F346611

General Info

Members Datasets Scaffolds Average Seq Length
233 187 466 244

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2868088558|2868095055
Length 284
Sequence TNVQHRGVAAGGGNRLGPHGGERPTRRSGFVWNLADAWVLIGRSMRHTVRNGDALFMGVFLPVMLLLLFVYVFGGALEEGIAQFDYVNYVVPGVILLTAGFSAATTAVSVTTDMTTGVMDRFRSLPITNWIVVFGHVVASLVRNLFSTALVVGVALIIGFRPTGNVLDWVAAVGVISLFILMMTWLSVMFGLIAKTPDAASGFTFFILFLPYMSSAFVPVETMPAVLRGFAEHQPITPIIETVRGLLMGTPIGDSGWLAVAWSVGVLIIVAPISARLFRSRTAS

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
107 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
115 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
116 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
117 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
118 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
119 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
120 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
123 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
124 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
148 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
160 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
161 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
162 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
163 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
164 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
165 2643221572 Leifsonia sp. Root60 Isolate Unclassified
166 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
167 2643221692 Nocardia sp. Root136 Isolate Unclassified
168 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
169 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
170 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
171 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
172 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
173 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
174 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
175 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
176 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
177 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
178 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
179 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
180 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
181 2922554459 Rhodococcus sp. 66b Isolate Unclassified
182 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
183 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
184 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
185 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
186 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
187 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.12
Metatranscriptomes 1.72
Isolates 11.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3
Nodule 0
Rhizoplane 15.45
Rhizosphere 66.95
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10011880 3300001979 Bacteria 3303
2 Ga0006562J51391_1184623 3300003578 Bacteria 3730
3 Ga0006562J51391_1184624 3300003578 Bacteria 3730
4 Ga0070676_10059121 3300005328 Bacteria 2273
5 Ga0068869_100046052 3300005334 Bacteria 3143
6 Ga0070682_100048869 3300005337 Bacteria 2636
7 Ga0068868_100031663 3300005338 Bacteria 4065
8 Ga0070689_100049293 3300005340 Bacteria 3251
9 Ga0070691_10006797 3300005341 Bacteria 5230
10 Ga0070692_10012729 3300005345 Bacteria 3905
11 Ga0070675_100037869 3300005354 Bacteria 3930
12 Ga0070671_100006984 3300005355 Bacteria 9043
13 Ga0070688_100176614 3300005365 Bacteria 1478
14 Ga0070659_100035723 3300005366 Bacteria 3871
15 Ga0070714_100423669 3300005435 Bacteria 1261
16 Ga0070663_100027655 3300005455 Bacteria 3853
17 Ga0070678_100017483 3300005456 Bacteria 4619
18 Ga0070678_100075868 3300005456 Bacteria 2531
19 Ga0070678_100091206 3300005456 Bacteria 2338
