F346103

General Info

Members Datasets Scaffolds Average Seq Length
233 150 466 303

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10023782|Ga0157378_100237822
Length 339
Sequence LLITVLGDIEIASGKNSSPSCKIPKLRNHKIKNSMQAASHILMIRPVHFGFNAETAVNNAFQIAGKDSGAQEKALAEFDAMVVLLQQNGVDVTVISDTDEPHTPDSIFPNNWISFHEDGTVVLYPMFAPNRRLERKPDIITRIAAKFDITRTIDLSRYEQESAFLEGTGSMVLDRQNKIAYACLSPRTDYFVLTEYCEKLGYTPVSFDAMDQAGRAIYHTNVMMCVADRYVVICMDAIPAEHEKEMVTETIQKTNKDIIPITLEQMNHFAGNMLQVNNDKGEPLLVMSSQAFNVLSKPQVEKLNSYNKIIHSPLTTIETNGGGSARCMMAELYLPIKKL

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
72 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
113 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
114 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
143 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
144 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
145 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 2739367663 Pedobacter sp. YR510 Isolate Unclassified
148 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
149 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
150 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.71
Metatranscriptomes 2.58
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.15
Nodule 0
Rhizoplane 1.72
Rhizosphere 93.56
Stem 0
Stem Tuber 0
Unclassified 5.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10023782 3300013297 Bacteria 5390
2 rootH2_10196887 3300003320 Bacteria 1605
3 rootH1_10155535 3300003323 Bacteria 2385
4 Ga0070658_10003226 3300005327 Bacteria 13468
5 Ga0070658_10108503 3300005327 Bacteria 2298
6 Ga0070676_10001251 3300005328 Bacteria 12801
7 Ga0070670_100177302 3300005331 Bacteria 1850
8 Ga0068869_100021417 3300005334 Bacteria 4447
9 Ga0070666_10000913 3300005335 Bacteria 17912
10 Ga0070680_100060914 3300005336 Bacteria 3088
11 Ga0070682_100000306 3300005337 Bacteria 34011
12 Ga0070682_100000460 3300005337 Bacteria 25673
13 Ga0068868_100001760 3300005338 Bacteria 14830
14 Ga0068868_100015825 3300005338 Bacteria 5588
15 Ga0070660_100020708 3300005339 Bacteria 4839
16 Ga0070691_10001224 3300005341 Bacteria 10797
17 Ga0070668_100000036 3300005347 Bacteria 81256
18 Ga0070675_100050901 3300005354 Bacteria 3402
19 Ga0070671_100011552 3300005355 Bacteria 7102
20 Ga0070671_100046359 3300005355 Bacteria 3615
21 Ga0070673_100000556 3300005364 Bacteria 20111
22 Ga0070673_100156313 3300005364 Bacteria 1936
23 Ga0070659_100000854 3300005366 Bacteria 22245
24 Ga0070667_100000151 3300005367 Bacteria 86629
25 Ga0070667_100011374 3300005367 Bacteria 7358
26 Ga0070662_100001152 3300005457 Bacteria 16211
27 Ga0070662_100146278 3300005457 Bacteria 1836
28 Ga0070681_10023004 3300005458 Bacteria 6265
29 Ga0068867_100001821 3300005459 Bacteria 14856
30 Ga0070685_10069653 3300005466 Unclassified 2081
31 Ga0070679_100007747 3300005530 Bacteria 10058
32 Ga0068853_100115996 3300005539 Bacteria 2384
33 Ga0070672_100000471 3300005543 Bacteria 23416
34 Ga0070693_100030784 3300005547 Bacteria 2937
35 Ga0070693_100098019 3300005547 Unclassified 1780
36 Ga0070665_100001215 3300005548 Bacteria 31387
37 Ga0070665_100066825 3300005548 Bacteria 3607
38 Ga0068855_100001248 3300005563 Bacteria 31576
39 Ga0068855_100095976 3300005563 Bacteria 3417
40 Ga0068855_100496380 3300005563 Bacteria 1327
41 Ga0070664_100026009 3300005564 Bacteria 4852
42 Ga0070664_100052244 3300005564 Bacteria 3461
43 Ga0068857_100255757 3300005577 Bacteria 1606
44 Ga0070702_100057982 3300005615 Bacteria 2241
45 Ga0068852_100094095 3300005616 Bacteria 2687
46 Ga0068852_100603038 3300005616 Bacteria 1102
47 Ga0068859_100000026 3300005617 Bacteria 188742
48 Ga0068859_100184709 3300005617 Bacteria 2168
49 Ga0068864_100001161 3300005618 Bacteria 21876
50 Ga0068864_100018308 3300005618 Bacteria 5849
51 Ga0068864_100316386 3300005618 Bacteria 1465
