026088 Bacteria 4097
130 Ga0207674_10012488 3300026116 Bacteria 9490
131 Ga0209813_10000009 3300027866 Bacteria 102315
132 Ga0268266_10003734 3300028379 Bacteria 14969
133 Ga0265326_10017045 3300028558 Bacteria 2098
134 Ga0265319_1181332 3300028563 Bacteria 649
135 Ga0265334_10051233 3300028573 Bacteria 1583
136 Ga0265322_10078246 3300028654 Bacteria 938
137 Ga0265338_10028695 3300028800 Bacteria 5543
138 Ga0265338_10260487 3300028800 Bacteria 1275
139 Ga0265338_10304951 3300028800 Bacteria 1156
140 Ga0265338_10356938 3300028800 Bacteria 1049
141 Ga0265324_10015771 3300029957 Bacteria 2773
142 Ga0265339_10129328 3300031249 Bacteria 1293
143 Ga0265327_10000017 3300031251 Bacteria 445264
144 Ga0265327_10005878 3300031251 Bacteria 10026
145 Ga0265327_10010524 3300031251 Bacteria 6491
146 Ga0265327_10031602 3300031251 Bacteria 2972
147 Ga0265327_10306583 3300031251 Bacteria 698
148 Ga0265316_10050606 3300031344 Bacteria 3266
149 Ga0265316_10451107 3300031344 Bacteria 922
150 Ga0395899_0009875 3300037312 Bacteria 7318
151 Ga0395900_0001412 3300037418 Bacteria 28734
152 Ga0395900_0012262 3300037418 Bacteria 8765
153 Ga0395900_0245759 3300037418 Bacteria 1793
154 Ga0395900_0963774 3300037418 Bacteria 774
155 Ga0395898_0002536 3300037466 Bacteria 21416
156 Ga0395905_0008237 3300037471 Bacteria 10294
157 Ga0395905_0090915 3300037471 Bacteria 2862
158 Ga0395905_0599614 3300037471 Bacteria 1003
159 Ga0395905_1540554 3300037471 Bacteria 569
160 Ga0395901_0021849 3300038443 Bacteria 6557
161 Ga0395901_0027323 3300038443 Bacteria 5862
162 Ga0395901_0049827 3300038443 Bacteria 4352
163 Ga0451804_0448241 3300041463 Bacteria 808
164 Ga0451833_0025125 3300041491 Bacteria 685
165 Ga0466963_0795473 3300044694 Unclassified 667
166 Ga0466967_0327555 3300045976 Bacteria 1479
167 Ga0496100_0036246 3300048903 Bacteria 3109
168 Ga0496101_0974895 3300048904 Bacteria 667
169 Ga0496112_0002149 3300048915 Bacteria 15656
170 Ga0501031_0004386 3300049568 Bacteria 9142
171 Ga0501032_0009702 3300049569 Bacteria 6971
172 Ga0501033_0230599 3300049570 Bacteria 1316
173 Ga0501034_0020539 3300049571 Bacteria 6745
174 Ga0501034_0028473 3300049571 Bacteria 5686
175 Ga0501036_0029140 3300049572 Bacteria 4666
176 Ga0501036_0287630 3300049572 Bacteria 1375
177 Ga0501037_0000133 3300049573 Bacteria 69741
178 Ga0501038_0213009 3300049574 Bacteria 1545
179 Ga0501040_0183932 3300049576 Bacteria 1482
180 Ga0501042_0054606 3300049578 Bacteria 2850
181 Ga0501043_0000404 3300049579 Bacteria 38801
182 Ga0501046_0000038 3300049580 Bacteria 159193
183 Ga0501046_0174800 3300049580 Unclassified 1609
184 Ga0501047_0000229 3300049581 Bacteria 66412
185 Ga0501047_0006066 3300049581 Bacteria 11360
186 Ga0501048_0000033 3300049582 Bacteria 64896
187 Ga0501048_0106238 3300049582 Bacteria 1981
188 Ga0501069_0275799 3300049585 Bacteria 983
189 Ga0501070_0191453 3300049586 Bacteria 1681
190 Ga0501070_0251922 3300049586 Bacteria 1444
191 Ga0501070_0738750 3300049586 Bacteria 776
192 Ga0501074_0976956 3300049590 Bacteria 595
193 Ga0501080_0001402 3300049742 Bacteria 20194