20 Ga0070662_100284560 3300005457 Bacteria 1339
21 Ga0070681_10038766 3300005458 Bacteria 4777
22 Ga0070679_100125907 3300005530 Bacteria 2544
23 Ga0070684_100100699 3300005535 Bacteria 2580
24 Ga0068853_100377266 3300005539 Bacteria 1324
25 Ga0070672_100114379 3300005543 Bacteria 2203
26 Ga0070693_100000564 3300005547 Bacteria 16415
27 Ga0070665_100658691 3300005548 Bacteria 1060
28 Ga0070664_100059287 3300005564 Bacteria 3256
29 Ga0070702_100081873 3300005615 Bacteria 1935
30 Ga0068852_100079464 3300005616 Bacteria 2905
31 Ga0068864_100092167 3300005618 Bacteria 2674
32 Ga0068864_100383095 3300005618 Bacteria 1333
33 Ga0068851_10003765 3300005834 Bacteria 6783
34 Ga0068870_10001665 3300005840 Bacteria 9091
35 Ga0068863_100008916 3300005841 Bacteria 9793
36 Ga0068858_100157264 3300005842 Bacteria 2139
37 Ga0068860_100215348 3300005843 Bacteria 1864
38 Ga0081455_10043101 3300005937 Bacteria 3952
39 Ga0081540_1070273 3300005983 Bacteria 1622
40 Ga0075365_10110123 3300006038 Bacteria 1892
41 Ga0097621_100036002 3300006237 Bacteria 3957
42 Ga0075370_10028887 3300006353 Bacteria 3085
43 Ga0068871_100074320 3300006358 Bacteria 2803
44 Ga0075428_100133566 3300006844 Bacteria 2698
45 Ga0075428_100343443 3300006844 Bacteria 1603
46 Ga0075434_100003458 3300006871 Bacteria 14113
47 Ga0075436_100003669 3300006914 Bacteria 10516
48 Ga0075435_100012806 3300007076 Bacteria 6215
49 Ga0111539_10057457 3300009094 Bacteria 4620
50 Ga0105245_10016800 3300009098 Bacteria 6390
51 Ga0105245_10108060 3300009098 Bacteria 2583
52 Ga0105247_10048457 3300009101 Bacteria 2609
53 Ga0105243_10000832 3300009148 Bacteria 29323
54 Ga0105243_10614655 3300009148 Bacteria 1048
55 Ga0105243_10714886 3300009148 Bacteria 978
56 Ga0105241_10014402 3300009174 Bacteria 5790
57 Ga0105237_10031021 3300009545 Bacteria 5421
58 Ga0105238_10223352 3300009551 Bacteria 1860
59 Ga0105246_10002841 3300011119 Bacteria 10494
60 Ga0157373_10127034 3300013100 Bacteria 1793
61 Ga0157374_10432259 3300013296 Bacteria 1316
62 Ga0163162_10027334 3300013306 Bacteria 5641
63 Ga0163162_10058679 3300013306 Bacteria 3878
64 Ga0163162_10373622 3300013306 Bacteria 1559
65 Ga0157372_10087178 3300013307 Bacteria 3541
66 Ga0157375_10055570 3300013308 Bacteria 3904
67 Ga0157375_10356558 3300013308 Bacteria 1629
68 Ga0163163_10182527 3300014325 Bacteria 2146
69 Ga0182008_10008277 3300014497 Bacteria 5683
70 Ga0157377_10005047 3300014745 Bacteria 6163
71 Ga0157379_10059392 3300014968 Bacteria 3419
72 Ga0163161_10198012 3300017792 Bacteria 1547
73 Ga0206354_11022891 3300020081 Bacteria 1199
74 Ga0209784_100393 3300025224 Bacteria 19953
75 Ga0209675_1028824 3300025291 Unclassified 1344
76 Ga0209025_1011703 3300025294 Bacteria 5734
77 Ga0207710_10053926 3300025900 Bacteria 1810
78 Ga0207688_10008192 3300025901 Bacteria 5680
79 Ga0207688_10057644 3300025901 Bacteria 2184
80 Ga0207647_10146965 3300025904 Bacteria 1379
81 Ga0207643_10000152 3300025908 Bacteria 47517
82 Ga0207705_10002423 3300025909 Bacteria 14401
83 Ga0207660_10043004 3300025917 Bacteria 3173
84 Ga0207657_10215107 3300025919 Bacteria 1541
85 Ga0207650_10002928 3300025925 Bacteria 11773
86 Ga0207659_10011995 3300025926 Bacteria 5492
87 Ga0207687_10092404 3300025927 Bacteria 2210
88 Ga0207644_10004462 3300025931 Bacteria 9086
89 Ga0207706_10109127 3300025933 Bacteria 2435
90 Ga0207709_10376313 3300025935 Bacteria 1079
91 Ga0207670_10139831 3300025936 Bacteria 1784
92 Ga0207691_10163470 3300025940 Bacteria 1952
93 Ga0207711_10144775 3300025941 Bacteria 2140
94 Ga0207689_10006709 3300025942 Bacteria 10154
95 Ga0207661_10011302 3300025944 Bacteria 6462
96 Ga0207679_10003066 3300025945 Bacteria 10350
97 Ga0207679_10500294 3300025945 Bacteria 1084
98 Ga0207667_10241950 3300025949 Bacteria 1846
99 Ga0207712_10497561 3300025961 Bacteria 1041