52 Ga0068851_10002501 3300005834 Bacteria 8078
53 Ga0068863_100001435 3300005841 Bacteria 23620
54 Ga0068863_100035596 3300005841 Bacteria 4741
55 Ga0068858_100001071 3300005842 Bacteria 28302
56 Ga0068858_100067398 3300005842 Bacteria 3315
57 Ga0068858_100092182 3300005842 Bacteria 2820
58 Ga0068860_100000824 3300005843 Bacteria 34695
59 Ga0068860_100006095 3300005843 Bacteria 12134
60 Ga0068860_100019647 3300005843 Bacteria 6552
61 Ga0068860_100391487 3300005843 Bacteria 1373
62 Ga0081455_10006436 3300005937 Bacteria 12590
63 Ga0075366_10109368 3300006195 Bacteria 1662
64 Ga0097621_100004022 3300006237 Bacteria 10191
65 Ga0097621_100007197 3300006237 Bacteria 7938
66 Ga0097621_100059485 3300006237 Bacteria 3129
67 Ga0068871_100003690 3300006358 Bacteria 10521
68 Ga0068865_100003069 3300006881 Bacteria 9987
69 Ga0097620_100000026 3300006931 Bacteria 188742
70 Ga0097620_100184711 3300006931 Bacteria 2168
71 Ga0105240_10005793 3300009093 Bacteria 18325
72 Ga0105240_10019358 3300009093 Bacteria 9097
73 Ga0105240_10155628 3300009093 Bacteria 2719
74 Ga0105240_10383740 3300009093 Unclassified 1586
75 Ga0105245_10012935 3300009098 Bacteria 7274
76 Ga0105245_10035416 3300009098 Bacteria 4429
77 Ga0105247_10003205 3300009101 Bacteria 10784
78 Ga0105247_10012320 3300009101 Bacteria 5137
79 Ga0105243_10089572 3300009148 Bacteria 2530
80 Ga0105241_10000113 3300009174 Bacteria 58135
81 Ga0105241_10000739 3300009174 Bacteria 24827
82 Ga0105248_10077632 3300009177 Bacteria 3734
83 Ga0105238_10030766 3300009551 Bacteria 5464
84 Ga0105249_10007291 3300009553 Bacteria 9642
85 Ga0105249_10012247 3300009553 Bacteria 7555
86 Ga0105249_10016226 3300009553 Bacteria 6605
87 Ga0105249_10031972 3300009553 Bacteria 4759
88 Ga0105239_10019423 3300010375 Bacteria 7502
89 Ga0105239_10159466 3300010375 Bacteria 2520
90 Ga0105246_10015690 3300011119 Bacteria 4788
91 Ga0157373_10000161 3300013100 Bacteria 54194
92 Ga0157373_10001334 3300013100 Bacteria 18896
93 Ga0157373_10003110 3300013100 Bacteria 12543
94 Ga0157371_10223896 3300013102 Bacteria 1351
95 Ga0157370_10129633 3300013104 Bacteria 2353
96 Ga0157369_10046328 3300013105 Bacteria 4726
97 Ga0157369_10408171 3300013105 Bacteria 1409
98 Ga0157369_10504889 3300013105 Bacteria 1251
99 Ga0157374_10000153 3300013296 Bacteria 63211
100 Ga0157374_10002577 3300013296 Bacteria 15283
101 Ga0157378_10010369 3300013297 Bacteria 8134
102 Ga0157378_10258016 3300013297 Unclassified 1671
103 Ga0163162_10000040 3300013306 Bacteria 133855
104 Ga0163162_10029523 3300013306 Bacteria 5427
105 Ga0157372_10002309 3300013307 Bacteria 20685
106 Ga0157372_10227576 3300013307 Bacteria 2162
107 Ga0157372_10274047 3300013307 Bacteria 1961
108 Ga0157375_10000407 3300013308 Bacteria 39103
109 Ga0157375_10191021 3300013308 Bacteria 2203
110 Ga0163163_10000110 3300014325 Bacteria 87033
111 Ga0163163_10041043 3300014325 Bacteria 4523
112 Ga0163163_10210629 3300014325 Bacteria 1993
113 Ga0157380_10001466 3300014326 Bacteria 15451
114 Ga0157380_10222759 3300014326 Bacteria 1689
115 Ga0157377_10037977 3300014745 Unclassified 2657
116 Ga0157379_10000173 3300014968 Bacteria 48672
117 Ga0157379_10016328 3300014968 Bacteria 6530
118 Ga0157379_10056869 3300014968 Bacteria 3495
119 Ga0157379_10326899 3300014968 Bacteria 1401
120 Ga0157376_10000535 3300014969 Bacteria 24452
121 Ga0157376_10018612 3300014969 Bacteria 5331
122 Ga0157376_10056339 3300014969 Bacteria 3283
123 Ga0163161_10113499 3300017792 Bacteria 2028
124 Ga0197907_10213375 3300020069 Unclassified 997
125 Ga0206355_1202739 3300020076 Unclassified 1129
126 Ga0206355_1209081 3300020076 Bacteria 1131
127 Ga0206351_10014417 3300020077 Bacteria 1211
128 Ga0206350_10159956 3300020080 Bacteria 1054
129 Ga0206350_10401402 3300020080 Unclassified 1101
130 Ga0209026_1000351 3300025250 Bacteria 43657
