F346117

General Info

Members Datasets Scaffolds Average Seq Length
233 161 466 186

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10798048|Ga0157372_107980482
Length 219
Sequence MLVEFRRLFLEESKGMADFTRKCLAQVRSNHRRKARGGVNPIATFTIVAATAVLAIVSAVLYAQGQERDKYSLRSPDGIAFSDFRGYEDWAVASSARTDEVQKVIVANPAMIRAYKAGIPRNGQPFPEGSRMVKLQWSQEKNKEATFPVDVPDVFKQAFVMEKDSKRFPKTGGWGYAVFNYDAASHEFTADATAHADCGNTCHVAVKTKDYIFHPYEIR

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
61 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
62 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
99 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
101 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
111 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
112 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
113 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
152 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
155 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
156 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
157 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
158 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
159 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
160 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
161 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.14
Metatranscriptomes 0.86
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.86
Nodule 0
Rhizoplane 0.43
Rhizosphere 91.85
Stem 0
Stem Tuber 0
Unclassified 2.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10798048 3300013307 Bacteria 1097
2 rootH1_10031662 3300003316 Bacteria 1458
3 Ga0065712_10014346 3300005290 Bacteria 1865
4 Ga0070683_100415052 3300005329 Bacteria 1284
5 Ga0070683_100597197 3300005329 Bacteria 1056
6 Ga0070670_100121138 3300005331 Bacteria 2257
7 Ga0068869_100405934 3300005334 Bacteria 1121
8 Ga0070666_10099877 3300005335 Bacteria 1999
9 Ga0068868_100075391 3300005338 Bacteria 2696
10 Ga0070661_100018540 3300005344 Bacteria 4949
11 Ga0070671_100007607 3300005355 Bacteria 8665
12 Ga0070671_100078601 3300005355 Bacteria 2757
13 Ga0070671_100862129 3300005355 Bacteria 790
14 Ga0070673_100184692 3300005364 Bacteria 1787
15 Ga0070673_100244738 3300005364 Bacteria 1561
16 Ga0070667_100002801 3300005367 Bacteria 15050
17 Ga0070667_100052092 3300005367 Bacteria 3452
18 Ga0070667_100054882 3300005367 Bacteria 3365
19 Ga0070714_101188794 3300005435 Bacteria 744
20 Ga0070713_100122165 3300005436 Bacteria 2286
21 Ga0070713_100252540 3300005436 Bacteria 1609
22 Ga0070710_10319450 3300005437 Bacteria 1019
23 Ga0070711_100254210 3300005439 Bacteria 1380
24 Ga0070663_100734354 3300005455 Bacteria 842
25 Ga0068867_100255031 3300005459 Bacteria 1428
26 Ga0068867_100712032 3300005459 Bacteria 887
27 Ga0070684_100123011 3300005535 Bacteria 2335
28 Ga0068853_100000203 3300005539 Bacteria 41915
29 Ga0068853_100024091 3300005539 Bacteria 5101
30 Ga0068853_100036751 3300005539 Bacteria 4165
31 Ga0068853_100113257 3300005539 Bacteria 2412
32 Ga0068853_100347501 3300005539 Bacteria 1379
33 Ga0070686_100425133 3300005544 Bacteria 1016
34 Ga0070693_100003298 3300005547 Bacteria 7497
35 Ga0070665_100000283 3300005548 Bacteria 82138
36 Ga0070665_100004367 3300005548 Bacteria 14873
37 Ga0068855_100002544 3300005563 Bacteria 22454
38 Ga0068855_100011971 3300005563 Bacteria 10487
39 Ga0068855_100364148 3300005563 Bacteria 1590
40 Ga0070664_100110991 3300005564 Unclassified 2393
41 Ga0068857_100096529 3300005577 Bacteria 2649
42 Ga0068857_100725972 3300005577 Bacteria 945
43 Ga0068854_100073320 3300005578 Bacteria 2509
