F346738

General Info

Members Datasets Scaffolds Average Seq Length
234 159 468 263

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10216861|Ga0070676_102168612
Length 283
Sequence MAAETSSSWCSKFVMVVAVTDYEDVDYTVEGATAVITINRPERYNAFRGRTVDELIRGFRSAWADHRVQAVILTGAGDKAFCTGGDVKQRAETGDYGPTESGMFEIGYLHRLIRDIPKPVIAAVNGLAVGGGHVLQVLCDLSIAAETARFGQAGPRVGSFDAGFGSAYLARVIGEKRAREMWYLCRLYDAATAERWGLVNAVVPADRLLAEAKAWAAEIAEKSPTAIRFLKQSFNADTDHQAGLSNLAMSALDLFTASPEGLEGATAFAEKRQPNFAAHVVGH

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
7 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
82 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
83 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
90 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
91 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
97 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
98 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
99 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
100 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
101 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
102 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
103 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
104 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
105 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
129 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
133 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
134 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
135 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
150 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
151 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
152 2643221604 Nocardioides sp. Root190 Isolate Unclassified
153 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
154 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
155 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
156 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
157 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
158 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
159 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.3
Metatranscriptomes 0
Isolates 4.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.56
Nodule 0
Rhizoplane 8.12
Rhizosphere 84.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10216861 3300005328 Bacteria 1262
2 Ga0070683_100001715 3300005329 Bacteria 17044
3 Ga0070683_100045225 3300005329 Bacteria 4063
4 Ga0070683_100603419 3300005329 Bacteria 1050
5 Ga0070682_100086563 3300005337 Bacteria 2041
6 Ga0070711_100428206 3300005439 Bacteria 1079
7 Ga0070708_100000239 3300005445 Bacteria 40761
8 Ga0070708_100142376 3300005445 Bacteria 2224
9 Ga0070708_100211981 3300005445 Bacteria 1815
10 Ga0070663_100047148 3300005455 Bacteria 3052
11 Ga0070663_100158585 3300005455 Bacteria 1740
12 Ga0070685_10348472 3300005466 Bacteria 1012
13 Ga0070685_10381659 3300005466 Bacteria 971
14 Ga0070706_100002875 3300005467 Bacteria 17156
15 Ga0070706_100003801 3300005467 Bacteria 14744
16 Ga0070707_100000455 3300005468 Bacteria 40583
17 Ga0070707_100000462 3300005468 Bacteria 40188
18 Ga0070698_100000073 3300005471 Bacteria 75512
19 Ga0070698_100011774 3300005471 Bacteria 9280
20 Ga0070698_100067931 3300005471 Bacteria 3583
21 Ga0070699_100000031 3300005518 Bacteria 138520
22 Ga0070699_100002293 3300005518 Bacteria 17217
23 Ga0070699_100015764 3300005518 Bacteria 6488
24 Ga0070699_100310998 3300005518 Bacteria 1414
25 Ga0070684_100020808 3300005535 Bacteria 5444
26 Ga0070684_100071322 3300005535 Bacteria 3058
27 Ga0070697_100485936 3300005536 Bacteria 1079
28 Ga0070672_100595131 3300005543 Bacteria 963
29 Ga0070665_100316172 3300005548 Bacteria 1565
