F346241

General Info

Members Datasets Scaffolds Average Seq Length
233 119 466 210

Family's Representative Sequence

Representative Sequence 3300031903|Ga0307407_10104867|Ga0307407_101048672
Length 213
Sequence VPRVRVHQHVNPLAPFYRQAPRAIDLAADFVDPNLPLHLDIGCARGRFILRMAEHEPKWNFLGVEIREPLVIEANRIAEEKGLAGNLHYEFCNAMLWLDRLLQDIPDGILQMVTIQFPDPWFKKKHAKRRMVNAELINAILNRLAVDGRIFVQTDIEPLADEMFGLFRERRELVEIAIDENPFPTKTERERAVEDKGLPVYRAMFAISSFSPS

Samples

Sample ID Description Type Environment
1 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
104 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
111 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
112 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
113 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
114 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
115 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
116 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
119 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 1.29
Rhizosphere 97.85
Stem 0
Stem Tuber 0
Unclassified 22.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307407_10104867 3300031903 Unclassified 1763
2 Ga0065707_10086777 3300005295 Bacteria 5309
3 Ga0070676_10142081 3300005328 Unclassified 1529
4 Ga0070683_100585525 3300005329 Bacteria 1067
5 Ga0070670_100030662 3300005331 Bacteria 4631
6 Ga0070670_100031407 3300005331 Bacteria 4573
7 Ga0070670_100071465 3300005331 Bacteria 2979
8 Ga0070670_100586032 3300005331 Bacteria 997
9 Ga0070677_10468401 3300005333 Unclassified 677
10 Ga0070680_100117762 3300005336 Bacteria 2215
11 Ga0068868_100155481 3300005338 Bacteria 1886
12 Ga0068868_100553415 3300005338 Unclassified 1014
13 Ga0068868_100971665 3300005338 Unclassified 775
14 Ga0070689_100644818 3300005340 Bacteria 921
15 Ga0070687_100540656 3300005343 Bacteria 791
16 Ga0070661_100092000 3300005344 Bacteria 2246
17 Ga0070661_100335524 3300005344 Bacteria 1183
18 Ga0070661_100413763 3300005344 Unclassified 1068
19 Ga0070668_100979834 3300005347 Bacteria 759
20 Ga0070675_100441352 3300005354 Bacteria 1166
21 Ga0070671_100048709 3300005355 Bacteria 3524
22 Ga0070671_100519452 3300005355 Bacteria 1025
23 Ga0070674_100873890 3300005356 Unclassified 781
24 Ga0070673_100641216 3300005364 Bacteria 972
25 Ga0070688_100015481 3300005365 Bacteria 4341
26 Ga0070688_100302853 3300005365 Bacteria 1156
27 Ga0070659_100044449 3300005366 Bacteria 3478
28 Ga0070667_100271880 3300005367 Unclassified 1520
29 Ga0070667_100680524 3300005367 Bacteria 951
30 Ga0070662_100660997 3300005457 Unclassified 882
31 Ga0070681_10179867 3300005458 Bacteria 2036
32 Ga0068867_100313078 3300005459 Bacteria 1298
33 Ga0068867_100557790 3300005459 Bacteria 993
34 Ga0070685_10618961 3300005466 Bacteria 781
35 Ga0070679_100035590 3300005530 Bacteria 4940
36 Ga0068853_100010171 3300005539 Bacteria 7601
37 Ga0070672_100141935 3300005543 Unclassified 1982
38 Ga0070686_100286019 3300005544 Bacteria 1218
39 Ga0068855_100887918 3300005563 Bacteria 942
40 Ga0070664_100005808 3300005564 Bacteria 9953
41 Ga0070664_100469599 3300005564 Bacteria 1157
42 Ga0070664_100876196 3300005564 Unclassified 841
43 Ga0070702_100187934 3300005615 Bacteria 1357
44 Ga0068859_100019979 3300005617 Bacteria 6725
45 Ga0068859_100071654 3300005617 Bacteria 3501
46 Ga0068864_100020397 3300005618 Bacteria 5544
47 Ga0068864_100039476 3300005618 Bacteria 4035
48 Ga0068864_100254010 3300005618 Bacteria 1633
49 Ga0068851_10020593 3300005834 Bacteria 3195
50 Ga0068851_10424397 3300005834 Bacteria 786
51 Ga0068858_100335511 3300005842 Bacteria 1446