44 Ga0068854_100137605 3300005578 Bacteria 1871
45 Ga0068854_100325863 3300005578 Bacteria 1250
46 Ga0068856_100003050 3300005614 Bacteria 17138
47 Ga0068852_100000082 3300005616 Bacteria 67016
48 Ga0068859_100031511 3300005617 Bacteria 5324
49 Ga0068851_10065598 3300005834 Unclassified 1869
50 Ga0068851_10167299 3300005834 Bacteria 1211
51 Ga0068863_100124479 3300005841 Bacteria 2459
52 Ga0068858_100022861 3300005842 Bacteria 5832
53 Ga0068860_100152467 3300005843 Bacteria 2226
54 Ga0081539_10001162 3300005985 Bacteria 47608
55 Ga0097621_100136900 3300006237 Bacteria 2089
56 Ga0097621_100334626 3300006237 Bacteria 1343
57 Ga0097621_100565148 3300006237 Bacteria 1036
58 Ga0068871_100220383 3300006358 Bacteria 1643
59 Ga0068865_100009655 3300006881 Bacteria 5985
60 Ga0068865_100375304 3300006881 Bacteria 1158
61 Ga0075436_100230477 3300006914 Bacteria 1316
62 Ga0097620_100031515 3300006931 Bacteria 5324
63 Ga0075435_100112981 3300007076 Bacteria 2260
64 Ga0105240_10002743 3300009093 Bacteria 27862
65 Ga0105240_10017353 3300009093 Bacteria 9704
66 Ga0105240_10043401 3300009093 Bacteria 5721
67 Ga0105241_10000382 3300009174 Bacteria 33682
68 Ga0105242_10823487 3300009176 Bacteria 921
69 Ga0105248_10165934 3300009177 Bacteria 2490
70 Ga0105237_10014777 3300009545 Bacteria 8148
71 Ga0105237_10624857 3300009545 Bacteria 1084
72 Ga0105238_10094554 3300009551 Bacteria 2977
73 Ga0105238_10129818 3300009551 Bacteria 2498
74 Ga0105238_10608225 3300009551 Bacteria 1101
75 Ga0105249_10314756 3300009553 Bacteria 1575
76 Ga0105239_10049412 3300010375 Bacteria 4612
77 Ga0105239_11178315 3300010375 Bacteria 883
78 Ga0157370_10058845 3300013104 Bacteria 3652
79 Ga0157369_10027646 3300013105 Bacteria 6285
80 Ga0157369_10108422 3300013105 Bacteria 2953
81 Ga0157369_10118151 3300013105 Unclassified 2814
82 Ga0157369_10259456 3300013105 Bacteria 1812
83 Ga0157374_10261801 3300013296 Bacteria 1704
84 Ga0157374_10340560 3300013296 Bacteria 1489
85 Ga0157378_10005460 3300013297 Bacteria 11136
86 Ga0157378_10101100 3300013297 Unclassified 2633
87 Ga0157378_10171244 3300013297 Bacteria 2036
88 Ga0163162_10008421 3300013306 Bacteria 10056
89 Ga0157372_10011408 3300013307 Bacteria 9452
90 Ga0157372_10247804 3300013307 Bacteria 2067
91 Ga0157375_10784418 3300013308 Bacteria 1102
92 Ga0163163_10082928 3300014325 Bacteria 3211
93 Ga0157379_10067194 3300014968 Bacteria 3205
94 Ga0157379_10337794 3300014968 Bacteria 1377
95 Ga0157379_10869772 3300014968 Bacteria 854
96 Ga0157376_10100817 3300014969 Bacteria 2522
97 Ga0163161_10200236 3300017792 Bacteria 1539
98 Ga0213873_10028453 3300021358 Bacteria 1371
99 Ga0224572_1019115 3300024225 Bacteria 1317
100 Ga0228598_1018674 3300024227 Bacteria 1368
101 Ga0209026_1017087 3300025250 Bacteria 1165
102 Ga0207656_10116710 3300025321 Bacteria 1239
103 Ga0207688_10319610 3300025901 Bacteria 952
104 Ga0207680_10031147 3300025903 Bacteria 3019
105 Ga0207647_10051055 3300025904 Bacteria 2558
106 Ga0207654_10000034 3300025911 Bacteria 113041
107 Ga0207654_10000099 3300025911 Bacteria 57684
108 Ga0207695_10000561 3300025913 Bacteria 76257
109 Ga0207695_10003769 3300025913 Bacteria 21043
110 Ga0207695_10138594 3300025913 Bacteria 2384
111 Ga0207695_10382938 3300025913 Eukaryota 1292
112 Ga0207671_10000123 3300025914 Bacteria 119385
113 Ga0207671_10077892 3300025914 Bacteria 2482
114 Ga0207663_10507941 3300025916 Bacteria 937
115 Ga0207649_10001279 3300025920 Bacteria 15025
116 Ga0207694_10000112 3300025924 Bacteria 85385
117 Ga0207694_10063891 3300025924 Bacteria 2868
118 Ga0207694_10136017 3300025924 Bacteria 1974
119 Ga0207687_10635706 3300025927 Bacteria 902