194 Ga0501083_0026580 3300049744 Bacteria 4000
195 Ga0501035_0000033 3300049822 Bacteria 175087
196 Ga0501035_0000562 3300049822 Bacteria 41104
197 Ga0501044_0028311 3300049823 Bacteria 5914
198 nmdc:mga03n38_19_c1 3300050490 Bacteria 41192
199 nmdc:mga03n38_950823_c1 3300050490 Bacteria 507
200 nmdc:mga00v17_1627_c1 3300050491 Bacteria 11750
201 nmdc:mga00v17_568106_c1 3300050491 Bacteria 733
202 nmdc:mga0k408_1480_c1 3300050493 Bacteria 12680
203 nmdc:mga0k408_328574_c1 3300050493 Bacteria 912
204 nmdc:mga06z11_14_c1 3300050494 Bacteria 96662
205 nmdc:mga06z11_193_c1 3300050494 Bacteria 21686
206 nmdc:mga04h51_10_c1 3300050495 Bacteria 102434
207 nmdc:mga04h51_1402_c1 3300050495 Bacteria 5569
208 nmdc:mga07m45_18647_c1 3300050496 Bacteria 3751
209 nmdc:mga0qj67_13713_c1 3300050509 Bacteria 6116
210 nmdc:mga0a205_1050397_c1 3300050515 Bacteria 662
211 nmdc:mga0sz30_447801_c1 3300050516 Unclassified 579
212 Ga0500610_0000001 3300053079 Bacteria 185468
213 Ga0500610_0049137 3300053079 Bacteria 2194
214 Ga0500643_000010 3300053087 Bacteria 408084
215 Ga0500643_022206 3300053087 Bacteria 2046
216 Ga0500643_092588 3300053087 Bacteria 824
217 Ga0500644_0000365 3300053088 Bacteria 22175
218 Ga0500644_0024522 3300053088 Bacteria 1845
219 Ga0500583_0030631 3300053092 Bacteria 2358
220 Ga0500651_0000416 3300053093 Bacteria 22899
221 Ga0500651_0137106 3300053093 Bacteria 1477
222 Ga0500650_0000001 3300053098 Bacteria 818797
223 Ga0500555_000002 3300053103 Bacteria 1314346
224 Ga0500562_000002 3300053108 Bacteria 977234
225 Ga0500562_020713 3300053108 Bacteria 1708
226 Ga0500594_0000001 3300053118 Bacteria 1178472
227 Ga0500614_000512 3300053123 Bacteria 10049
228 Ga0500652_000084 3300053131 Bacteria 39562
229 Ga0500655_032946 3300053133 Bacteria 1001
230 Ga0500568_0008745 3300053139 Bacteria 4856
231 Ga0500568_0011379 3300053139 Bacteria 4135
232 Ga0500579_021018 3300053143 Bacteria 4233
233 Ga0500570_000045 3300053724 Bacteria 31120
234 Ga0501082_0245057 3300060353 Bacteria 1560

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028573 Ga0265334_10051233 Ga0265334_100512332 114
2 3300031251 Ga0265327_10005878 Ga0265327_1000587813 114
3 3300053724 Ga0500570_000045 Ga0500570_000045_22258_22617 114
4 3300005458 Ga0070681_10002189 Ga0070681_1000218918 118
5 3300049586 Ga0501070_0251922 Ga0501070_0251922_924_1334 118
6 3300005356 Ga0070674_100014629 Ga0070674_10001462910 119
7 3300005365 Ga0070688_100237926 Ga0070688_1002379262 119
8 3300005466 Ga0070685_10002659 Ga0070685_1000265910 119
9 3300005548 Ga0070665_101492643 Ga0070665_1014926432 119
10 3300025937 Ga0207669_10017111 Ga0207669_100171117 119
11 3300028379 Ga0268266_10003734 Ga0268266_100037343 119
12 3300049568 Ga0501031_0004386 Ga0501031_0004386_3909_4319 119
13 3300049569 Ga0501032_0009702 Ga0501032_0009702_5476_5886 119
14 3300049571 Ga0501034_0020539 Ga0501034_0020539_5187_5597 119
15 3300049572 Ga0501036_0029140 Ga0501036_0029140_1758_2168 119
16 3300049573 Ga0501037_0000133 Ga0501037_0000133_32915_33325 119