52 Ga0068860_100014987 3300005843 Bacteria 7576
53 Ga0068860_100045576 3300005843 Bacteria 4182
54 Ga0068860_100067844 3300005843 Bacteria 3388
55 Ga0068862_100041891 3300005844 Bacteria 3898
56 Ga0068862_100166743 3300005844 Bacteria 1969
57 Ga0068862_100302850 3300005844 Bacteria 1471
58 Ga0068862_100394591 3300005844 Unclassified 1293
59 Ga0068862_100972000 3300005844 Unclassified 838
60 Ga0097621_100364787 3300006237 Bacteria 1287
61 Ga0068871_100066362 3300006358 Bacteria 2958
62 Ga0075434_101178594 3300006871 Unclassified 778
63 Ga0068865_100054130 3300006881 Bacteria 2787
64 Ga0097620_100019980 3300006931 Bacteria 6725
65 Ga0097620_100071657 3300006931 Bacteria 3501
66 Ga0105240_10249335 3300009093 Unclassified 2054
67 Ga0111539_10095197 3300009094 Bacteria 3498
68 Ga0111539_10697168 3300009094 Unclassified 1182
69 Ga0105245_10521956 3300009098 Bacteria 1206
70 Ga0105247_10006670 3300009101 Bacteria 7126
71 Ga0105247_10249853 3300009101 Bacteria 1212
72 Ga0105241_10061458 3300009174 Bacteria 2893
73 Ga0105242_10035040 3300009176 Bacteria 4024
74 Ga0105242_11095639 3300009176 Unclassified 810
75 Ga0105248_10318762 3300009177 Bacteria 1751
76 Ga0105249_10014909 3300009553 Bacteria 6876
77 Ga0105249_10020386 3300009553 Bacteria 5928
78 Ga0105249_10069119 3300009553 Unclassified 3259
79 Ga0105249_10139005 3300009553 Unclassified 2327
80 Ga0105249_10745430 3300009553 Unclassified 1041
81 Ga0105239_11042703 3300010375 Bacteria 941
82 Ga0157370_10345753 3300013104 Bacteria 1371
83 Ga0157369_10224250 3300013105 Bacteria 1966
84 Ga0157378_10026388 3300013297 Bacteria 5121
85 Ga0157378_10117393 3300013297 Bacteria 2448
86 Ga0163162_10041123 3300013306 Unclassified 4624
87 Ga0163162_10048596 3300013306 Unclassified 4251
88 Ga0163162_10061759 3300013306 Bacteria 3785
89 Ga0163162_10217900 3300013306 Unclassified 2039
90 Ga0163162_10394044 3300013306 Bacteria 1517
91 Ga0163162_11332746 3300013306 Bacteria 816
92 Ga0157375_10241129 3300013308 Bacteria 1967
93 Ga0157375_10402422 3300013308 Bacteria 1535
94 Ga0157375_11714189 3300013308 Bacteria 744
95 Ga0163163_10042275 3300014325 Bacteria 4463
96 Ga0163163_10090343 3300014325 Bacteria 3076
97 Ga0163163_10094573 3300014325 Bacteria 3007
98 Ga0163163_10150899 3300014325 Bacteria 2368
99 Ga0157380_10043228 3300014326 Bacteria 3526
100 Ga0157380_11126400 3300014326 Bacteria 825
101 Ga0157377_10144585 3300014745 Bacteria 1465
102 Ga0157379_10441433 3300014968 Bacteria 1200
103 Ga0163161_10000761 3300017792 Bacteria 25344
104 Ga0163161_10295607 3300017792 Bacteria 1274
105 Ga0207697_10247771 3300025315 Bacteria 788
106 Ga0207710_10002405 3300025900 Bacteria 8728
107 Ga0207680_10206037 3300025903 Bacteria 1342
108 Ga0207645_10061179 3300025907 Bacteria 2405
109 Ga0207705_10009631 3300025909 Bacteria 7025
110 Ga0207707_10133333 3300025912 Unclassified 2173
111 Ga0207695_10241884 3300025913 Bacteria 1706
112 Ga0207650_10024878 3300025925 Bacteria 4262
113 Ga0207650_10128122 3300025925 Bacteria 1983
114 Ga0207659_10026299 3300025926 Bacteria 3925
115 Ga0207644_10519756 3300025931 Bacteria 983
116 Ga0207644_10665636 3300025931 Bacteria 867
117 Ga0207690_10034950 3300025932 Bacteria 3241
118 Ga0207706_10601895 3300025933 Unclassified 944
119 Ga0207706_10826607 3300025933 Unclassified 786
120 Ga0207670_10624358 3300025936 Bacteria 886
121 Ga0207670_10799566 3300025936 Bacteria 786
122 Ga0207669_10717291 3300025937 Unclassified 823
123 Ga0207704_10021629 3300025938 Bacteria 3430
124 Ga0207704_10903049 3300025938 Unclassified 743
125 Ga0207691_10088398 3300025940 Bacteria 2779