120 Ga0207700_10001777 3300025928 Bacteria 12232
121 Ga0207704_10110487 3300025938 Bacteria 1857
122 Ga0207711_10102870 3300025941 Bacteria 2529
123 Ga0207689_10000935 3300025942 Bacteria 28042
124 Ga0207689_10091734 3300025942 Bacteria 2496
125 Ga0207661_10541120 3300025944 Bacteria 1066
126 Ga0207667_10005686 3300025949 Bacteria 15203
127 Ga0207667_10071320 3300025949 Bacteria 3612
128 Ga0207667_10077646 3300025949 Bacteria 3443
129 Ga0207667_10251205 3300025949 Bacteria 1809
130 Ga0207640_10017197 3300025981 Bacteria 4225
131 Ga0207640_10280761 3300025981 Bacteria 1308
132 Ga0207658_10043862 3300025986 Bacteria 3254
133 Ga0207658_10174471 3300025986 Unclassified 1774
134 Ga0207658_10550717 3300025986 Bacteria 1032
135 Ga0207677_10062334 3300026023 Bacteria 2586
136 Ga0207677_11130101 3300026023 Bacteria 715
137 Ga0207703_10010946 3300026035 Bacteria 7070
138 Ga0207703_10193382 3300026035 Bacteria 1804
139 Ga0207639_10000233 3300026041 Bacteria 41490
140 Ga0207639_10034663 3300026041 Unclassified 3731
141 Ga0207639_10345814 3300026041 Bacteria 1327
142 Ga0207678_10100211 3300026067 Bacteria 2474
143 Ga0207702_10011105 3300026078 Bacteria 7518
144 Ga0207641_10059405 3300026088 Bacteria 3256
145 Ga0207648_10357979 3300026089 Bacteria 1316
146 Ga0207676_10074148 3300026095 Bacteria 2741
147 Ga0207674_10008197 3300026116 Bacteria 12107
148 Ga0207698_10000066 3300026142 Bacteria 70450
149 Ga0265357_1002061 3300028023 Bacteria 1590
150 Ga0268266_10000001 3300028379 Bacteria 4040580
151 Ga0268264_11006458 3300028381 Bacteria 840
152 Ga0265336_10001257 3300028666 Bacteria 12007
153 Ga0265338_10005180 3300028800 Bacteria 17115
154 Ga0265338_10310707 3300028800 Bacteria 1143
155 Ga0307511_10007737 3300030521 Bacteria 10800
156 Ga0265760_10000042 3300031090 Bacteria 38544
157 Ga0265760_10000566 3300031090 Bacteria 10521
158 Ga0265330_10001393 3300031235 Bacteria 14131
159 Ga0265328_10089665 3300031239 Bacteria 1136
160 Ga0265325_10001858 3300031241 Bacteria 14582
161 Ga0265339_10017161 3300031249 Bacteria 4292
162 Ga0265339_10040028 3300031249 Bacteria 2606
163 Ga0265331_10016838 3300031250 Bacteria 3827
164 Ga0265316_10005953 3300031344 Bacteria 11743
165 Ga0265316_10011855 3300031344 Bacteria 7840
166 Ga0265316_10045610 3300031344 Bacteria 3479
167 Ga0307508_10318182 3300031616 Bacteria 1148
168 Ga0307508_10360806 3300031616 Bacteria 1044
169 Ga0265314_10199774 3300031711 Bacteria 1183
170 Ga0265342_10012649 3300031712 Bacteria 5708
171 Ga0307411_10132568 3300032005 Bacteria 1824
172 Ga0307507_10521061 3300033179 Bacteria 635
173 Ga0316215_1007110 3300033544 Bacteria 1089
174 Ga0373956_0014190 3300035119 Bacteria 3325
175 Ga0373957_0095765 3300035120 Bacteria 1184
176 Ga0373955_0060988 3300035172 Bacteria 2082
177 Ga0373955_0091848 3300035172 Bacteria 1731
178 Ga0373933_0001098 3300035724 Bacteria 16126
179 Ga0373937_0000048 3300036401 Bacteria 106296
180 Ga0373937_0042290 3300036401 Bacteria 4156
181 Ga0373937_0086443 3300036401 Bacteria 2902
182 Ga0373937_0603151 3300036401 Bacteria 1042
183 Ga0373925_0258305 3300037068 Bacteria 1399
184 Ga0395905_0351093 3300037471 Bacteria 1367
185 Ga0436363_0507950 3300039450 Bacteria 1019
186 Ga0436363_1083683 3300039450 Bacteria 708
187 Ga0495638_0010345 3300046460 Bacteria 6488
188 Ga0495641_0190957 3300046461 Bacteria 918
189 Ga0495651_0033404 3300046462 Bacteria 4013
190 Ga0495651_0068375 3300046462 Bacteria 2708
191 Ga0495651_0404004 3300046462 Bacteria 891
192 Ga0495653_0142862 3300046463 Bacteria 1681
193 Ga0495650_0033212 3300046471 Bacteria 2299
194 Ga0495582_0024273 3300046473 Bacteria 3316
