F346626

General Info

Members Datasets Scaffolds Average Seq Length
233 188 186 353

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8002784119|8002787073
Length 412
Sequence PTPSAASVNAGGGPTAATPRSATAGQARPPDLTTDLTTDKASAALTATADLDTGSRASAPRPASLETRVGLAVHGVRLTAPVSRRAGAGPSDDGHVVLGGRGVALPIVATSRYEVSGDRLLFEGTDLGIPVEPVRRPRFYDLTTADGIRYEQLARLHGADVLATTVLQTCVRYQEADRCRFCAIEESLRAGATTALKTPAQLAEVAEAAVRLDGVRQLVMTTGSTAAPDRGARLLVEAVRAVLAAVPGLPIQVQCEPPADLAAIRELRQAGASAIGIHVESLDDAVRARWMPGKATVPLAAYEAAWTEAVRVFGRNRVSTYLLIGLGEDPDELVAGAERLIGLGVYPFVVPFRPIAGTLAARDGATAPDQAVVADVTRRVAAALRAAGMRGADQTAGCAACGACSALPEAGG

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2517572101 Frankia sp. DC12 Isolate Nodule
3 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
4 2626541554 Frankia sp. AvcI.1 Isolate Nodule
5 2643221604 Nocardioides sp. Root190 Isolate Unclassified
6 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
7 2671180195 Frankia sp. CcI49 Isolate Nodule
8 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
9 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
10 2687453737 Frankia sp. BMG5.36 Isolate Nodule
11 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
12 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
13 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
14 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
15 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
16 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
17 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
18 2773857922 Frankia sp. CcI49 Isolate Nodule
19 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
20 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
21 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
22 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
23 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
24 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
25 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
26 2891562705 Microbispora tritici MT50 Isolate Unclassified
27 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
28 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
29 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
30 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
31 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
32 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
33 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
34 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
35 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
36 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
37 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
38 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
39 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
40 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
41 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
42 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
43 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
44 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
45 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
46 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
79 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
80 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
93 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
94 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
95 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
96 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
100 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
103 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
104 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
105 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