126 Ga0207691_10155662 3300025940 Bacteria 2007
127 Ga0207711_10003196 3300025941 Bacteria 14292
128 Ga0207689_10866506 3300025942 Bacteria 762
129 Ga0207679_10119481 3300025945 Unclassified 2095
130 Ga0207679_10149090 3300025945 Bacteria 1901
131 Ga0207679_10300357 3300025945 Bacteria 1384
132 Ga0207712_10005202 3300025961 Bacteria 8231
133 Ga0207712_10009019 3300025961 Bacteria 6310
134 Ga0207712_10017755 3300025961 Bacteria 4626
135 Ga0207712_10151550 3300025961 Unclassified 1791
136 Ga0207712_10174197 3300025961 Unclassified 1684
137 Ga0207712_10591618 3300025961 Unclassified 959
138 Ga0207658_10219328 3300025986 Bacteria 1599
139 Ga0207677_10053170 3300026023 Bacteria 2755
140 Ga0207678_10099109 3300026067 Unclassified 2489
141 Ga0207641_10036108 3300026088 Unclassified 4124
142 Ga0207641_10102680 3300026088 Bacteria 2521
143 Ga0207648_10338725 3300026089 Bacteria 1354
144 Ga0207648_11038803 3300026089 Unclassified 768
145 Ga0207676_10050440 3300026095 Unclassified 3244
146 Ga0207676_10060144 3300026095 Bacteria 3003
147 Ga0207676_10083715 3300026095 Bacteria 2599
148 Ga0207674_10169166 3300026116 Unclassified 2139
149 Ga0207674_10278607 3300026116 Bacteria 1620
150 Ga0207674_10578937 3300026116 Unclassified 1084
151 Ga0207683_10319800 3300026121 Bacteria 1421
152 Ga0268265_10186061 3300028380 Bacteria 1789
153 Ga0268265_10489406 3300028380 Unclassified 1157
154 Ga0268265_10603951 3300028380 Unclassified 1049
155 Ga0268264_10001440 3300028381 Bacteria 22259
156 Ga0307408_100016575 3300031548 Bacteria 4921
157 Ga0307408_100051786 3300031548 Bacteria 2959
158 Ga0307408_100149773 3300031548 Bacteria 1841
159 Ga0307408_100213410 3300031548 Bacteria 1570
160 Ga0307408_100335651 3300031548 Bacteria 1278
161 Ga0307405_10009932 3300031731 Bacteria 4903
162 Ga0307405_10067341 3300031731 Bacteria 2287
163 Ga0307405_10115093 3300031731 Bacteria 1829
164 Ga0307405_10508910 3300031731 Bacteria 967
165 Ga0307405_10599550 3300031731 Unclassified 899
166 Ga0307413_10009070 3300031824 Bacteria 4737
167 Ga0307413_10009131 3300031824 Bacteria 4727
168 Ga0307413_10023065 3300031824 Bacteria 3367
169 Ga0307413_10079554 3300031824 Bacteria 2096
170 Ga0307413_10200520 3300031824 Bacteria 1441
171 Ga0307413_10480453 3300031824 Unclassified 993
172 Ga0307413_10738949 3300031824 Bacteria 821
173 Ga0307410_10012011 3300031852 Bacteria 4984
174 Ga0307410_10090040 3300031852 Bacteria 2175
175 Ga0307410_10480767 3300031852 Bacteria 1019
176 Ga0307410_10772111 3300031852 Bacteria 815
177 Ga0307406_10017425 3300031901 Bacteria 4181
178 Ga0307406_10047421 3300031901 Bacteria 2708
179 Ga0307406_10073269 3300031901 Bacteria 2251
180 Ga0307406_10121229 3300031901 Bacteria 1819
181 Ga0307406_11086259 3300031901 Unclassified 690
182 Ga0307407_10003195 3300031903 Bacteria 6646
183 Ga0307407_10005877 3300031903 Bacteria 5382
184 Ga0307407_10008435 3300031903 Bacteria 4731
185 Ga0307412_10057914 3300031911 Bacteria 2589
186 Ga0307412_10132702 3300031911 Bacteria 1811
187 Ga0307409_100001242 3300031995 Bacteria 12290
188 Ga0307409_100017626 3300031995 Bacteria 4767
189 Ga0307409_100050888 3300031995 Bacteria 3167
190 Ga0307409_100061461 3300031995 Bacteria 2935
191 Ga0307409_100065776 3300031995 Unclassified 2855
192 Ga0307409_100148128 3300031995 Bacteria 2033
193 Ga0307409_100156201 3300031995 Bacteria 1988
194 Ga0307409_100262352 3300031995 Bacteria 1586
195 Ga0307416_100069870 3300032002 Bacteria 2909
196 Ga0307416_100070071 3300032002 Bacteria 2905
197 Ga0307416_100078849 3300032002 Bacteria 2773
198 Ga0307416_101028762 3300032002 Unclassified 927