195 Ga0495664_0015309 3300046477 Bacteria 4358
196 Ga0495618_0306062 3300046514 Bacteria 987
197 Ga0495630_0053331 3300046517 Bacteria 3028
198 Ga0495643_0133308 3300046522 Bacteria 1245
199 Ga0495652_0026792 3300046529 Bacteria 5087
200 Ga0495652_0116621 3300046529 Bacteria 2137
201 Ga0495587_0000866 3300046536 Bacteria 20006
202 Ga0495667_0481391 3300046559 Bacteria 778
203 Ga0495656_0196111 3300046615 Bacteria 1000
204 Ga0495656_0461085 3300046615 Bacteria 670
205 Ga0495625_0002562 3300046660 Bacteria 19523
206 Ga0495635_0253068 3300046663 Bacteria 1187
207 Ga0495599_0175151 3300046678 Bacteria 1323
208 Ga0495646_0087214 3300046680 Bacteria 1809
209 Ga0495600_0132208 3300046809 Bacteria 1622
210 Ga0495604_0052990 3300047317 Bacteria 3139
211 Ga0495636_0000021 3300047318 Bacteria 72964
212 Ga0495674_0034178 3300047319 Bacteria 4599
213 Ga0495680_0090108 3300047322 Bacteria 2301
214 Ga0495675_0005469 3300047444 Bacteria 7750
215 Ga0495686_0201986 3300047472 Bacteria 1140
216 Ga0495602_0000442 3300048088 Bacteria 38967
217 Ga0496105_0421641 3300048908 Bacteria 1056
218 Ga0495682_0123519 3300049460 Bacteria 927
219 nmdc:mga0rr50_618392_c1 3300050513 Bacteria 924
220 nmdc:mga08x19_375183_c1 3300050514 Bacteria 996
221 nmdc:mga0a205_323959_c1 3300050515 Bacteria 1411
222 Ga0495612_0059112 3300053078 Bacteria 1585
223 Ga0495595_0038799 3300053084 Bacteria 2171
224 Ga0495619_0106786 3300053085 Bacteria 1909
225 Ga0500643_004142 3300053087 Bacteria 6660
226 Ga0500583_0001325 3300053092 Bacteria 7068
227 Ga0500651_0086958 3300053093 Bacteria 1930
228 Ga0500595_000007 3300053119 Bacteria 289461
229 Ga0500597_000023 3300053120 Bacteria 33502
230 Ga0500568_0000179 3300053139 Bacteria 55301
231 Ga0500568_0007262 3300053139 Bacteria 5457
232 Ga0500622_0197970 3300053156 Bacteria 916
233 Ga0500637_0005747 3300053178 Bacteria 6038
234 Ga0157372_10798048
235 rootH1_10031662
236 Ga0065712_10014346
237 Ga0070683_100415052
238 Ga0070683_100597197
239 Ga0070670_100121138
240 Ga0068869_100405934
241 Ga0070666_10099877
242 Ga0068868_100075391
243 Ga0070661_100018540
244 Ga0070671_100007607
245 Ga0070671_100078601
246 Ga0070671_100862129
247 Ga0070673_100184692
248 Ga0070673_100244738
249 Ga0070667_100002801
250 Ga0070667_100052092
251 Ga0070667_100054882
252 Ga0070714_101188794
253 Ga0070713_100122165
254 Ga0070713_100252540
255 Ga0070710_10319450
256 Ga0070711_100254210
257 Ga0070663_100734354
258 Ga0068867_100255031
259 Ga0068867_100712032
260 Ga0070684_100123011
261 Ga0068853_100000203
262 Ga0068853_100024091
263 Ga0068853_100036751
264 Ga0068853_100113257
265 Ga0068853_100347501
266 Ga0070686_100425133
267 Ga0070693_100003298
268 Ga0070665_100000283
269 Ga0070665_100004367
270 Ga0068855_100002544
271 Ga0068855_100011971
272 Ga0068855_100364148
273 Ga0070664_100110991
274 Ga0068857_100096529
275 Ga0068857_100725972
276 Ga0068854_100073320
277 Ga0068854_100137605
278 Ga0068854_100325863
279 Ga0068856_100003050
280 Ga0068852_100000082
281 Ga0068859_100031511
282 Ga0068851_10065598
283 Ga0068851_10167299
284 Ga0068863_100124479
285 Ga0068858_100022861
286 Ga0068860_100152467
287 Ga0081539_10001162
288 Ga0097621_100136900
289 Ga0097621_100334626
290 Ga0097621_100565148
291 Ga0068871_100220383
292 Ga0068865_100009655
293 Ga0068865_100375304
294 Ga0075436_100230477
295 Ga0097620_100031515
296 Ga0075435_100112981
297 Ga0105240_10002743
298 Ga0105240_10017353
299 Ga0105240_10043401
300 Ga0105241_10000382
301 Ga0105242_10823487
302 Ga0105248_10165934
303 Ga0105237_10014777
304 Ga0105237_10624857
305 Ga0105238_10094554
306 Ga0105238_10129818
307 Ga0105238_10608225