113 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
114 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
117 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
118 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
128 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
129 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
132 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
135 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
136 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
137 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
150 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
151 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
152 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
153 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
157 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
180 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
181 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
182 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
183 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
184 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
185 8002775197 Frankia nepalensis CN7 Isolate Nodule
186 8002784119 Frankia sp. AgB1.9 Isolate Nodule
187 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
188 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 79.83
Metatranscriptomes 0
Isolates 20.17

Biome Distribution

Category Percentage (%)
Aerial Root 1.29
Bulb 0
Endosphere 10.3
Nodule 5.15
Rhizoplane 4.29
Rhizosphere 54.08
Stem 0
Stem Tuber 0
Unclassified 24.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000250 3300000549 Bacteria 9876
2 rootH1_10000649 3300003323 Bacteria 26896
3 JGI25407J50210_10007731 3300003373 Bacteria 2698
4 Ga0055540_1001584 3300003792 Bacteria 13273
5 Ga0068869_100266470 3300005334 Bacteria 1373
6 Ga0068853_100012778 3300005539 Bacteria 6838
7 Ga0070665_100025437 3300005548 Bacteria 5964
8 Ga0068854_100090898 3300005578 Bacteria 2271
9 Ga0070702_100192496 3300005615 Bacteria 1343
10 Ga0068852_100084377 3300005616 Bacteria 2827
11 Ga0068859_100000044 3300005617 Bacteria 144391
12 Ga0068863_100000204 3300005841 Bacteria 63407
13 Ga0068863_100000325 3300005841 Bacteria 48321
14 Ga0068862_100000263 3300005844 Bacteria 58636
15 Ga0081538_10000014 3300005981 Bacteria 151008
16 Ga0081538_10034970 3300005981 Bacteria 3310
17 Ga0081539_10005752 3300005985 Bacteria 12379
18 Ga0081539_10005774 3300005985 Bacteria 12339
19 Ga0075365_10003163 3300006038 Bacteria 8401
20 Ga0075365_10083481 3300006038 Bacteria 2167
21 Ga0075364_10002417 3300006051 Bacteria 10460
22 Ga0075364_10013353 3300006051 Bacteria 5045
23 Ga0075364_10017252 3300006051 Bacteria 4507
24 Ga0075369_10000764 3300006186 Bacteria 10486
25 Ga0075369_10022503 3300006186 Bacteria 2600
26 Ga0075370_10021042 3300006353 Bacteria 3572
27 Ga0075431_100000225 3300006847 Bacteria 42245
28 Ga0075431_100196179 3300006847 Bacteria 2067
29 Ga0097620_100000044 3300006931 Bacteria 144391
30 Ga0105245_10205365 3300009098 Bacteria 1894
31 Ga0105247_10000428 3300009101 Bacteria 35775
32 Ga0114129_10193258 3300009147 Bacteria 2762
33 Ga0105248_10001275 3300009177 Bacteria 28162
34 Ga0105237_10009265 3300009545 Bacteria 10552
35 Ga0105238_10558658 3300009551 Bacteria 1149
36 Ga0105249_10008433 3300009553 Bacteria 8978
37 Ga0105239_10076851 3300010375 Bacteria 3673
38 Ga0157372_10173938 3300013307 Bacteria 2492
39 Ga0163163_10032100 3300014325 Bacteria 5072
40 Ga0182008_10001551 3300014497 Bacteria 15276
41 Ga0157379_10013066 3300014968 Bacteria 7272
42 Ga0182006_1061568 3300015261 Bacteria 1415
43 Ga0182005_1010135 3300015265 Bacteria 2716
44 Ga0183367_1011 3300015688 Bacteria 397353