199 Ga0307414_10017101 3300032004 Bacteria 4429
200 Ga0307414_10038796 3300032004 Unclassified 3202
201 Ga0307414_10060731 3300032004 Bacteria 2675
202 Ga0307414_10101658 3300032004 Bacteria 2165
203 Ga0307414_10562265 3300032004 Bacteria 1018
204 Ga0307411_10014099 3300032005 Bacteria 4436
205 Ga0307411_10047216 3300032005 Bacteria 2782
206 Ga0307411_10090793 3300032005 Bacteria 2132
207 Ga0307411_10092300 3300032005 Bacteria 2117
208 Ga0307411_10281100 3300032005 Bacteria 1325
209 Ga0307411_10889991 3300032005 Bacteria 790
210 Ga0307415_100010902 3300032126 Bacteria 5170
211 Ga0307415_100013402 3300032126 Bacteria 4787
212 Ga0307415_100026253 3300032126 Bacteria 3671
213 Ga0307415_100035607 3300032126 Bacteria 3252
214 Ga0307415_100048547 3300032126 Bacteria 2865
215 Ga0307415_100201153 3300032126 Bacteria 1581
216 Ga0436365_1271091 3300039437 Bacteria 1392
217 Ga0450892_011869 3300042130 Unclassified 778
218 Ga0450889_010348 3300042144 Unclassified 962
219 Ga0495668_0000292 3300046616 Bacteria 68757
220 Ga0496101_0730360 3300048904 Bacteria 782
221 Ga0496104_0345391 3300048907 Bacteria 1401
222 Ga0496113_0563532 3300048916 Bacteria 913
223 Ga0501072_0001164 3300049588 Bacteria 19584
224 Ga0501224_025991 3300049664 Unclassified 875
225 Ga0501240_008460 3300049673 Bacteria 1321
226 Ga0501221_056283 3300049704 Bacteria 899
227 Ga0501229_028456 3300049706 Viruses 759
228 Ga0501263_004595 3300049760 Unclassified 1528
229 Ga0501268_003381 3300049765 Bacteria 2178
230 Ga0501270_002150 3300049767 Unclassified 1990
231 nmdc:mga08y16_358629_c1 3300050511 Bacteria 1497
232 Ga0500577_0000192 3300053142 Bacteria 16101
233 Ga0501084_0175821 3300054114 Unclassified 1807
234 Ga0307407_10104867
235 Ga0065707_10086777
236 Ga0070676_10142081
237 Ga0070683_100585525
238 Ga0070670_100030662
239 Ga0070670_100031407
240 Ga0070670_100071465
241 Ga0070670_100586032
242 Ga0070677_10468401
243 Ga0070680_100117762
244 Ga0068868_100155481
245 Ga0068868_100553415
246 Ga0068868_100971665
247 Ga0070689_100644818
248 Ga0070687_100540656
249 Ga0070661_100092000
250 Ga0070661_100335524
251 Ga0070661_100413763
252 Ga0070668_100979834
253 Ga0070675_100441352
254 Ga0070671_100048709
255 Ga0070671_100519452
256 Ga0070674_100873890
257 Ga0070673_100641216
258 Ga0070688_100015481
259 Ga0070688_100302853
260 Ga0070659_100044449
261 Ga0070667_100271880
262 Ga0070667_100680524
263 Ga0070662_100660997
264 Ga0070681_10179867
265 Ga0068867_100313078
266 Ga0068867_100557790
267 Ga0070685_10618961
268 Ga0070679_100035590
269 Ga0068853_100010171
270 Ga0070672_100141935
271 Ga0070686_100286019
272 Ga0068855_100887918
273 Ga0070664_100005808
274 Ga0070664_100469599
275 Ga0070664_100876196
276 Ga0070702_100187934
277 Ga0068859_100019979
278 Ga0068859_100071654
279 Ga0068864_100020397
280 Ga0068864_100039476
281 Ga0068864_100254010
282 Ga0068851_10020593
283 Ga0068851_10424397
284 Ga0068858_100335511
285 Ga0068860_100014987
286 Ga0068860_100045576
287 Ga0068860_100067844
288 Ga0068862_100041891
289 Ga0068862_100166743
290 Ga0068862_100302850
291 Ga0068862_100394591
292 Ga0068862_100972000
293 Ga0097621_100364787
294 Ga0068871_100066362
295 Ga0075434_101178594
296 Ga0068865_100054130
297 Ga0097620_100019980
298 Ga0097620_100071657
299 Ga0105240_10249335
300 Ga0111539_10095197
301 Ga0111539_10697168
302 Ga0105245_10521956
303 Ga0105247_10006670
304 Ga0105247_10249853
305 Ga0105241_10061458
306 Ga0105242_10035040
307 Ga0105242_11095639
308 Ga0105248_10318762
309 Ga0105249_10014909
310 Ga0105249_10020386
311 Ga0105249_10069119