308 Ga0105249_10314756
309 Ga0105239_10049412
310 Ga0105239_11178315
311 Ga0157370_10058845
312 Ga0157369_10027646
313 Ga0157369_10108422
314 Ga0157369_10118151
315 Ga0157369_10259456
316 Ga0157374_10261801
317 Ga0157374_10340560
318 Ga0157378_10005460
319 Ga0157378_10101100
320 Ga0157378_10171244
321 Ga0163162_10008421
322 Ga0157372_10011408
323 Ga0157372_10247804
324 Ga0157375_10784418
325 Ga0163163_10082928
326 Ga0157379_10067194
327 Ga0157379_10337794
328 Ga0157379_10869772
329 Ga0157376_10100817
330 Ga0163161_10200236
331 Ga0213873_10028453
332 Ga0224572_1019115
333 Ga0228598_1018674
334 Ga0209026_1017087
335 Ga0207656_10116710
336 Ga0207688_10319610
337 Ga0207680_10031147
338 Ga0207647_10051055
339 Ga0207654_10000034
340 Ga0207654_10000099
341 Ga0207695_10000561
342 Ga0207695_10003769
343 Ga0207695_10138594
344 Ga0207695_10382938
345 Ga0207671_10000123
346 Ga0207671_10077892
347 Ga0207663_10507941
348 Ga0207649_10001279
349 Ga0207694_10000112
350 Ga0207694_10063891
351 Ga0207694_10136017
352 Ga0207687_10635706
353 Ga0207700_10001777
354 Ga0207704_10110487
355 Ga0207711_10102870
356 Ga0207689_10000935
357 Ga0207689_10091734
358 Ga0207661_10541120
359 Ga0207667_10005686
360 Ga0207667_10071320
361 Ga0207667_10077646
362 Ga0207667_10251205
363 Ga0207640_10017197
364 Ga0207640_10280761
365 Ga0207658_10043862
366 Ga0207658_10174471
367 Ga0207658_10550717
368 Ga0207677_10062334
369 Ga0207677_11130101
370 Ga0207703_10010946
371 Ga0207703_10193382
372 Ga0207639_10000233
373 Ga0207639_10034663
374 Ga0207639_10345814
375 Ga0207678_10100211
376 Ga0207702_10011105
377 Ga0207641_10059405
378 Ga0207648_10357979
379 Ga0207676_10074148
380 Ga0207674_10008197
381 Ga0207698_10000066
382 Ga0265357_1002061
383 Ga0268266_10000001
384 Ga0268264_11006458
385 Ga0265336_10001257
386 Ga0265338_10005180
387 Ga0265338_10310707
388 Ga0307511_10007737
389 Ga0265760_10000042
390 Ga0265760_10000566
391 Ga0265330_10001393
392 Ga0265328_10089665
393 Ga0265325_10001858
394 Ga0265339_10017161
395 Ga0265339_10040028
396 Ga0265331_10016838
397 Ga0265316_10005953
398 Ga0265316_10011855
399 Ga0265316_10045610
400 Ga0307508_10318182
401 Ga0307508_10360806
402 Ga0265314_10199774
403 Ga0265342_10012649
404 Ga0307411_10132568
405 Ga0307507_10521061
406 Ga0316215_1007110
407 Ga0373956_0014190
408 Ga0373957_0095765
409 Ga0373955_0060988
410 Ga0373955_0091848
411 Ga0373933_0001098
412 Ga0373937_0000048
413 Ga0373937_0042290
414 Ga0373937_0086443
415 Ga0373937_0603151
416 Ga0373925_0258305
417 Ga0395905_0351093
418 Ga0436363_0507950
419 Ga0436363_1083683
420 Ga0495638_0010345
421 Ga0495641_0190957
422 Ga0495651_0033404
423 Ga0495651_0068375
424 Ga0495651_0404004
425 Ga0495653_0142862
426 Ga0495650_0033212
427 Ga0495582_0024273
428 Ga0495664_0015309
429 Ga0495618_0306062
430 Ga0495630_0053331
431 Ga0495643_0133308
432 Ga0495652_0026792
433 Ga0495652_0116621
434 Ga0495587_0000866
435 Ga0495667_0481391
436 Ga0495656_0196111
437 Ga0495656_0461085
438 Ga0495625_0002562
439 Ga0495635_0253068
440 Ga0495599_0175151
441 Ga0495646_0087214
442 Ga0495600_0132208
443 Ga0495604_0052990
444 Ga0495636_0000021
445 Ga0495674_0034178
446 Ga0495680_0090108
447 Ga0495675_0005469
448 Ga0495686_0201986
449 Ga0495602_0000442
450 Ga0496105_0421641
451 Ga0495682_0123519
452 nmdc:mga0rr50_618392_c1
453 nmdc:mga08x19_375183_c1
454 nmdc:mga0a205_323959_c1
455 Ga0495612_0059112
456 Ga0495595_0038799
457 Ga0495619_0106786
458 Ga0500643_004142
459 Ga0500583_0001325
460 Ga0500651_0086958
461 Ga0500595_000007
462 Ga0500597_000023
463 Ga0500568_0000179
464 Ga0500568_0007262
465 Ga0500622_0197970
466 Ga0500637_0005747