45 Ga0209051_1002882 3300025303 Bacteria 11821
46 Ga0209051_1003172 3300025303 Bacteria 11003
47 Ga0207710_10000011 3300025900 Bacteria 428560
48 Ga0207711_10000278 3300025941 Bacteria 55354
49 Ga0207711_10005565 3300025941 Bacteria 10651
50 Ga0207712_10008222 3300025961 Bacteria 6594
51 Ga0207678_10035289 3300026067 Bacteria 4354
52 Ga0207678_10113888 3300026067 Bacteria 2308
53 Ga0207683_10249050 3300026121 Bacteria 1621
54 Ga0268265_10000180 3300028380 Bacteria 74801
55 Ga0307517_10001180 3300028786 Bacteria 43992
56 Ga0307515_10000050 3300028794 Bacteria 275624
57 Ga0307515_10136940 3300028794 Bacteria 2655
58 Ga0265338_10007972 3300028800 Bacteria 12965
59 Ga0307511_10002474 3300030521 Bacteria 19309
60 Ga0307513_10063452 3300031456 Bacteria 3899
61 Ga0307513_10108513 3300031456 Bacteria 2776
62 Ga0307509_10009548 3300031507 Bacteria 12091
63 Ga0307508_10010285 3300031616 Bacteria 8559
64 Ga0307508_10177652 3300031616 Bacteria 1732
65 Ga0307514_10043663 3300031649 Bacteria 3518
66 Ga0307516_10052654 3300031730 Bacteria 3983
67 Ga0307518_10046587 3300031838 Bacteria 3153
68 Ga0307416_100239766 3300032002 Bacteria 1756
69 Ga0307415_100082852 3300032126 Bacteria 2296
70 Ga0307415_100241896 3300032126 Bacteria 1460
71 Ga0307507_10000004 3300033179 Bacteria 289641
72 Ga0307507_10023545 3300033179 Bacteria 6754
73 Ga0307510_10069963 3300033180 Bacteria 3509
74 Ga0373956_0001196 3300035119 Bacteria 10724
75 Ga0451793_0549178 3300041452 Bacteria 1256
76 Ga0439458_0000294 3300042157 Bacteria 12443
77 Ga0495627_037754 3300046453 Bacteria 1497
78 Ga0495592_0076056 3300046454 Bacteria 2437
79 Ga0495629_0002711 3300046459 Bacteria 13557
80 Ga0495651_0000556 3300046462 Bacteria 28812
81 Ga0495653_0002934 3300046463 Bacteria 13649
82 Ga0495653_0173726 3300046463 Bacteria 1485
83 Ga0495582_0092032 3300046473 Bacteria 1691
84 Ga0495662_0001030 3300046476 Bacteria 13673
85 Ga0495664_0000412 3300046477 Bacteria 20871
86 Ga0495585_0054015 3300046492 Bacteria 2222
87 Ga0495583_0012683 3300046506 Bacteria 4749
88 Ga0495620_0002266 3300046515 Bacteria 11133
89 Ga0495628_0207538 3300046516 Bacteria 1474
90 Ga0495643_0001303 3300046522 Bacteria 23710
91 Ga0495587_0001237 3300046536 Bacteria 16943
92 Ga0495597_0016588 3300046542 Bacteria 3477
93 Ga0495668_0010826 3300046616 Bacteria 5497
94 Ga0495634_0000330 3300046642 Bacteria 45651
95 Ga0495625_0028773 3300046660 Bacteria 4162
96 Ga0495635_0009717 3300046663 Bacteria 6724
97 Ga0495588_0018115 3300046674 Bacteria 3429
98 Ga0495657_0001729 3300046675 Bacteria 18688
99 Ga0495646_0000919 3300046680 Bacteria 16737
100 Ga0495646_0067866 3300046680 Bacteria 2107
101 Ga0495613_0039131 3300046689 Bacteria 3515
102 Ga0495613_0051924 3300046689 Bacteria 3021
103 Ga0495624_0061524 3300046690 Bacteria 2352
104 Ga0495649_0028923 3300046694 Bacteria 3071
105 Ga0495589_0015301 3300046794 Bacteria 3950
106 Ga0495600_0100564 3300046809 Bacteria 1884
107 Ga0495660_0017589 3300046810 Bacteria 4115
108 Ga0495581_0032338 3300047315 Bacteria 3029
109 Ga0495604_0000648 3300047317 Bacteria 29764
110 Ga0495676_0002652 3300047321 Bacteria 16007
111 Ga0495676_0065859 3300047321 Bacteria 2810
112 Ga0495687_004118 3300047443 Bacteria 10040
113 Ga0495687_007912 3300047443 Bacteria 6178
114 Ga0495687_017539 3300047443 Bacteria 3567
115 Ga0495687_034722 3300047443 Bacteria 2275
116 Ga0495685_000830 3300047447 Bacteria 9424
117 Ga0495681_0003350 3300047470 Bacteria 11151
118 Ga0495686_0004563 3300047472 Bacteria 11338
119 Ga0495686_0028241 3300047472 Bacteria 3654
120 Ga0495593_0001621 3300047673 Bacteria 13315
121 Ga0495602_0013639 3300048088 Bacteria 8292
122 Ga0495614_0000459 3300048089 Bacteria 16732
123 Ga0496101_0000008 3300048904 Bacteria 309720