30 Ga0070704_100004417 3300005549 Bacteria 8121
31 Ga0070664_100574937 3300005564 Bacteria 1044
32 Ga0068857_100124162 3300005577 Bacteria 2326
33 Ga0068856_100328493 3300005614 Bacteria 1547
34 Ga0068864_100062929 3300005618 Bacteria 3215
35 Ga0068870_10021576 3300005840 Bacteria 3153
36 Ga0068863_100139101 3300005841 Bacteria 2320
37 Ga0068858_100272422 3300005842 Bacteria 1611
38 Ga0070717_10137218 3300006028 Bacteria 2107
39 Ga0075363_100042618 3300006048 Bacteria 2399
40 Ga0075364_10000462 3300006051 Bacteria 20578
41 Ga0070715_10210325 3300006163 Bacteria 994
42 Ga0070712_100126141 3300006175 Bacteria 1934
43 Ga0075369_10013829 3300006186 Bacteria 3212
44 Ga0111539_10350484 3300009094 Bacteria 1718
45 Ga0105245_10809657 3300009098 Bacteria 975
46 Ga0105247_10041921 3300009101 Bacteria 2801
47 Ga0105248_10317515 3300009177 Bacteria 1755
48 Ga0105237_10004675 3300009545 Bacteria 15760
49 Ga0105239_10596015 3300010375 Bacteria 1260
50 Ga0105246_10179868 3300011119 Bacteria 1627
51 Ga0157369_10117446 3300013105 Bacteria 2824
52 Ga0157374_10418393 3300013296 Bacteria 1339
53 Ga0163162_10715377 3300013306 Bacteria 1122
54 Ga0157375_10164751 3300013308 Bacteria 2361
55 Ga0157375_10425271 3300013308 Bacteria 1494
56 Ga0163163_10102000 3300014325 Bacteria 2892
57 Ga0163163_10222712 3300014325 Bacteria 1935
58 Ga0163163_11045916 3300014325 Bacteria 880
59 Ga0157377_10123623 3300014745 Bacteria 1572
60 Ga0163161_10249675 3300017792 Bacteria 1383
61 Ga0213874_10038740 3300021377 Bacteria 1416
62 Ga0213876_10053843 3300021384 Bacteria 2125
63 Ga0207688_10051338 3300025901 Bacteria 2310
64 Ga0207688_10142963 3300025901 Bacteria 1409
65 Ga0207643_10033682 3300025908 Bacteria 2867
66 Ga0207705_10161266 3300025909 Bacteria 1685
67 Ga0207705_10396068 3300025909 Bacteria 1068
68 Ga0207684_10000051 3300025910 Bacteria 230737
69 Ga0207684_10003660 3300025910 Bacteria 14924
70 Ga0207671_10002392 3300025914 Bacteria 20124
71 Ga0207693_10084790 3300025915 Bacteria 2482
72 Ga0207693_10218561 3300025915 Bacteria 1497
73 Ga0207662_10058689 3300025918 Bacteria 2304
74 Ga0207657_10004161 3300025919 Bacteria 15335
75 Ga0207652_10077230 3300025921 Bacteria 2906
76 Ga0207646_10000164 3300025922 Bacteria 89825
77 Ga0207646_10000852 3300025922 Bacteria 39448
78 Ga0207646_10193210 3300025922 Bacteria 1838
79 Ga0207687_10089429 3300025927 Bacteria 2242
80 Ga0207687_10157313 3300025927 Bacteria 1740
81 Ga0207687_10272376 3300025927 Bacteria 1354
82 Ga0207665_10048419 3300025939 Bacteria 2853
83 Ga0207665_10152771 3300025939 Bacteria 1655
84 Ga0207691_10116020 3300025940 Bacteria 2377
85 Ga0207689_10078891 3300025942 Bacteria 2706
86 Ga0207661_10026561 3300025944 Bacteria 4413
87 Ga0207661_10029938 3300025944 Bacteria 4187
88 Ga0207679_10508260 3300025945 Bacteria 1076
89 Ga0207712_10211310 3300025961 Bacteria 1545
90 Ga0207640_10265764 3300025981 Bacteria 1339
91 Ga0207658_10273824 3300025986 Bacteria 1444
92 Ga0207703_10102989 3300026035 Bacteria 2423
93 Ga0207678_10034329 3300026067 Bacteria 4418
94 Ga0207678_10052672 3300026067 Bacteria 3510
95 Ga0207678_10079509 3300026067 Bacteria 2807
96 Ga0207708_10191287 3300026075 Bacteria 1629
97 Ga0207676_10533492 3300026095 Bacteria 1119
98 Ga0207674_10068276 3300026116 Bacteria 3577
99 Ga0207674_10087657 3300026116 Bacteria 3106
100 Ga0207674_10136854 3300026116 Bacteria 2411
101 Ga0207675_100225472 3300026118 Bacteria 1807
102 Ga0207683_10199635 3300026121 Bacteria 1818
103 Ga0316576_10033777 3300031727 Bacteria 3644
104 Ga0307413_10107355 3300031824 Bacteria 1860
105 Ga0307413_10110842 3300031824 Bacteria 1837
106 Ga0307413_10313892 3300031824 Bacteria 1194
107 Ga0307410_10019423 3300031852 Bacteria 4134
108 Ga0307410_10107478 3300031852 Bacteria 2012