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16694

Cytochrome_P460

Cytochrome P460

84

214

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2je2-assembly1.cif.gz_A cytochrome p460 from nitrosomonas europaea - probable nonphysiological oxidized form 0.8198 43 148
6hiu-assembly1.cif.gz_A cytochrome p460 from methylococcus capsulatus (bath) 0.7774 31 172
6hiu-assembly1.cif.gz_A cytochrome p460 from methylococcus capsulatus (bath) 0.739 31 172
8gar-assembly1.cif.gz_A nitrosomonas europaea cytochrome p460 arg44ala 0.7324 43 168
7zs4-assembly1.cif.gz_A f32v cytochrome c prime beta from methylococcus capsulatus (bath) 0.71 41 166
ID Description Score Start End Superfamily
2je3A00 Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase;Cytochrome P460 0.8137 43 149 3.50.70.20
af_A0A1D6JUA0_124_347_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.7234 46 67 3.60.10.10
af_K7LWA0_1_126_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.6704 46 67 3.60.10.10
af_Q4V7A8_16_457_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.5956 49 101 3.40.50.1820
af_Q8IQI5_15_479_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.5928 49 102 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1Q7VEB2-F1-model_v4 Cytochrome P460 0.8959 12 133
AF-A0A852VCN9-F1-model_v4 Mono/diheme cytochrome c family protein 0.8841 25 171 GO:0009055
GO:0020037
GO:0046872
AF-A0A6B9YVF0-F1-model_v4 C-type cytochrome 0.8803 20 171 GO:0009055
GO:0020037
GO:0046872
AF-A0A2V7MFV7-F1-model_v4 Cytochrome P460 0.86 27 177
AF-A0A1Q6X022-F1-model_v4 Cytochrome P460 0.8564 12 177

Map