124 Ga0496102_0000005 3300048905 Bacteria 481937
125 Ga0496102_0008066 3300048905 Bacteria 9009
126 Ga0496102_0020803 3300048905 Bacteria 5799
127 Ga0496103_0000002 3300048906 Bacteria 605387
128 Ga0496106_0018435 3300048909 Bacteria 5160
129 Ga0496107_0010162 3300048910 Bacteria 6528
130 Ga0496109_0329326 3300048912 Bacteria 1442
131 Ga0496113_0012364 3300048916 Bacteria 5736
132 Ga0496116_0000034 3300048919 Bacteria 409567
133 Ga0496116_0000296 3300048919 Bacteria 84170
134 Ga0496117_0000003 3300048920 Bacteria 1881097
135 Ga0496117_0006387 3300048920 Bacteria 11961
136 Ga0496118_0000001 3300048921 Bacteria 1881100
137 Ga0496118_0000539 3300048921 Bacteria 62235
138 Ga0496119_0000144 3300048922 Bacteria 99370
139 Ga0496119_0000179 3300048922 Bacteria 88433
140 Ga0496119_0000388 3300048922 Bacteria 60765
141 Ga0496119_0001039 3300048922 Bacteria 35479
142 Ga0496120_0000174 3300048923 Bacteria 109870
143 Ga0496120_0003960 3300048923 Bacteria 12876
144 Ga0496120_0011634 3300048923 Bacteria 6038
145 Ga0496120_0147499 3300048923 Bacteria 1186
146 Ga0496121_0000471 3300048924 Bacteria 78517
147 Ga0496121_0012558 3300048924 Bacteria 9215
148 Ga0496121_0086155 3300048924 Bacteria 2469
149 Ga0496122_0000305 3300048925 Bacteria 108235
150 Ga0496122_0031737 3300048925 Bacteria 4386
151 Ga0496123_0001046 3300048926 Bacteria 41871
152 Ga0496124_0251818 3300048927 Bacteria 1306
153 Ga0496124_0347369 3300048927 Bacteria 1051
154 Ga0496126_0000422 3300048929 Bacteria 85201
155 Ga0496126_0007307 3300048929 Bacteria 12134
156 Ga0501031_0143888 3300049568 Bacteria 1558
157 Ga0501032_0046433 3300049569 Bacteria 2935
158 Ga0501033_0044031 3300049570 Bacteria 3322
159 Ga0501034_0161858 3300049571 Bacteria 2208
160 Ga0501036_0051494 3300049572 Bacteria 3486
161 Ga0501037_0259099 3300049573 Bacteria 1215
162 Ga0501038_0021545 3300049574 Bacteria 5783
163 Ga0501039_0048789 3300049575 Bacteria 3273
164 Ga0501043_0046111 3300049579 Bacteria 3427
165 Ga0501047_0164656 3300049581 Bacteria 2088
166 Ga0501035_0017774 3300049822 Bacteria 6558
167 Ga0501044_0163816 3300049823 Bacteria 2198
168 Ga0501045_0196477 3300049824 Bacteria 1503
169 nmdc:mga00v17_183246_c1 3300050491 Bacteria 1351
170 nmdc:mga00v17_4125_c1 3300050491 Bacteria 7521
171 nmdc:mga00v17_60891_c1 3300050491 Bacteria 2320
172 nmdc:mga0yw44_117463_c1 3300050492 Bacteria 1710
173 nmdc:mga0yw44_4259_c1 3300050492 Bacteria 6523
174 nmdc:mga07m45_109356_c1 3300050496 Bacteria 1591
175 nmdc:mga05p37_178507_c1 3300050507 Bacteria 2585
176 nmdc:mga06r32_319839_c1 3300050510 Bacteria 1537
177 nmdc:mga06r32_589_c1 3300050510 Bacteria 31615
178 nmdc:mga0sz30_1167_c1 3300050516 Bacteria 5440
179 Ga0495601_0014615 3300053077 Bacteria 4732
180 Ga0495612_0072573 3300053078 Bacteria 1437
181 Ga0500566_0065771 3300053094 Bacteria 2044
182 Ga0500560_001303 3300053107 Bacteria 4238
183 Ga0500560_016513 3300053107 Bacteria 2016
184 Ga0500568_0000068 3300053139 Bacteria 103847
185 Ga0500573_0009356 3300053140 Bacteria 5432
186 Ga0500633_0040881 3300053160 Bacteria 1558

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0347369 Ga0496124_0347369_109_1038 299
2 3300006847 Ga0075431_100196179 Ga0075431_1001961792 310
3 3300050510 nmdc:mga06r32_319839_c1 nmdc:mga06r32_319839_c1_309_1478 310
4 3300048905 Ga0496102_0008066 Ga0496102_0008066_5307_6401 314
5 3300003323 rootH1_10000649 rootH1_100006498 318
6 3300048924 Ga0496121_0086155 Ga0496121_0086155_610_1692 318
7 3300005985 Ga0081539_10005752 Ga0081539_1000575210 320
8 3300046463 Ga0495653_0002934 Ga0495653_0002934_10744_11829 320
9 3300005617 Ga0068859_100000044 Ga0068859_10000004463 321
10 3300005844 Ga0068862_100000263 Ga0068862_10000026343 321
11 3300006931 Ga0097620_100000044 Ga0097620_10000004463 321