17 3300049574 Ga0501038_0213009 Ga0501038_0213009_1022_1432 119
18 3300049576 Ga0501040_0183932 Ga0501040_0183932_939_1349 119
19 3300049578 Ga0501042_0054606 Ga0501042_0054606_1772_2182 119
20 3300049579 Ga0501043_0000404 Ga0501043_0000404_32084_32494 119
21 3300049580 Ga0501046_0000038 Ga0501046_0000038_116864_117274 119
22 3300049581 Ga0501047_0006066 Ga0501047_0006066_8843_9253 119
23 3300049582 Ga0501048_0000033 Ga0501048_0000033_47289_47699 119
24 3300049585 Ga0501069_0275799 Ga0501069_0275799_128_538 119
25 3300049590 Ga0501074_0976956 Ga0501074_0976956_13_423 119
26 3300049744 Ga0501083_0026580 Ga0501083_0026580_3488_3898 119
27 3300049822 Ga0501035_0000562 Ga0501035_0000562_36014_36424 119
28 3300049823 Ga0501044_0028311 Ga0501044_0028311_44_454 119
29 3300060353 Ga0501082_0245057 Ga0501082_0245057_966_1376 119
30 3300005366 Ga0070659_100195902 Ga0070659_1001959022 120
31 3300005458 Ga0070681_10198609 Ga0070681_101986093 120
32 3300005530 Ga0070679_100025007 Ga0070679_1000250073 120
33 3300005614 Ga0068856_100022566 Ga0068856_1000225666 120
34 3300025932 Ga0207690_10513227 Ga0207690_105132272 120
35 3300026078 Ga0207702_10034254 Ga0207702_100342546 120
36 3300026088 Ga0207641_10036604 Ga0207641_100366042 120
37 3300048915 Ga0496112_0002149 Ga0496112_0002149_11479_11871 120
38 3300010375 Ga0105239_10032725 Ga0105239_100327252 121
39 3300025912 Ga0207707_10297187 Ga0207707_102971872 121
40 3300025921 Ga0207652_10007005 Ga0207652_1000700516 121
41 3300038443 Ga0395901_0049827 Ga0395901_0049827_1308_1700 121
42 3300048903 Ga0496100_0036246 Ga0496100_0036246_1931_2323 121
43 3300048904 Ga0496101_0974895 Ga0496101_0974895_163_555 121
44 3300053079 Ga0500610_0049137 Ga0500610_0049137_362_763 121
45 3300053088 Ga0500644_0024522 Ga0500644_0024522_1318_1719 121
46 3300053092 Ga0500583_0030631 Ga0500583_0030631_391_792 121
47 3300053098 Ga0500650_0000001 Ga0500650_0000001_518452_518853 121
48 3300053118 Ga0500594_0000001 Ga0500594_0000001_2567_2968 121
49 3300053133 Ga0500655_032946 Ga0500655_032946_380_781 121
50 3300053143 Ga0500579_021018 Ga0500579_021018_3497_3898 121
51 3300005337 Ga0070682_100532263 Ga0070682_1005322632 122
52 3300028800 Ga0265338_10260487 Ga0265338_102604873 122
53 3300037471 Ga0395905_0090915 Ga0395905_0090915_2167_2559 122
54 3300049571 Ga0501034_0028473 Ga0501034_0028473_3768_4199 122
55 3300049572 Ga0501036_0287630 Ga0501036_0287630_313_744 122
56 3300049581 Ga0501047_0000229 Ga0501047_0000229_62820_63251 122
57 3300049582 Ga0501048_0106238 Ga0501048_0106238_64_495 122
58 3300049586 Ga0501070_0738750 Ga0501070_0738750_102_533 122
59 3300049822 Ga0501035_0000033 Ga0501035_0000033_160864_161295 122
60 3300005327 Ga0070658_10331712 Ga0070658_103317123 123
61 3300005614 Ga0068856_101102455 Ga0068856_1011024551 123
62 3300006042 Ga0075368_10000103 Ga0075368_1000010316 123
63 3300006048 Ga0075363_100000006 Ga0075363_10000000613 123
64 3300006048 Ga0075363_101033275 Ga0075363_1010332751 123
65 3300006178 Ga0075367_10000021 Ga0075367_1000002147 123
66 3300006353 Ga0075370_10015049 Ga0075370_100150497 123