109 Ga0307410_10130055 3300031852 Bacteria 1848
110 Ga0307406_10066162 3300031901 Bacteria 2351
111 Ga0307406_10158273 3300031901 Bacteria 1625
112 Ga0307407_10082315 3300031903 Bacteria 1950
113 Ga0307409_100021318 3300031995 Bacteria 4440
114 Ga0307409_100118783 3300031995 Bacteria 2234
115 Ga0307409_100207910 3300031995 Bacteria 1756
116 Ga0307409_100696157 3300031995 Bacteria 1015
117 Ga0307416_100662411 3300032002 Bacteria 1130
118 Ga0307416_101091314 3300032002 Bacteria 902
119 Ga0307414_10089350 3300032004 Bacteria 2283
120 Ga0307414_10200315 3300032004 Bacteria 1623
121 Ga0307414_10555910 3300032004 Bacteria 1023
122 Ga0307411_10077429 3300032005 Bacteria 2276
123 Ga0373956_0076709 3300035119 Bacteria 1530
124 Ga0316574_0015187 3300035398 Bacteria 4467
125 Ga0316584_0027842 3300036712 Bacteria 4161
126 Ga0395899_0061131 3300037312 Bacteria 2774
127 Ga0395900_0148365 3300037418 Bacteria 2397
128 Ga0395898_0191580 3300037466 Bacteria 1953
129 Ga0436364_0926189 3300037853 Bacteria 6081
130 Ga0436364_1017452 3300037853 Bacteria 1033
131 Ga0436365_0430062 3300039437 Bacteria 3745
132 Ga0436361_0010489 3300039447 Bacteria 1887
133 Ga0436363_1691596 3300039450 Bacteria 4126
134 Ga0466972_0034886 3300044658 Bacteria 2463
135 Ga0466961_0051511 3300044693 Bacteria 2629
136 Ga0466970_0008986 3300044765 Bacteria 5040
137 Ga0466970_0027094 3300044765 Bacteria 3006
138 Ga0451576_0913824 3300045051 Bacteria 921
139 Ga0466967_0372027 3300045976 Bacteria 1386
140 Ga0466967_0608947 3300045976 Bacteria 1078
141 Ga0495641_0097162 3300046461 Bacteria 1315
142 Ga0495596_0053988 3300046500 Bacteria 1572
143 Ga0495663_0082585 3300046525 Bacteria 1037
144 Ga0495667_0506768 3300046559 Bacteria 756
145 Ga0495656_0009627 3300046615 Bacteria 3482
146 Ga0495588_0030027 3300046674 Bacteria 2730
147 Ga0495647_0042036 3300046681 Bacteria 1744
148 Ga0495581_0005105 3300047315 Bacteria 7602
149 Ga0495636_0106053 3300047318 Bacteria 1233
150 Ga0495676_0092705 3300047321 Bacteria 2254
151 Ga0496102_0044974 3300048905 Bacteria 4007
152 Ga0496104_0032994 3300048907 Bacteria 4820
153 Ga0496105_0030849 3300048908 Bacteria 4394
154 Ga0496105_0613500 3300048908 Bacteria 843
155 Ga0496108_0006960 3300048911 Bacteria 9152
156 Ga0496108_0161774 3300048911 Bacteria 1935
157 Ga0496109_0016582 3300048912 Bacteria 6441
158 Ga0496109_0152607 3300048912 Bacteria 2163
159 Ga0496110_0007274 3300048913 Bacteria 8827
160 Ga0496110_0024725 3300048913 Bacteria 5123
161 Ga0496111_0000053 3300048914 Bacteria 45543
162 Ga0496112_0577874 3300048915 Bacteria 1056
163 Ga0496114_0000752 3300048917 Bacteria 24163
164 Ga0496114_0066289 3300048917 Bacteria 3027
165 Ga0496114_0074854 3300048917 Bacteria 2851
166 Ga0496114_0100513 3300048917 Bacteria 2468
167 Ga0496114_0272597 3300048917 Bacteria 1491
168 Ga0496114_0376715 3300048917 Bacteria 1256
169 Ga0496114_0386532 3300048917 Bacteria 1239
170 Ga0501031_0091672 3300049568 Bacteria 1982
171 Ga0501033_0070573 3300049570 Bacteria 2566
172 Ga0501033_0145645 3300049570 Bacteria 1711
173 Ga0501036_0001193 3300049572 Bacteria 19803
174 Ga0501036_0062223 3300049572 Bacteria 3161
175 Ga0501037_0035275 3300049573 Bacteria 3690
176 Ga0501037_0131079 3300049573 Bacteria 1797
177 Ga0501038_0003139 3300049574 Bacteria 15415
178 Ga0501038_0267676 3300049574 Bacteria 1348
179 Ga0501038_0403744 3300049574 Bacteria 1057
180 Ga0501039_0092827 3300049575 Bacteria 2352
181 Ga0501040_0001036 3300049576 Bacteria 17613
182 Ga0501040_0001724 3300049576 Bacteria 14028
183 Ga0501041_0047706 3300049577 Bacteria 2607
184 Ga0501042_0005577 3300049578 Bacteria 8108
185 Ga0501042_0030435 3300049578 Bacteria 3811
186 Ga0501046_0095923 3300049580 Bacteria 2278
187 Ga0501048_0115933 3300049582 Bacteria 1892