12 3300009553 Ga0105249_10008433 Ga0105249_100084338 321
13 3300014325 Ga0163163_10032100 Ga0163163_100321002 321
14 3300025961 Ga0207712_10008222 Ga0207712_100082222 321
15 3300028380 Ga0268265_10000180 Ga0268265_1000018037 321
16 3300026067 Ga0207678_10113888 Ga0207678_101138882 325
17 3300050496 nmdc:mga07m45_109356_c1 nmdc:mga07m45_109356_c1_172_1167 325
18 3300033179 Ga0307507_10000004 Ga0307507_10000004105 326
19 3300006038 Ga0075365_10003163 Ga0075365_100031634 327
20 3300050491 nmdc:mga00v17_183246_c1 nmdc:mga00v17_183246_c1_165_1247 327
21 3300050492 nmdc:mga0yw44_4259_c1 nmdc:mga0yw44_4259_c1_4548_5630 327
22 iso_pu_bacteria 2684623035 2686534450 327
23 3300010375 Ga0105239_10076851 Ga0105239_100768513 329
24 3300048916 Ga0496113_0012364 Ga0496113_0012364_4305_5360 329
25 3300048925 Ga0496122_0000305 Ga0496122_0000305_104645_105700 329
26 3300048926 Ga0496123_0001046 Ga0496123_0001046_12055_13110 329
27 3300048927 Ga0496124_0251818 Ga0496124_0251818_94_1149 329
28 3300048929 Ga0496126_0007307 Ga0496126_0007307_2464_3519 329
29 3300003373 JGI25407J50210_10007731 JGI25407J50210_100077313 330
30 3300005981 Ga0081538_10000014 Ga0081538_10000014128 330
31 3300006186 Ga0075369_10022503 Ga0075369_100225032 330
32 3300053140 Ga0500573_0009356 Ga0500573_0009356_4128_5225 331
33 3300005841 Ga0068863_100000325 Ga0068863_10000032530 333
34 3300005539 Ga0068853_100012778 Ga0068853_1000127784 334
35 3300005841 Ga0068863_100000204 Ga0068863_10000020448 334
36 3300047472 Ga0495686_0004563 Ga0495686_0004563_520_1581 334
37 3300028794 Ga0307515_10136940 Ga0307515_101369403 336
38 3300031649 Ga0307514_10043663 Ga0307514_100436633 336
39 iso_pu_bacteria 2687453743 2689996444 336
40 3300050516 nmdc:mga0sz30_1167_c1 nmdc:mga0sz30_1167_c1_207_1244 337
41 3300041452 Ga0451793_0549178 Ga0451793_0549178_135_1175 338
42 3300048923 Ga0496120_0147499 Ga0496120_0147499_88_1143 338
43 3300032002 Ga0307416_100239766 Ga0307416_1002397662 339
44 3300032126 Ga0307415_100082852 Ga0307415_1000828522 339
45 3300032126 Ga0307415_100241896 Ga0307415_1002418962 339
46 3300006051 Ga0075364_10017252 Ga0075364_100172524 340
47 3300014497 Ga0182008_10001551 Ga0182008_100015516 340
48 3300015261 Ga0182006_1061568 Ga0182006_10615682 340
49 3300028786 Ga0307517_10001180 Ga0307517_100011804 340
50 3300028794 Ga0307515_10000050 Ga0307515_1000005035 340
51 3300031730 Ga0307516_10052654 Ga0307516_100526544 340
52 3300033179 Ga0307507_10023545 Ga0307507_100235454 340
53 3300050491 nmdc:mga00v17_60891_c1 nmdc:mga00v17_60891_c1_65_1135 340
54 3300053094 Ga0500566_0065771 Ga0500566_0065771_382_1440 340
55 iso_pu_bacteria 8055172936 8055174447 340
56 3300005334 Ga0068869_100266470 Ga0068869_1002664702 341
57 3300006051 Ga0075364_10013353 Ga0075364_100133532 341
58 3300047443 Ga0495687_007912 Ga0495687_007912_4369_5487 341
59 3300048925 Ga0496122_0031737 Ga0496122_0031737_738_1829 341
60 3300050491 nmdc:mga00v17_4125_c1 nmdc:mga00v17_4125_c1_1044_2093 341
61 iso_pu_bacteria 2523231044 2523383937 341
62 iso_pu_bacteria 2738543034 2739365047 341
63 iso_pu_bacteria 2799112218 2799182878 341
64 iso_pu_bacteria 2904765812 2904768882 341
65 iso_pu_bacteria 2904770941 2904771829 341
66 iso_pu_bacteria 2908811453 2908813735 341
67 iso_pu_bacteria 2919420072 2919422240 341
68 iso_pu_bacteria 2919432681 2919434202 341
69 iso_pu_bacteria 2929212328 2929213659 341
70 3300005548 Ga0070665_100025437 Ga0070665_1000254375 342
71 3300005578 Ga0068854_100090898 Ga0068854_1000908982 342
72 3300005615 Ga0070702_100192496 Ga0070702_1001924962 342
73 3300005616 Ga0068852_100084377 Ga0068852_1000843772 342
74 3300006847 Ga0075431_100000225 Ga0075431_10000022525 342
75 3300009098 Ga0105245_10205365 Ga0105245_102053651 342