67 3300006844 Ga0075428_100003149 Ga0075428_10000314914 123
68 3300006846 Ga0075430_100014603 Ga0075430_1000146034 123
69 3300009098 Ga0105245_10004821 Ga0105245_1000482112 123
70 3300009176 Ga0105242_10007562 Ga0105242_100075622 123
71 3300009176 Ga0105242_11224549 Ga0105242_112245492 123
72 3300013100 Ga0157373_10276398 Ga0157373_102763981 123
73 3300014968 Ga0157379_11408466 Ga0157379_114084662 123
74 3300025927 Ga0207687_10015188 Ga0207687_100151882 123
75 3300025927 Ga0207687_11664757 Ga0207687_116647571 123
76 3300025934 Ga0207686_10005025 Ga0207686_100050252 123
77 3300025960 Ga0207651_10826825 Ga0207651_108268252 123
78 3300027866 Ga0209813_10000009 Ga0209813_1000000928 123
79 3300041491 Ga0451833_0025125 Ga0451833_0025125_157_534 123
80 3300049580 Ga0501046_0174800 Ga0501046_0174800_467_841 123
81 3300050490 nmdc:mga03n38_19_c1 nmdc:mga03n38_19_c1_4594_4971 123
82 3300050490 nmdc:mga03n38_950823_c1 nmdc:mga03n38_950823_c1_95_478 123
83 3300050494 nmdc:mga06z11_14_c1 nmdc:mga06z11_14_c1_36312_36689 123
84 3300050495 nmdc:mga04h51_10_c1 nmdc:mga04h51_10_c1_30609_30986 123
85 3300050496 nmdc:mga07m45_18647_c1 nmdc:mga07m45_18647_c1_2964_3341 123
86 3300050509 nmdc:mga0qj67_13713_c1 nmdc:mga0qj67_13713_c1_250_624 123
87 3300005327 Ga0070658_10000015 Ga0070658_1000001532 124
88 3300005339 Ga0070660_100002817 Ga0070660_10000281717 124
89 3300005530 Ga0070679_100002994 Ga0070679_10000299424 124
90 3300006042 Ga0075368_10219676 Ga0075368_102196762 124
91 3300006051 Ga0075364_10764345 Ga0075364_107643452 124
92 3300006178 Ga0075367_10000146 Ga0075367_1000014623 124
93 3300006195 Ga0075366_10001116 Ga0075366_100011166 124
94 3300009553 Ga0105249_10921270 Ga0105249_109212702 124
95 3300013105 Ga0157369_10467584 Ga0157369_104675842 124
96 3300013105 Ga0157369_11792555 Ga0157369_117925552 124
97 3300025909 Ga0207705_10000011 Ga0207705_10000011314 124
98 3300025909 Ga0207705_10160104 Ga0207705_101601042 124
99 3300025917 Ga0207660_10421337 Ga0207660_104213373 124
100 3300025919 Ga0207657_10006928 Ga0207657_1000692810 124
101 3300025921 Ga0207652_10075557 Ga0207652_100755572 124
102 3300025961 Ga0207712_10456523 Ga0207712_104565233 124
103 3300037418 Ga0395900_0001412 Ga0395900_0001412_19449_19829 124
104 3300037418 Ga0395900_0963774 Ga0395900_0963774_149_535 124
105 3300037471 Ga0395905_0599614 Ga0395905_0599614_399_779 124
106 3300037471 Ga0395905_1540554 Ga0395905_1540554_44_430 124
107 3300038443 Ga0395901_0027323 Ga0395901_0027323_990_1370 124
108 3300041463 Ga0451804_0448241 Ga0451804_0448241_247_633 124
109 3300049570 Ga0501033_0230599 Ga0501033_0230599_219_653 124
110 3300050491 nmdc:mga00v17_568106_c1 nmdc:mga00v17_568106_c1_100_474 124
111 3300050493 nmdc:mga0k408_1480_c1 nmdc:mga0k408_1480_c1_11313_11687 124
112 3300050494 nmdc:mga06z11_193_c1 nmdc:mga06z11_193_c1_232_606 124
113 3300050495 nmdc:mga04h51_1402_c1 nmdc:mga04h51_1402_c1_190_564 124
114 3300050515 nmdc:mga0a205_1050397_c1 nmdc:mga0a205_1050397_c1_77_469 124
115 3300053087 Ga0500643_000010 Ga0500643_000010_335875_336252 124