100 Ga0207677_10023268 3300026023 Bacteria 3824
101 Ga0207703_10016835 3300026035 Bacteria 5702
102 Ga0207639_10057915 3300026041 Bacteria 2978
103 Ga0207678_10002623 3300026067 Bacteria 16379
104 Ga0207708_10007726 3300026075 Bacteria 7963
105 Ga0207702_10000816 3300026078 Bacteria 32949
106 Ga0207641_10034828 3300026088 Bacteria 4190
107 Ga0207676_10001605 3300026095 Bacteria 16645
108 Ga0207676_10121847 3300026095 Bacteria 2201
109 Ga0207676_10591533 3300026095 Bacteria 1065
110 Ga0207674_10015058 3300026116 Bacteria 8518
111 Ga0207675_100148194 3300026118 Bacteria 2232
112 Ga0207683_10000130 3300026121 Bacteria 61549
113 Ga0207683_10045605 3300026121 Bacteria 3834
114 Ga0207683_10288966 3300026121 Bacteria 1499
115 Ga0207698_10011160 3300026142 Bacteria 5812
116 Ga0207428_10069790 3300027907 Bacteria 2763
117 Ga0268264_10189248 3300028381 Bacteria 1875
118 Ga0265328_10130277 3300031239 Bacteria 941
119 Ga0307513_10019616 3300031456 Bacteria 8044
120 Ga0307514_10004352 3300031649 Bacteria 13052
121 Ga0307405_10501769 3300031731 Bacteria 973
122 Ga0307411_10191313 3300032005 Bacteria 1563
123 Ga0307507_10086863 3300033179 Bacteria 2708
124 Ga0373962_0080499 3300035242 Bacteria 988
125 Ga0373931_0149494 3300035691 Bacteria 1360
126 Ga0372808_016064 3300036459 Bacteria 1072
127 Ga0395899_0029415 3300037312 Bacteria 4131
128 Ga0395899_0209361 3300037312 Bacteria 1356
129 Ga0395900_0378111 3300037418 Bacteria 1385
130 Ga0395900_0764837 3300037418 Bacteria 896
131 Ga0395898_0030928 3300037466 Bacteria 5354
132 Ga0395898_0122842 3300037466 Bacteria 2488
133 Ga0436364_0289171 3300037853 Bacteria 2053
134 Ga0451791_1142721 3300041451 Bacteria 5240
135 Ga0451800_1041640 3300041459 Bacteria 1795
136 Ga0451833_1332668 3300041491 Bacteria 2642
137 Ga0451833_1391804 3300041491 Bacteria 941
138 Ga0451837_0562296 3300041494 Bacteria 2660
139 Ga0451839_0659711 3300041496 Bacteria 1381
140 Ga0451849_0413098 3300041505 Bacteria 1821
141 Ga0451843_1697780 3300041509 Bacteria 1580
142 Ga0451853_0287078 3300041512 Bacteria 6798
143 Ga0451853_0925176 3300041512 Bacteria 1430
144 Ga0439449_0030826 3300042007 Bacteria 1999
145 Ga0439463_014260 3300042016 Bacteria 1958
146 Ga0439459_0008229 3300042438 Bacteria 1778
147 Ga0466965_0033416 3300044683 Bacteria 2514
148 Ga0466964_0088502 3300044706 Bacteria 1343
149 Ga0466964_0140402 3300044706 Bacteria 1110
150 Ga0466970_0402004 3300044765 Bacteria 782
151 Ga0466967_0079633 3300045976 Bacteria 2954
152 Ga0466967_0168929 3300045976 Bacteria 2057
153 Ga0466967_0445671 3300045976 Bacteria 1265
154 Ga0495641_0115176 3300046461 Bacteria 1199
155 Ga0495608_0147325 3300046511 Bacteria 1501
156 Ga0495668_0013289 3300046616 Bacteria 4862
157 Ga0495674_0125715 3300047319 Bacteria 2164
158 Ga0495686_0108913 3300047472 Bacteria 1663
159 Ga0496102_0011551 3300048905 Bacteria 7620
160 Ga0496102_0292956 3300048905 Bacteria 1534
161 Ga0496102_0295957 3300048905 Bacteria 1525
162 Ga0496102_0358550 3300048905 Bacteria 1373
163 Ga0496103_0175403 3300048906 Bacteria 1377
164 Ga0496103_0382024 3300048906 Bacteria 905
165 Ga0496104_0028868 3300048907 Bacteria 5143
166 Ga0496104_0213850 3300048907 Bacteria 1839
167 Ga0496105_0001353 3300048908 Bacteria 17215
168 Ga0496106_0329587 3300048909 Bacteria 1225
169 Ga0496108_0026213 3300048911 Bacteria 4807
170 Ga0496108_0104159 3300048911 Bacteria 2421
171 Ga0496109_0000916 3300048912 Bacteria 24532
172 Ga0496109_0017290 3300048912 Bacteria 6316
173 Ga0496109_0032540 3300048912 Bacteria 4688
174 Ga0496109_0280015 3300048912 Bacteria 1572
175 Ga0496109_0466687 3300048912 Bacteria 1192
176 Ga0496110_0000708 3300048913 Bacteria 23057
177 Ga0496110_0101712 3300048913 Bacteria 2577
178 Ga0496110_0147926 3300048913 Bacteria 2125
179 Ga0496111_0000105 3300048914 Bacteria 36551