76 3300009147 Ga0114129_10193258 Ga0114129_101932582 342
77 3300025303 Ga0209051_1003172 Ga0209051_100317210 342
78 3300025941 Ga0207711_10000278 Ga0207711_1000027856 342
79 3300026067 Ga0207678_10035289 Ga0207678_100352892 342
80 3300031456 Ga0307513_10063452 Ga0307513_100634522 342
81 3300031616 Ga0307508_10177652 Ga0307508_101776522 342
82 3300046453 Ga0495627_037754 Ga0495627_037754_328_1389 342
83 3300046492 Ga0495585_0054015 Ga0495585_0054015_269_1330 342
84 3300048905 Ga0496102_0020803 Ga0496102_0020803_2127_3410 342
85 3300048912 Ga0496109_0329326 Ga0496109_0329326_87_1139 342
86 3300048919 Ga0496116_0000296 Ga0496116_0000296_25922_27205 342
87 3300048920 Ga0496117_0006387 Ga0496117_0006387_7023_8306 342
88 3300048921 Ga0496118_0000539 Ga0496118_0000539_49026_50309 342
89 3300048922 Ga0496119_0000388 Ga0496119_0000388_20312_21595 342
90 3300048924 Ga0496121_0012558 Ga0496121_0012558_2598_3749 342
91 3300050507 nmdc:mga05p37_178507_c1 nmdc:mga05p37_178507_c1_748_1800 342
92 3300050510 nmdc:mga06r32_589_c1 nmdc:mga06r32_589_c1_13801_14853 342
93 iso_pu_bacteria 2626541554 2626636231 342
94 iso_pu_bacteria 2856741275 2856742269 342
95 iso_pu_bacteria 2891562705 2891565455 342
96 iso_pu_bacteria 8055157932 8055162582 342
97 3300003792 Ga0055540_1001584 Ga0055540_100158411 343
98 3300005981 Ga0081538_10034970 Ga0081538_100349701 343
99 3300006038 Ga0075365_10083481 Ga0075365_100834812 343
100 3300009551 Ga0105238_10558658 Ga0105238_105586581 343
101 3300013307 Ga0157372_10173938 Ga0157372_101739383 343
102 3300025303 Ga0209051_1002882 Ga0209051_100288210 343
103 3300048904 Ga0496101_0000008 Ga0496101_0000008_304052_305107 343
104 3300048905 Ga0496102_0000005 Ga0496102_0000005_395910_396965 343
105 3300048906 Ga0496103_0000002 Ga0496103_0000002_85003_86058 343
106 3300048909 Ga0496106_0018435 Ga0496106_0018435_3444_4499 343
107 3300048910 Ga0496107_0010162 Ga0496107_0010162_2478_3533 343
108 3300048919 Ga0496116_0000034 Ga0496116_0000034_323776_324831 343
109 3300048920 Ga0496117_0000003 Ga0496117_0000003_677139_678194 343
110 3300048921 Ga0496118_0000001 Ga0496118_0000001_677142_678197 343
111 3300048922 Ga0496119_0000179 Ga0496119_0000179_25068_26123 343
112 3300048923 Ga0496120_0000174 Ga0496120_0000174_54912_55967 343
113 3300048924 Ga0496121_0000471 Ga0496121_0000471_1635_2690 343
114 3300048929 Ga0496126_0000422 Ga0496126_0000422_43968_45023 343
115 3300050492 nmdc:mga0yw44_117463_c1 nmdc:mga0yw44_117463_c1_44_1099 343
116 3300053139 Ga0500568_0000068 Ga0500568_0000068_54511_55566 343
117 iso_pu_bacteria 2891554331 2891555500 343
118 3300005985 Ga0081539_10005774 Ga0081539_100057745 344
119 3300006051 Ga0075364_10002417 Ga0075364_100024173 344
120 3300006186 Ga0075369_10000764 Ga0075369_100007649 344
121 3300006353 Ga0075370_10021042 Ga0075370_100210423 344
122 3300009101 Ga0105247_10000428 Ga0105247_1000042817 344
123 3300009177 Ga0105248_10001275 Ga0105248_100012757 344
124 3300009545 Ga0105237_10009265 Ga0105237_100092659 344
125 3300014968 Ga0157379_10013066 Ga0157379_100130662 344
126 3300015265 Ga0182005_1010135 Ga0182005_10101352 344
127 3300015688 Ga0183367_1011 Ga0183367_1011311 344
128 3300025900 Ga0207710_10000011 Ga0207710_10000011325 344
129 3300025941 Ga0207711_10005565 Ga0207711_100055657 344
130 3300026121 Ga0207683_10249050 Ga0207683_102490502 344
131 3300028800 Ga0265338_10007972 Ga0265338_1000797213 344
132 3300030521 Ga0307511_10002474 Ga0307511_100024745 344
133 3300031507 Ga0307509_10009548 Ga0307509_100095485 344
134 3300031616 Ga0307508_10010285 Ga0307508_1001028511 344
135 3300031838 Ga0307518_10046587 Ga0307518_100465872 344
136 3300033180 Ga0307510_10069963 Ga0307510_100699633 344