116 3300053087 Ga0500643_092588 Ga0500643_092588_148_534 124
117 3300053093 Ga0500651_0000416 Ga0500651_0000416_21441_21845 124
118 3300053093 Ga0500651_0137106 Ga0500651_0137106_19_423 124
119 3300053123 Ga0500614_000512 Ga0500614_000512_85_489 124
120 3300053139 Ga0500568_0008745 Ga0500568_0008745_601_978 124
121 3300053139 Ga0500568_0011379 Ga0500568_0011379_1703_2089 124
122 3300003320 rootH2_10000244 rootH2_10000244366 125
123 3300004799 Ga0058863_11756211 Ga0058863_117562111 125
124 3300005329 Ga0070683_100143254 Ga0070683_1001432544 125
125 3300005336 Ga0070680_101664078 Ga0070680_1016640781 125
126 3300005337 Ga0070682_100732784 Ga0070682_1007327842 125
127 3300005339 Ga0070660_101658426 Ga0070660_1016584261 125
128 3300005344 Ga0070661_100198654 Ga0070661_1001986543 125
129 3300005458 Ga0070681_10489977 Ga0070681_104899772 125
130 3300005530 Ga0070679_100137212 Ga0070679_1001372122 125
131 3300005530 Ga0070679_100220587 Ga0070679_1002205871 125
132 3300005530 Ga0070679_100402896 Ga0070679_1004028961 125
133 3300005530 Ga0070679_100561398 Ga0070679_1005613982 125
134 3300005530 Ga0070679_100673507 Ga0070679_1006735072 125
135 3300005535 Ga0070684_100255142 Ga0070684_1002551422 125
136 3300005535 Ga0070684_100428671 Ga0070684_1004286712 125
137 3300005547 Ga0070693_100320550 Ga0070693_1003205502 125
138 3300005563 Ga0068855_100004673 Ga0068855_10000467316 125
139 3300005563 Ga0068855_100023229 Ga0068855_1000232299 125
140 3300005563 Ga0068855_100146933 Ga0068855_1001469336 125
141 3300005563 Ga0068855_100606424 Ga0068855_1006064242 125
142 3300005577 Ga0068857_100302687 Ga0068857_1003026873 125
143 3300005578 Ga0068854_100200292 Ga0068854_1002002923 125
144 3300005614 Ga0068856_100364764 Ga0068856_1003647642 125
145 3300005614 Ga0068856_100689310 Ga0068856_1006893102 125
146 3300005616 Ga0068852_100210707 Ga0068852_1002107074 125
147 3300005842 Ga0068858_100022783 Ga0068858_1000227835 125
148 3300006051 Ga0075364_10000255 Ga0075364_1000025517 125
149 3300006051 Ga0075364_10279818 Ga0075364_102798183 125
150 3300006195 Ga0075366_10681411 Ga0075366_106814112 125
151 3300006237 Ga0097621_100000264 Ga0097621_10000026425 125
152 3300006358 Ga0068871_100000039 Ga0068871_10000003984 125
153 3300009093 Ga0105240_10120762 Ga0105240_101207624 125
154 3300009093 Ga0105240_11166404 Ga0105240_111664042 125
155 3300009098 Ga0105245_10000002 Ga0105245_10000002242 125
156 3300009098 Ga0105245_10308298 Ga0105245_103082982 125
157 3300009174 Ga0105241_10188144 Ga0105241_101881442 125
158 3300009174 Ga0105241_10213598 Ga0105241_102135983 125
159 3300009174 Ga0105241_11643473 Ga0105241_116434731 125
160 3300009551 Ga0105238_10000579 Ga0105238_1000057928 125
161 3300009551 Ga0105238_10823816 Ga0105238_108238162 125
162 3300009986 Ga0105033_100289 Ga0105033_1002893 125
163 3300009993 Ga0105028_105991 Ga0105028_1059912 125
164 3300013296 Ga0157374_10000031 Ga0157374_10000031129 125
165 3300013296 Ga0157374_10007401 Ga0157374_1000740114 125
166 3300014326 Ga0157380_10344182 Ga0157380_103441823 125