188 Ga0501048_0159228 3300049582 Bacteria 1597
189 Ga0501068_0191359 3300049584 Bacteria 1296
190 Ga0501070_0212065 3300049586 Bacteria 1589
191 Ga0501070_0460740 3300049586 Bacteria 1024
192 Ga0501071_0011234 3300049587 Bacteria 6024
193 Ga0501071_0016081 3300049587 Bacteria 5143
194 Ga0501072_0037304 3300049588 Bacteria 3811
195 Ga0501072_0104125 3300049588 Bacteria 2256
196 Ga0501073_0254216 3300049589 Bacteria 1213
197 Ga0501074_0056141 3300049590 Bacteria 2838
198 Ga0501074_0258268 3300049590 Bacteria 1239
199 Ga0501075_0093941 3300049591 Bacteria 2276
200 Ga0501075_0333304 3300049591 Bacteria 1156
201 Ga0501076_0051443 3300049592 Bacteria 3261
202 Ga0501076_0055677 3300049592 Bacteria 3136
203 Ga0501076_0098423 3300049592 Bacteria 2356
204 Ga0501077_0003477 3300049593 Bacteria 9460
205 Ga0501077_0125006 3300049593 Bacteria 1630
206 Ga0501206_008816 3300049653 Bacteria 1337
207 Ga0501079_0076971 3300049741 Bacteria 2580
208 Ga0501079_0170972 3300049741 Bacteria 1694
209 Ga0501080_0139172 3300049742 Bacteria 2245
210 Ga0501081_0027418 3300049743 Bacteria 3843
211 Ga0501081_0135445 3300049743 Bacteria 1763
212 Ga0501083_0383431 3300049744 Bacteria 914
213 Ga0501035_0030693 3300049822 Bacteria 4899
214 Ga0501044_0401137 3300049823 Bacteria 1284
215 Ga0501045_0048308 3300049824 Bacteria 3102
216 Ga0501045_0069931 3300049824 Bacteria 2581
217 nmdc:mga03n38_26360_c1 3300050490 Bacteria 2399
218 nmdc:mga00v17_669_c1 3300050491 Bacteria 18877
219 nmdc:mga0qj67_52863_c1 3300050509 Bacteria 3215
220 nmdc:mga08y16_274696_c1 3300050511 Bacteria 1739
221 nmdc:mga0sz30_2604_c1 3300050516 Bacteria 6419
222 Ga0501084_0212735 3300054114 Bacteria 1631
223 Ga0530510_0061132 3300061734 Bacteria 2727
224 2523384787 2523231044 Bacteria 6434991
225 2558913639 2558860112 Bacteria 9931328
226 2644034709 2643221604 Bacteria 5014917
227 2866554657 2866552031 Bacteria 5824618
228 2870784250 2870782633 Bacteria 9624083
229 2915358957 2915358134 Bacteria 6050864
230 2917737248 2917736166 Bacteria 9690793
231 2919053946 2919051321 Bacteria 4210889
232 8004023874 8004021418 Bacteria 4313954
233 8054474594 8054472261 Bacteria 7464355
234 8054478526 8054472261 Bacteria 7464355
235 Ga0070676_10216861
236 Ga0070683_100001715
237 Ga0070683_100045225
238 Ga0070683_100603419
239 Ga0070682_100086563
240 Ga0070711_100428206
241 Ga0070708_100000239
242 Ga0070708_100142376
243 Ga0070708_100211981
244 Ga0070663_100047148
245 Ga0070663_100158585
246 Ga0070685_10348472
247 Ga0070685_10381659
248 Ga0070706_100002875
249 Ga0070706_100003801
250 Ga0070707_100000455
251 Ga0070707_100000462
252 Ga0070698_100000073
253 Ga0070698_100011774
254 Ga0070698_100067931
255 Ga0070699_100000031
256 Ga0070699_100002293
257 Ga0070699_100015764
258 Ga0070699_100310998
259 Ga0070684_100020808
260 Ga0070684_100071322
261 Ga0070697_100485936
262 Ga0070672_100595131
263 Ga0070665_100316172
264 Ga0070704_100004417
265 Ga0070664_100574937
266 Ga0068857_100124162
267 Ga0068856_100328493
268 Ga0068864_100062929
269 Ga0068870_10021576
270 Ga0068863_100139101
271 Ga0068858_100272422
272 Ga0070717_10137218
273 Ga0075363_100042618
274 Ga0075364_10000462
275 Ga0070715_10210325
276 Ga0070712_100126141
277 Ga0075369_10013829
278 Ga0111539_10350484
279 Ga0105245_10809657
280 Ga0105247_10041921
281 Ga0105248_10317515
282 Ga0105237_10004675
283 Ga0105239_10596015
284 Ga0105246_10179868
285 Ga0157369_10117446
286 Ga0157374_10418393
287 Ga0163162_10715377
288 Ga0157375_10164751
289 Ga0157375_10425271
290 Ga0163163_10102000
291 Ga0163163_10222712
292 Ga0163163_11045916
293 Ga0157377_10123623
294 Ga0163161_10249675
295 Ga0213874_10038740
296 Ga0213876_10053843
297 Ga0207688_10051338
298 Ga0207688_10142963
299 Ga0207643_10033682