137 3300042157 Ga0439458_0000294 Ga0439458_0000294_586_1677 344
138 3300046459 Ga0495629_0002711 Ga0495629_0002711_8693_9784 344
139 3300046660 Ga0495625_0028773 Ga0495625_0028773_2425_3516 344
140 3300046674 Ga0495588_0018115 Ga0495588_0018115_1861_2952 344
141 3300046680 Ga0495646_0067866 Ga0495646_0067866_591_1694 344
142 3300046690 Ga0495624_0061524 Ga0495624_0061524_758_1840 344
143 3300047443 Ga0495687_004118 Ga0495687_004118_6207_7298 344
144 3300047470 Ga0495681_0003350 Ga0495681_0003350_5545_6636 344
145 3300047472 Ga0495686_0028241 Ga0495686_0028241_298_1356 344
146 3300048922 Ga0496119_0000144 Ga0496119_0000144_69950_71026 344
147 3300048922 Ga0496119_0001039 Ga0496119_0001039_24228_25295 344
148 3300048923 Ga0496120_0003960 Ga0496120_0003960_10166_11233 344
149 3300048923 Ga0496120_0011634 Ga0496120_0011634_2734_3810 344
150 3300049568 Ga0501031_0143888 Ga0501031_0143888_428_1513 344
151 3300049569 Ga0501032_0046433 Ga0501032_0046433_1107_2192 344
152 3300049570 Ga0501033_0044031 Ga0501033_0044031_1279_2364 344
153 3300049571 Ga0501034_0161858 Ga0501034_0161858_770_1855 344
154 3300049572 Ga0501036_0051494 Ga0501036_0051494_1518_2603 344
155 3300049573 Ga0501037_0259099 Ga0501037_0259099_37_1122 344
156 3300049574 Ga0501038_0021545 Ga0501038_0021545_3979_5064 344
157 3300049575 Ga0501039_0048789 Ga0501039_0048789_1357_2442 344
158 3300049579 Ga0501043_0046111 Ga0501043_0046111_1014_2099 344
159 3300049581 Ga0501047_0164656 Ga0501047_0164656_365_1450 344
160 3300049822 Ga0501035_0017774 Ga0501035_0017774_4262_5347 344
161 3300049823 Ga0501044_0163816 Ga0501044_0163816_749_1834 344
162 3300049824 Ga0501045_0196477 Ga0501045_0196477_349_1434 344
163 3300053077 Ga0495601_0014615 Ga0495601_0014615_260_1363 344
164 3300053078 Ga0495612_0072573 Ga0495612_0072573_41_1144 344
165 3300053107 Ga0500560_001303 Ga0500560_001303_2432_3523 344
166 3300053107 Ga0500560_016513 Ga0500560_016513_771_1853 344
167 3300053160 Ga0500633_0040881 Ga0500633_0040881_49_1140 344
168 iso_pu_bacteria 2508501039 2508671304 344
169 iso_pu_bacteria 2517572101 2517761907 344
170 iso_pu_bacteria 2643221681 2644457553 344
171 iso_pu_bacteria 2671180195 2671834620 344
172 iso_pu_bacteria 2675902999 2676202704 344
173 iso_pu_bacteria 2687453737 2689962881 344
174 iso_pu_bacteria 2773857921 2774847280 344
175 iso_pu_bacteria 2773857922 2774852776 344
176 iso_pu_bacteria 2786546132 2786666581 344
177 iso_pu_bacteria 2867346516 2867351432 344
178 iso_pu_bacteria 2895880812 2895889750 344
179 iso_pu_bacteria 2954673503 2954681672 344
180 iso_pu_bacteria 2954711539 2954711703 344
181 iso_pu_bacteria 2954721474 2954721624 344
182 iso_pu_bacteria 2954740390 2954740532 344
183 iso_pu_bacteria 2954749733 2954759028 344
184 iso_pu_bacteria 2954759201 2954759546 344
185 iso_pu_bacteria 2984576629 2984577606 344
186 iso_pu_bacteria 2990256926 2990259764 344
187 iso_pu_bacteria 8002784119 8002787073 344
188 3300031456 Ga0307513_10108513 Ga0307513_101085132 345
189 3300035119 Ga0373956_0001196 Ga0373956_0001196_9457_10515 345
190 3300046454 Ga0495592_0076056 Ga0495592_0076056_258_1355 345
191 3300046462 Ga0495651_0000556 Ga0495651_0000556_20718_21815 345
192 3300046463 Ga0495653_0173726 Ga0495653_0173726_46_1143 345
193 3300046473 Ga0495582_0092032 Ga0495582_0092032_282_1379 345
194 3300046476 Ga0495662_0001030 Ga0495662_0001030_12557_13654 345
195 3300046477 Ga0495664_0000412 Ga0495664_0000412_6998_8095 345
196 3300046506 Ga0495583_0012683 Ga0495583_0012683_3046_4161 345
197 3300046515 Ga0495620_0002266 Ga0495620_0002266_3685_4800 345
198 3300046516 Ga0495628_0207538 Ga0495628_0207538_315_1412 345
199 3300046522 Ga0495643_0001303 Ga0495643_0001303_16483_17598 345
200 3300046536 Ga0495587_0001237 Ga0495587_0001237_2382_3479 345