180 Ga0496111_0131294 3300048914 Bacteria 1853
181 Ga0496112_0113853 3300048915 Bacteria 2676
182 Ga0496112_0140286 3300048915 Bacteria 2386
183 Ga0496113_0005529 3300048916 Bacteria 7889
184 Ga0496113_0015950 3300048916 Bacteria 5180
185 Ga0496113_0198901 3300048916 Bacteria 1593
186 Ga0496114_0012965 3300048917 Bacteria 6680
187 Ga0496114_0037813 3300048917 Bacteria 3993
188 Ga0496114_0102099 3300048917 Bacteria 2450
189 Ga0496114_0212714 3300048917 Bacteria 1696
190 Ga0496114_0470311 3300048917 Bacteria 1112
191 Ga0496115_0124936 3300048918 Bacteria 2119
192 Ga0496115_0209218 3300048918 Bacteria 1611
193 Ga0496124_0371973 3300048927 Bacteria 1003
194 Ga0496125_0022977 3300048928 Bacteria 5775
195 Ga0501033_0032607 3300049570 Bacteria 3912
196 Ga0501034_0112651 3300049571 Bacteria 2710
197 Ga0501043_0439184 3300049579 Bacteria 982
198 Ga0501047_0330528 3300049581 Bacteria 1363
199 Ga0501048_0393843 3300049582 Bacteria 990
200 nmdc:mga09592_197817_c1 3300050508 Bacteria 1740
201 nmdc:mga08y16_159368_c1 3300050511 Bacteria 2345
202 nmdc:mga0n895_332759_c1 3300050512 Bacteria 1539
203 nmdc:mga0rr50_32605_c1 3300050513 Bacteria 3714
204 nmdc:mga08x19_1085_c1 3300050514 Bacteria 16966
205 Ga0495595_0157354 3300053084 Bacteria 1120
206 Ga0500568_0000727 3300053139 Bacteria 23611
207 Ga0500616_0001025 3300053153 Bacteria 29646
208 2868095055 2868088558 Bacteria 7609351
209 2566995559 2565956761 Bacteria 6601618
210 2616901886 2616644941 Bacteria 8510691
211 2643874729 2643221572 Bacteria 3614809
212 2644381785 2643221669 Bacteria 3611286
213 2644517055 2643221692 Bacteria 7282860
214 2712198417 2711768088 Bacteria 3195027
215 2738888493 2738541308 Bacteria 7020677
216 2739203280 2738543005 Bacteria 5278128
217 2739237420 2738543011 Bacteria 5731169
218 2774398329 2773857763 Bacteria 4180068
219 2857457284 2857453340 Bacteria 8090534
220 2861522102 2861520306 Bacteria 8348283
221 2862297024 2862290372 Bacteria 7471434
222 2862509445 2862507626 Bacteria 9425308
223 2889302562 2889300758 Bacteria 5690814
224 2895662896 2895660088 Bacteria 3782833
225 2904537825 2904535858 Bacteria 6308016
226 2919057460 2919055335 Bacteria 3875751
227 2922557015 2922554459 Bacteria 6683962
228 2928142494 2928142448 Bacteria 5288925
229 2939748443 2939743619 Bacteria 5762299
230 2971415698 2971410472 Bacteria 8311090
231 8055179183 8055172936 Bacteria 9305943
232 8056211430 8056207758 Bacteria 8639239
233 8056537560 8056533031 Bacteria 8964429
234 JGI24740J21852_10011880
235 Ga0006562J51391_1184623
236 Ga0006562J51391_1184624
237 Ga0070676_10059121
238 Ga0068869_100046052
239 Ga0070682_100048869
240 Ga0068868_100031663
241 Ga0070689_100049293
242 Ga0070691_10006797
243 Ga0070692_10012729
244 Ga0070675_100037869
245 Ga0070671_100006984
246 Ga0070688_100176614
247 Ga0070659_100035723
248 Ga0070714_100423669
249 Ga0070663_100027655
250 Ga0070678_100017483
251 Ga0070678_100075868
252 Ga0070678_100091206
253 Ga0070662_100284560
254 Ga0070681_10038766
255 Ga0070679_100125907
256 Ga0070684_100100699
257 Ga0068853_100377266
258 Ga0070672_100114379
259 Ga0070693_100000564
260 Ga0070665_100658691
261 Ga0070664_100059287
262 Ga0070702_100081873
263 Ga0068852_100079464
264 Ga0068864_100092167
265 Ga0068864_100383095
266 Ga0068851_10003765
267 Ga0068870_10001665
268 Ga0068863_100008916
269 Ga0068858_100157264
270 Ga0068860_100215348
271 Ga0081455_10043101
272 Ga0081540_1070273
273 Ga0075365_10110123
274 Ga0097621_100036002
275 Ga0075370_10028887
276 Ga0068871_100074320
277 Ga0075428_100133566
278 Ga0075428_100343443
279 Ga0075434_100003458
280 Ga0075436_100003669
281 Ga0075435_100012806
282 Ga0111539_10057457
283 Ga0105245_10016800
284 Ga0105245_10108060
285 Ga0105247_10048457
286 Ga0105243_10000832
287 Ga0105243_10614655
288 Ga0105243_10714886
289 Ga0105241_10014402