312 Ga0105249_10139005
313 Ga0105249_10745430
314 Ga0105239_11042703
315 Ga0157370_10345753
316 Ga0157369_10224250
317 Ga0157378_10026388
318 Ga0157378_10117393
319 Ga0163162_10041123
320 Ga0163162_10048596
321 Ga0163162_10061759
322 Ga0163162_10217900
323 Ga0163162_10394044
324 Ga0163162_11332746
325 Ga0157375_10241129
326 Ga0157375_10402422
327 Ga0157375_11714189
328 Ga0163163_10042275
329 Ga0163163_10090343
330 Ga0163163_10094573
331 Ga0163163_10150899
332 Ga0157380_10043228
333 Ga0157380_11126400
334 Ga0157377_10144585
335 Ga0157379_10441433
336 Ga0163161_10000761
337 Ga0163161_10295607
338 Ga0207697_10247771
339 Ga0207710_10002405
340 Ga0207680_10206037
341 Ga0207645_10061179
342 Ga0207705_10009631
343 Ga0207707_10133333
344 Ga0207695_10241884
345 Ga0207650_10024878
346 Ga0207650_10128122
347 Ga0207659_10026299
348 Ga0207644_10519756
349 Ga0207644_10665636
350 Ga0207690_10034950
351 Ga0207706_10601895
352 Ga0207706_10826607
353 Ga0207670_10624358
354 Ga0207670_10799566
355 Ga0207669_10717291
356 Ga0207704_10021629
357 Ga0207704_10903049
358 Ga0207691_10088398
359 Ga0207691_10155662
360 Ga0207711_10003196
361 Ga0207689_10866506
362 Ga0207679_10119481
363 Ga0207679_10149090
364 Ga0207679_10300357
365 Ga0207712_10005202
366 Ga0207712_10009019
367 Ga0207712_10017755
368 Ga0207712_10151550
369 Ga0207712_10174197
370 Ga0207712_10591618
371 Ga0207658_10219328
372 Ga0207677_10053170
373 Ga0207678_10099109
374 Ga0207641_10036108
375 Ga0207641_10102680
376 Ga0207648_10338725
377 Ga0207648_11038803
378 Ga0207676_10050440
379 Ga0207676_10060144
380 Ga0207676_10083715
381 Ga0207674_10169166
382 Ga0207674_10278607
383 Ga0207674_10578937
384 Ga0207683_10319800
385 Ga0268265_10186061
386 Ga0268265_10489406
387 Ga0268265_10603951
388 Ga0268264_10001440
389 Ga0307408_100016575
390 Ga0307408_100051786
391 Ga0307408_100149773
392 Ga0307408_100213410
393 Ga0307408_100335651
394 Ga0307405_10009932
395 Ga0307405_10067341
396 Ga0307405_10115093
397 Ga0307405_10508910
398 Ga0307405_10599550
399 Ga0307413_10009070
400 Ga0307413_10009131
401 Ga0307413_10023065
402 Ga0307413_10079554
403 Ga0307413_10200520
404 Ga0307413_10480453
405 Ga0307413_10738949
406 Ga0307410_10012011
407 Ga0307410_10090040
408 Ga0307410_10480767
409 Ga0307410_10772111
410 Ga0307406_10017425
411 Ga0307406_10047421
412 Ga0307406_10073269
413 Ga0307406_10121229
414 Ga0307406_11086259
415 Ga0307407_10003195
416 Ga0307407_10005877
417 Ga0307407_10008435
418 Ga0307412_10057914
419 Ga0307412_10132702
420 Ga0307409_100001242
421 Ga0307409_100017626
422 Ga0307409_100050888
423 Ga0307409_100061461
424 Ga0307409_100065776
425 Ga0307409_100148128
426 Ga0307409_100156201
427 Ga0307409_100262352
428 Ga0307416_100069870
429 Ga0307416_100070071
430 Ga0307416_100078849
431 Ga0307416_101028762
432 Ga0307414_10017101
433 Ga0307414_10038796
434 Ga0307414_10060731
435 Ga0307414_10101658
436 Ga0307414_10562265
437 Ga0307411_10014099
438 Ga0307411_10047216
439 Ga0307411_10090793
440 Ga0307411_10092300
441 Ga0307411_10281100
442 Ga0307411_10889991
443 Ga0307415_100010902
444 Ga0307415_100013402
445 Ga0307415_100026253
446 Ga0307415_100035607
447 Ga0307415_100048547
448 Ga0307415_100201153
449 Ga0436365_1271091
450 Ga0450892_011869
451 Ga0450889_010348
452 Ga0495668_0000292
453 Ga0496101_0730360
454 Ga0496104_0345391
455 Ga0496113_0563532
456 Ga0501072_0001164
457 Ga0501224_025991
458 Ga0501240_008460
459 Ga0501221_056283
460 Ga0501229_028456
461 Ga0501263_004595
462 Ga0501268_003381
463 Ga0501270_002150
464 nmdc:mga08y16_358629_c1
465 Ga0500577_0000192
466 Ga0501084_0175821