201 3300046542 Ga0495597_0016588 Ga0495597_0016588_2146_3261 345
202 3300046616 Ga0495668_0010826 Ga0495668_0010826_1122_2237 345
203 3300046642 Ga0495634_0000330 Ga0495634_0000330_23423_24520 345
204 3300046663 Ga0495635_0009717 Ga0495635_0009717_1549_2646 345
205 3300046675 Ga0495657_0001729 Ga0495657_0001729_12990_14087 345
206 3300046680 Ga0495646_0000919 Ga0495646_0000919_11185_12282 345
207 3300046689 Ga0495613_0039131 Ga0495613_0039131_569_1666 345
208 3300046689 Ga0495613_0051924 Ga0495613_0051924_1810_2916 345
209 3300046694 Ga0495649_0028923 Ga0495649_0028923_1633_2748 345
210 3300046794 Ga0495589_0015301 Ga0495589_0015301_1167_2282 345
211 3300046809 Ga0495600_0100564 Ga0495600_0100564_281_1378 345
212 3300046810 Ga0495660_0017589 Ga0495660_0017589_364_1479 345
213 3300047315 Ga0495581_0032338 Ga0495581_0032338_658_1755 345
214 3300047317 Ga0495604_0000648 Ga0495604_0000648_1929_3026 345
215 3300047321 Ga0495676_0002652 Ga0495676_0002652_7568_8641 345
216 3300047321 Ga0495676_0065859 Ga0495676_0065859_165_1262 345
217 3300047443 Ga0495687_017539 Ga0495687_017539_766_1881 345
218 3300047443 Ga0495687_034722 Ga0495687_034722_1167_2255 345
219 3300047447 Ga0495685_000830 Ga0495685_000830_1099_2214 345
220 3300047673 Ga0495593_0001621 Ga0495593_0001621_11703_12800 345
221 3300048088 Ga0495602_0013639 Ga0495602_0013639_1928_3025 345
222 3300048089 Ga0495614_0000459 Ga0495614_0000459_11871_12968 345
223 iso_pu_bacteria 2728369276 2729909802 345
224 iso_pu_bacteria 2751185792 2753327577 345
225 iso_pu_bacteria 2758568621 2760623779 345
226 iso_pu_bacteria 2857481737 2857484404 345
227 iso_pu_bacteria 2891326441 2891329867 345
228 iso_pu_bacteria 8002775197 8002776756 345
229 3300000549 LJQas_1000250 LJQas_10002509 346
230 iso_pu_bacteria 2643221604 2644036088 346
231 iso_pu_bacteria 2773857763 2774398088 346
232 iso_pu_bacteria 2977264416 2977265204 346
233 iso_pu_bacteria 2984523437 2984523833 346

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

176

340

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6utq-assembly1.cif.gz_E lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase in complex with cadmium 0.7992 242 289
5udr-assembly1.cif.gz_E lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase in complex with nicotinamide mononucleotid nmn 0.7751 238 289
4u0p-assembly1.cif.gz_B the crystal structure of lipoyl synthase in complex with s-adenosyl homocysteine 0.7572 96 288
5exi-assembly1.cif.gz_A crystal structure of m. tuberculosis lipoyl synthase at 2.28 a resolution 0.752 98 329
5exk-assembly6.cif.gz_K crystal structure of m. tuberculosis lipoyl synthase with 6-thiooctanoyl peptide intermediate 0.7386 101 297
ID Description Score Start End Superfamily
af_Q58214_34_265_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7679 155 323 3.20.20.70
3ciwA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7646 100 324 3.20.20.70
af_P9WK91_74_280_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7631 115 323 3.20.20.70
af_Q58826_3_356_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7618 102 324 3.20.20.70
af_Q58234_1_296_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7607 96 319 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2S6AYP2-F1-model_v4 Radical SAM protein 0.9913 170 257
AF-A0A1E5MIJ6-F1-model_v4 Radical SAM protein 0.984 37 346 GO:0044689
GO:0046872
GO:0051539
AF-A0A7K3NSA6-F1-model_v4 Radical SAM protein 0.9785 120 254 GO:0003824
GO:0051539
AF-A0A4Q4CKG4-F1-model_v4 Radical SAM protein 0.9764 219 346
AF-A0A7K1VIU5-F1-model_v4 MSMEG_0568 family radical SAM protein 0.9762 4 346 GO:0044689
GO:0046872
GO:0051539

Feature Viewer

pLDDT pTM Quality
88.4 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map