290 Ga0105237_10031021
291 Ga0105238_10223352
292 Ga0105246_10002841
293 Ga0157373_10127034
294 Ga0157374_10432259
295 Ga0163162_10027334
296 Ga0163162_10058679
297 Ga0163162_10373622
298 Ga0157372_10087178
299 Ga0157375_10055570
300 Ga0157375_10356558
301 Ga0163163_10182527
302 Ga0182008_10008277
303 Ga0157377_10005047
304 Ga0157379_10059392
305 Ga0163161_10198012
306 Ga0206354_11022891
307 Ga0209784_100393
308 Ga0209675_1028824
309 Ga0209025_1011703
310 Ga0207710_10053926
311 Ga0207688_10008192
312 Ga0207688_10057644
313 Ga0207647_10146965
314 Ga0207643_10000152
315 Ga0207705_10002423
316 Ga0207660_10043004
317 Ga0207657_10215107
318 Ga0207650_10002928
319 Ga0207659_10011995
320 Ga0207687_10092404
321 Ga0207644_10004462
322 Ga0207706_10109127
323 Ga0207709_10376313
324 Ga0207670_10139831
325 Ga0207691_10163470
326 Ga0207711_10144775
327 Ga0207689_10006709
328 Ga0207661_10011302
329 Ga0207679_10003066
330 Ga0207679_10500294
331 Ga0207667_10241950
332 Ga0207712_10497561
333 Ga0207677_10023268
334 Ga0207703_10016835
335 Ga0207639_10057915
336 Ga0207678_10002623
337 Ga0207708_10007726
338 Ga0207702_10000816
339 Ga0207641_10034828
340 Ga0207676_10001605
341 Ga0207676_10121847
342 Ga0207676_10591533
343 Ga0207674_10015058
344 Ga0207675_100148194
345 Ga0207683_10000130
346 Ga0207683_10045605
347 Ga0207683_10288966
348 Ga0207698_10011160
349 Ga0207428_10069790
350 Ga0268264_10189248
351 Ga0265328_10130277
352 Ga0307513_10019616
353 Ga0307514_10004352
354 Ga0307405_10501769
355 Ga0307411_10191313
356 Ga0307507_10086863
357 Ga0373962_0080499
358 Ga0373931_0149494
359 Ga0372808_016064
360 Ga0395899_0029415
361 Ga0395899_0209361
362 Ga0395900_0378111
363 Ga0395900_0764837
364 Ga0395898_0030928
365 Ga0395898_0122842
366 Ga0436364_0289171
367 Ga0451791_1142721
368 Ga0451800_1041640
369 Ga0451833_1332668
370 Ga0451833_1391804
371 Ga0451837_0562296
372 Ga0451839_0659711
373 Ga0451849_0413098
374 Ga0451843_1697780
375 Ga0451853_0287078
376 Ga0451853_0925176
377 Ga0439449_0030826
378 Ga0439463_014260
379 Ga0439459_0008229
380 Ga0466965_0033416
381 Ga0466964_0088502
382 Ga0466964_0140402
383 Ga0466970_0402004
384 Ga0466967_0079633
385 Ga0466967_0168929
386 Ga0466967_0445671
387 Ga0495641_0115176
388 Ga0495608_0147325
389 Ga0495668_0013289
390 Ga0495674_0125715
391 Ga0495686_0108913
392 Ga0496102_0011551
393 Ga0496102_0292956
394 Ga0496102_0295957
395 Ga0496102_0358550
396 Ga0496103_0175403
397 Ga0496103_0382024
398 Ga0496104_0028868
399 Ga0496104_0213850
400 Ga0496105_0001353
401 Ga0496106_0329587
402 Ga0496108_0026213
403 Ga0496108_0104159
404 Ga0496109_0000916
405 Ga0496109_0017290
406 Ga0496109_0032540
407 Ga0496109_0280015
408 Ga0496109_0466687
409 Ga0496110_0000708
410 Ga0496110_0101712
411 Ga0496110_0147926
412 Ga0496111_0000105
413 Ga0496111_0131294
414 Ga0496112_0113853
415 Ga0496112_0140286
416 Ga0496113_0005529
417 Ga0496113_0015950
418 Ga0496113_0198901
419 Ga0496114_0012965
420 Ga0496114_0037813
421 Ga0496114_0102099
422 Ga0496114_0212714
423 Ga0496114_0470311
424 Ga0496115_0124936
425 Ga0496115_0209218
426 Ga0496124_0371973
427 Ga0496125_0022977
428 Ga0501033_0032607
429 Ga0501034_0112651
430 Ga0501043_0439184
431 Ga0501047_0330528
432 Ga0501048_0393843
433 nmdc:mga09592_197817_c1
434 nmdc:mga08y16_159368_c1
435 nmdc:mga0n895_332759_c1
436 nmdc:mga0rr50_32605_c1
437 nmdc:mga08x19_1085_c1
438 Ga0495595_0157354
439 Ga0500568_0000727
440 Ga0500616_0001025
441 2868095055
442 2566995559
443 2616901886
444 2643874729
445 2644381785
446 2644517055
447 2712198417
448 2738888493
449 2739203280
450 2739237420
451 2774398329
452 2857457284
453 2861522102
454 2862297024
455 2862509445
456 2889302562
457 2895662896
458 2904537825
459 2919057460
460 2922557015
461 2928142494
462 2939748443
463 2971415698
464 8055179183
465 8056211430
466 8056537560