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02390

Methyltransf_4

Putative methyltransferase

34

203

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dxz-assembly1.cif.gz_A crystal structure of ectrmb in complex with sah 0.8329 22 207
7nzj-assembly3.cif.gz_E structure of bstrmb apo 0.8317 34 207
7ogj-assembly2.cif.gz_B crystal structure of human mettl1 in complex with sah 0.8274 35 207
3dxy-assembly1.cif.gz_A crystal structure of ectrmb in complex with sam 0.8196 19 207
6gky-assembly1.cif.gz_A-2 crystal structure of coclaurine n-methyltransferase (cnmt) bound to n-methylheliamine and sah 0.8171 34 153
ID Description Score Start End Superfamily
af_Q8L8R4_95_308_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.912 5 206 3.40.50.150
af_Q67VB2_1_103_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9091 34 91 3.40.50.150
af_Q8L8R4_95_308_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8871 5 206 3.40.50.150
af_A0A1D6KUK4_472_668_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8865 18 207 3.40.50.150
af_A0A1D6GCG1_162_322_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8782 70 207 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7V9DCJ3-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9553 1 207 GO:0008176
GO:0043527
AF-K9WVW0-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9504 4 207 GO:0008176
GO:0043527
AF-A0A846DZ14-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9465 1 207 GO:0008176
GO:0043527
AF-A0A163P0J7-F1-model_v4 deleted 0.9465 30 206
AF-F4XUY8-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9443 19 206 GO:0008176
GO:0043527

Map