167 3300014968 Ga0157379_12161551 Ga0157379_121615512 125
168 3300025909 Ga0207705_10083261 Ga0207705_100832613 125
169 3300025911 Ga0207654_10202435 Ga0207654_102024352 125
170 3300025911 Ga0207654_10206024 Ga0207654_102060242 125
171 3300025912 Ga0207707_10279802 Ga0207707_102798022 125
172 3300025913 Ga0207695_10802017 Ga0207695_108020172 125
173 3300025914 Ga0207671_10431677 Ga0207671_104316772 125
174 3300025917 Ga0207660_11223008 Ga0207660_112230081 125
175 3300025917 Ga0207660_11512461 Ga0207660_115124611 125
176 3300025920 Ga0207649_10771153 Ga0207649_107711532 125
177 3300025921 Ga0207652_10310938 Ga0207652_103109382 125
178 3300025921 Ga0207652_10595896 Ga0207652_105958962 125
179 3300025921 Ga0207652_10879229 Ga0207652_108792291 125
180 3300025921 Ga0207652_10961222 Ga0207652_109612222 125
181 3300025921 Ga0207652_11418331 Ga0207652_114183312 125
182 3300025921 Ga0207652_11730276 Ga0207652_117302761 125
183 3300025924 Ga0207694_10000232 Ga0207694_1000023237 125
184 3300025927 Ga0207687_10000001 Ga0207687_10000001969 125
185 3300025927 Ga0207687_10000030 Ga0207687_10000030100 125
186 3300025927 Ga0207687_10190578 Ga0207687_101905783 125
187 3300025927 Ga0207687_10220400 Ga0207687_102204003 125
188 3300025929 Ga0207664_10003229 Ga0207664_1000322914 125
189 3300025929 Ga0207664_11247870 Ga0207664_112478702 125
190 3300025932 Ga0207690_10361785 Ga0207690_103617852 125
191 3300025944 Ga0207661_10262103 Ga0207661_102621032 125
192 3300025944 Ga0207661_11460679 Ga0207661_114606792 125
193 3300025949 Ga0207667_10000299 Ga0207667_1000029918 125
194 3300025949 Ga0207667_10031938 Ga0207667_100319384 125
195 3300025949 Ga0207667_10050173 Ga0207667_100501739 125
196 3300025949 Ga0207667_10138733 Ga0207667_101387335 125
197 3300025981 Ga0207640_10257897 Ga0207640_102578972 125
198 3300026035 Ga0207703_10076947 Ga0207703_100769475 125
199 3300026041 Ga0207639_10001800 Ga0207639_1000180019 125
200 3300026116 Ga0207674_10012488 Ga0207674_1001248810 125
201 3300028558 Ga0265326_10017045 Ga0265326_100170454 125
202 3300028563 Ga0265319_1181332 Ga0265319_11813322 125
203 3300028654 Ga0265322_10078246 Ga0265322_100782462 125
204 3300028800 Ga0265338_10028695 Ga0265338_100286953 125
205 3300028800 Ga0265338_10304951 Ga0265338_103049512 125
206 3300028800 Ga0265338_10356938 Ga0265338_103569382 125
207 3300029957 Ga0265324_10015771 Ga0265324_100157713 125
208 3300031249 Ga0265339_10129328 Ga0265339_101293282 125
209 3300031251 Ga0265327_10000017 Ga0265327_10000017167 125
210 3300031251 Ga0265327_10010524 Ga0265327_1001052411 125
211 3300031251 Ga0265327_10031602 Ga0265327_100316027 125
212 3300031251 Ga0265327_10306583 Ga0265327_103065832 125
213 3300031344 Ga0265316_10050606 Ga0265316_100506066 125
214 3300031344 Ga0265316_10451107 Ga0265316_104511072 125
215 3300037312 Ga0395899_0009875 Ga0395899_0009875_1442_1834 125
216 3300037418 Ga0395900_0012262 Ga0395900_0012262_2889_3281 125
217 3300037418 Ga0395900_0245759 Ga0395900_0245759_669_1046 125
218 3300037466 Ga0395898_0002536 Ga0395898_0002536_8051_8443 125