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

35

248

0.9

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

81

278

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e7q-assembly1.cif.gz_A cryo-em structure of human abca4 in atp-bound state 0.7379 81 268
7fdv-assembly1.cif.gz_D cryo-em structure of the human cholesterol transporter abcg1 in complex with cholesterol 0.7277 30 269
8wbx-assembly1.cif.gz_B cryo-em structure of the abcg25 bound to aba 0.7195 30 273
7r8c-assembly1.cif.gz_B the structure of human abcg1 0.7159 22 274
7r88-assembly1.cif.gz_A the structure of human abcg5-i529w/abcg8-wt 0.7097 28 274
ID Description Score Start End Superfamily
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8645 79 266 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8505 79 266 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8281 81 267 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6042 79 266 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.598 79 266 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A6G4U594-F1-model_v4 Transport permease protein 0.9688 30 276 GO:0043190
GO:0140359
AF-A0A2B6RJH6-F1-model_v4 ABC transporter 0.9684 92 273 GO:0016020
GO:0140359
AF-A0A7K1I8H2-F1-model_v4 deleted 0.9682 30 276
AF-A0A5P9PVE6-F1-model_v4 Transport permease protein 0.9655 29 276 GO:0043190
GO:0140359
AF-A0A543B040-F1-model_v4 Transport permease protein 0.9654 28 276 GO:0043190
GO:0140359

Map