300 Ga0207705_10161266
301 Ga0207705_10396068
302 Ga0207684_10000051
303 Ga0207684_10003660
304 Ga0207671_10002392
305 Ga0207693_10084790
306 Ga0207693_10218561
307 Ga0207662_10058689
308 Ga0207657_10004161
309 Ga0207652_10077230
310 Ga0207646_10000164
311 Ga0207646_10000852
312 Ga0207646_10193210
313 Ga0207687_10089429
314 Ga0207687_10157313
315 Ga0207687_10272376
316 Ga0207665_10048419
317 Ga0207665_10152771
318 Ga0207691_10116020
319 Ga0207689_10078891
320 Ga0207661_10026561
321 Ga0207661_10029938
322 Ga0207679_10508260
323 Ga0207712_10211310
324 Ga0207640_10265764
325 Ga0207658_10273824
326 Ga0207703_10102989
327 Ga0207678_10034329
328 Ga0207678_10052672
329 Ga0207678_10079509
330 Ga0207708_10191287
331 Ga0207676_10533492
332 Ga0207674_10068276
333 Ga0207674_10087657
334 Ga0207674_10136854
335 Ga0207675_100225472
336 Ga0207683_10199635
337 Ga0316576_10033777
338 Ga0307413_10107355
339 Ga0307413_10110842
340 Ga0307413_10313892
341 Ga0307410_10019423
342 Ga0307410_10107478
343 Ga0307410_10130055
344 Ga0307406_10066162
345 Ga0307406_10158273
346 Ga0307407_10082315
347 Ga0307409_100021318
348 Ga0307409_100118783
349 Ga0307409_100207910
350 Ga0307409_100696157
351 Ga0307416_100662411
352 Ga0307416_101091314
353 Ga0307414_10089350
354 Ga0307414_10200315
355 Ga0307414_10555910
356 Ga0307411_10077429
357 Ga0373956_0076709
358 Ga0316574_0015187
359 Ga0316584_0027842
360 Ga0395899_0061131
361 Ga0395900_0148365
362 Ga0395898_0191580
363 Ga0436364_0926189
364 Ga0436364_1017452
365 Ga0436365_0430062
366 Ga0436361_0010489
367 Ga0436363_1691596
368 Ga0466972_0034886
369 Ga0466961_0051511
370 Ga0466970_0008986
371 Ga0466970_0027094
372 Ga0451576_0913824
373 Ga0466967_0372027
374 Ga0466967_0608947
375 Ga0495641_0097162
376 Ga0495596_0053988
377 Ga0495663_0082585
378 Ga0495667_0506768
379 Ga0495656_0009627
380 Ga0495588_0030027
381 Ga0495647_0042036
382 Ga0495581_0005105
383 Ga0495636_0106053
384 Ga0495676_0092705
385 Ga0496102_0044974
386 Ga0496104_0032994
387 Ga0496105_0030849
388 Ga0496105_0613500
389 Ga0496108_0006960
390 Ga0496108_0161774
391 Ga0496109_0016582
392 Ga0496109_0152607
393 Ga0496110_0007274
394 Ga0496110_0024725
395 Ga0496111_0000053
396 Ga0496112_0577874
397 Ga0496114_0000752
398 Ga0496114_0066289
399 Ga0496114_0074854
400 Ga0496114_0100513
401 Ga0496114_0272597
402 Ga0496114_0376715
403 Ga0496114_0386532
404 Ga0501031_0091672
405 Ga0501033_0070573
406 Ga0501033_0145645
407 Ga0501036_0001193
408 Ga0501036_0062223
409 Ga0501037_0035275
410 Ga0501037_0131079
411 Ga0501038_0003139
412 Ga0501038_0267676
413 Ga0501038_0403744
414 Ga0501039_0092827
415 Ga0501040_0001036
416 Ga0501040_0001724
417 Ga0501041_0047706
418 Ga0501042_0005577
419 Ga0501042_0030435
420 Ga0501046_0095923
421 Ga0501048_0115933
422 Ga0501048_0159228
423 Ga0501068_0191359
424 Ga0501070_0212065
425 Ga0501070_0460740
426 Ga0501071_0011234
427 Ga0501071_0016081
428 Ga0501072_0037304
429 Ga0501072_0104125
430 Ga0501073_0254216
431 Ga0501074_0056141
432 Ga0501074_0258268
433 Ga0501075_0093941
434 Ga0501075_0333304
435 Ga0501076_0051443
436 Ga0501076_0055677
437 Ga0501076_0098423
438 Ga0501077_0003477
439 Ga0501077_0125006
440 Ga0501206_008816
441 Ga0501079_0076971
442 Ga0501079_0170972
443 Ga0501080_0139172
444 Ga0501081_0027418
445 Ga0501081_0135445
446 Ga0501083_0383431
447 Ga0501035_0030693
448 Ga0501044_0401137
449 Ga0501045_0048308
450 Ga0501045_0069931
451 nmdc:mga03n38_26360_c1
452 nmdc:mga00v17_669_c1
453 nmdc:mga0qj67_52863_c1
454 nmdc:mga08y16_274696_c1
455 nmdc:mga0sz30_2604_c1
456 Ga0501084_0212735
457 Ga0530510_0061132
458 2523384787
459 2558913639
460 2644034709
461 2866554657
462 2870784250
463 2915358957
464 2917737248
465 2919053946
466 8004023874
467 8054474594
468 8054478526