219 3300037471 Ga0395905_0008237 Ga0395905_0008237_5385_5777 125
220 3300038443 Ga0395901_0021849 Ga0395901_0021849_3630_4022 125
221 3300044694 Ga0466963_0795473 Ga0466963_0795473_167_553 125
222 3300045976 Ga0466967_0327555 Ga0466967_0327555_40_426 125
223 3300049586 Ga0501070_0191453 Ga0501070_0191453_1069_1461 125
224 3300049742 Ga0501080_0001402 Ga0501080_0001402_3840_4229 125
225 3300050491 nmdc:mga00v17_1627_c1 nmdc:mga00v17_1627_c1_2261_2647 125
226 3300050493 nmdc:mga0k408_328574_c1 nmdc:mga0k408_328574_c1_215_601 125
227 3300050516 nmdc:mga0sz30_447801_c1 nmdc:mga0sz30_447801_c1_138_521 125
228 3300053079 Ga0500610_0000001 Ga0500610_0000001_54794_55183 125
229 3300053087 Ga0500643_022206 Ga0500643_022206_923_1312 125
230 3300053088 Ga0500644_0000365 Ga0500644_0000365_10711_11100 125
231 3300053103 Ga0500555_000002 Ga0500555_000002_470105_470494 125
232 3300053108 Ga0500562_000002 Ga0500562_000002_938537_938914 125
233 3300053108 Ga0500562_020713 Ga0500562_020713_789_1178 125
234 3300053131 Ga0500652_000084 Ga0500652_000084_22025_22414 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00237

Ribosomal_L22

Ribosomal protein L22p/L17e

5

108

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c93-assembly1.cif.gz_S cryo-em captures early ribosome assembly in action 0.9518 1 110
8c8z-assembly1.cif.gz_S cryo-em captures early ribosome assembly in action 0.9486 1 110
8c93-assembly1.cif.gz_S cryo-em captures early ribosome assembly in action 0.9425 1 110
8c96-assembly1.cif.gz_S cryo-em captures early ribosome assembly in action 0.9421 1 108
6pvk-assembly1.cif.gz_S bacterial 45srbga ribosomal particle class a 0.9409 3 110
ID Description Score Start End Superfamily
af_P56795_7_145_3.90.470.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.9172 2 109 3.90.470.10
af_Q54J88_309_423_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9123 29 57 1.25.10.10
af_Q4DYB8_108_251_3.90.470.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.9107 2 110 3.90.470.10
4g5uS00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.9104 1 110 3.90.470.10
5mmiT00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.9013 2 110 3.90.470.10
ID Description Score Start End GO Terms
AF-A0A7J6I173-F1-model_v4 Large ribosomal subunit protein uL22c (50S ribosomal protein L22, chloroplastic) 0.9619 2 109 GO:0003735
GO:0006412
GO:0009536
GO:0015934
GO:0015935
GO:0016740
GO:0019843
AF-A0A251THC5-F1-model_v4 Large ribosomal subunit protein uL22c (Small ribosomal subunit protein uS3c) 0.9385 2 109 GO:0003735
GO:0006412
GO:0015934
GO:0019843
GO:0022627
AF-A0A6A5L0W0-F1-model_v4 deleted 0.9213 2 109
AF-A8W3M1-F1-model_v4 Large ribosomal subunit protein uL22c (50S ribosomal protein L22, plastid) 0.9206 1 109 GO:0003735
GO:0006412
GO:0009536
GO:0015934
GO:0019843
AF-A0A411L2I7-F1-model_v4 Large ribosomal subunit protein uL22c 0.9198 2 109 GO:0003735
GO:0006412
GO:0009507
GO:0015934
GO:0019843

Feature Viewer

pLDDT pTM Quality
89.74 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map