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

28

279

0.93

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

33

279

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o34-assembly1.cif.gz_C thne from s.clavuligerus 0.9332 27 243
5dtp-assembly1.cif.gz_B crystal structure of m. tuberculosis echa6 (apo, trigonal crystal form) 0.9307 23 237
3t8b-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis menb with altered hexameric assembly 0.925 20 223
4kd6-assembly1.cif.gz_A crystal structure of a enoyl-coa hydratase/isomerase from burkholderia graminis c4d1m 0.9241 24 251
6lvo-assembly1.cif.gz_A enoyl-coa isomerase (boeci) from bosea sp. pamc 26642 0.9224 23 269
ID Description Score Start End Superfamily
3rsiC01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9685 24 77 3.30.300.220
af_Q2FZL5_3_210_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9479 18 219 3.90.226.10
4lk5B01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9368 24 204 3.90.226.10
4qiiB01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.936 19 219 3.90.226.10
5ve2I00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9246 23 276 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A7K0N7A9-F1-model_v4 1,4-dihydroxy-2-naphthoyl-CoA synthase (EC 4.1.3.36) 0.988 108 280 GO:0008935
AF-A0A132N7E4-F1-model_v4 1,4-dihydroxy-2-naphthoyl-CoA synthase (DHNA-CoA synthase) (EC 4.1.3.36) 0.9869 22 280 GO:0005829
GO:0008935
GO:0009234
AF-A0A6J7VMG2-F1-model_v4 Unannotated protein 0.9855 47 280 GO:0008935
AF-A0A7C2SSF0-F1-model_v4 1,4-dihydroxy-2-naphthoyl-CoA synthase (EC 4.1.3.36) 0.984 46 281 GO:0005829
GO:0008935
GO:0009234
AF-A0A3D0VDY9-F1-model_v4 1,4-dihydroxy-2-naphthoyl-CoA synthase (EC 4.1.3.36) 0.9813 20 199 GO:0005829
GO:0008935
GO:0009234

Map