131 Ga0207710_10001464 3300025900 Bacteria 11721
132 Ga0207710_10010484 3300025900 Bacteria 3904
133 Ga0207680_10001727 3300025903 Bacteria 10295
134 Ga0207705_10003028 3300025909 Bacteria 12813
135 Ga0207654_10003203 3300025911 Bacteria 8272
136 Ga0207707_10000189 3300025912 Bacteria 65118
137 Ga0207695_10002088 3300025913 Bacteria 30409
138 Ga0207671_10073266 3300025914 Bacteria 2558
139 Ga0207660_10001432 3300025917 Bacteria 16013
140 Ga0207662_10211728 3300025918 Bacteria 1258
141 Ga0207657_10020350 3300025919 Bacteria 6272
142 Ga0207657_10484012 3300025919 Bacteria 970
143 Ga0207652_10000488 3300025921 Bacteria 40566
144 Ga0207681_10068595 3300025923 Unclassified 2464
145 Ga0207694_10226276 3300025924 Bacteria 1527
146 Ga0207650_10104098 3300025925 Bacteria 2189
147 Ga0207659_10049001 3300025926 Bacteria 2994
148 Ga0207687_10011776 3300025927 Bacteria 5724
149 Ga0207690_10011362 3300025932 Bacteria 5325
150 Ga0207706_10002485 3300025933 Bacteria 17975
151 Ga0207704_10001601 3300025938 Bacteria 10176
152 Ga0207691_10000504 3300025940 Bacteria 38867
153 Ga0207691_10198653 3300025940 Bacteria 1746
154 Ga0207689_10029042 3300025942 Bacteria 4622
155 Ga0207689_10058561 3300025942 Bacteria 3169
156 Ga0207667_10005017 3300025949 Bacteria 16181
157 Ga0207667_10186787 3300025949 Bacteria 2127
158 Ga0207667_10410945 3300025949 Bacteria 1377
159 Ga0207651_10000164 3300025960 Bacteria 28660
160 Ga0207712_10028628 3300025961 Bacteria 3728
161 Ga0207712_10191814 3300025961 Bacteria 1613
162 Ga0207668_10000568 3300025972 Bacteria 23189
163 Ga0207658_10000225 3300025986 Bacteria 59285
164 Ga0207658_10096055 3300025986 Bacteria 2310
165 Ga0207658_10124532 3300025986 Bacteria 2060
166 Ga0207658_10220125 3300025986 Unclassified 1596
167 Ga0207677_10003499 3300026023 Bacteria 8323
168 Ga0207677_10013233 3300026023 Bacteria 4773
169 Ga0207677_10050302 3300026023 Bacteria 2818
170 Ga0207703_10001012 3300026035 Bacteria 27015
171 Ga0207703_10021902 3300026035 Bacteria 5004
172 Ga0207703_10128359 3300026035 Bacteria 2186
173 Ga0207639_10083279 3300026041 Bacteria 2538
174 Ga0207639_10143031 3300026041 Bacteria 1995
175 Ga0207641_10000155 3300026088 Bacteria 97385
176 Ga0207641_10006442 3300026088 Bacteria 9897
177 Ga0207641_10008788 3300026088 Bacteria 8344
178 Ga0207648_10013539 3300026089 Bacteria 7583
179 Ga0207676_10006768 3300026095 Bacteria 8114
180 Ga0207676_10013345 3300026095 Bacteria 5902
181 Ga0207676_10112939 3300026095 Bacteria 2277
182 Ga0207683_10326389 3300026121 Bacteria 1406
183 Ga0207698_10706678 3300026142 Bacteria 1003
184 Ga0268266_10001023 3300028379 Bacteria 35230
185 Ga0268264_10001646 3300028381 Bacteria 20632
186 Ga0268264_10059000 3300028381 Bacteria 3215
187 Ga0307515_10000363 3300028794 Bacteria 111302
188 Ga0316183_1096868 3300030742 Bacteria 33618
189 Ga0316181_1101548 3300030744 Bacteria 29976
190 Ga0316182_1019572 3300030745 Bacteria 2361
191 Ga0265327_10011303 3300031251 Bacteria 6168
192 Ga0395899_0145332 3300037312 Bacteria 1684
193 Ga0451807_1031808 3300041486 Bacteria 978
194 Ga0451577_0009739 3300042876 Bacteria 9212
195 Ga0451577_0013930 3300042876 Bacteria 7505
196 Ga0451577_0157238 3300042876 Bacteria 2046
197 Ga0466972_0000422 3300044658 Bacteria 21982
198 Ga0453684_0006335 3300044712 Bacteria 22591
199 Ga0453684_0457641 3300044712 Bacteria 1419
200 Ga0466970_0001701 3300044765 Bacteria 10578
201 Ga0466960_0024051 3300044901 Bacteria 2744
202 Ga0451576_0060223 3300045051 Unclassified 3961
203 Ga0451576_0255567 3300045051 Bacteria 1831
204 Ga0495638_0119991 3300046460 Bacteria 1555
205 Ga0495594_0167424 3300046499 Bacteria 1250
206 Ga0495668_0001611 3300046616 Bacteria 21126
207 Ga0495672_0037754 3300047320 Bacteria 2953
208 Ga0495686_0012134 3300047472 Bacteria 6045
209 Ga0496108_0495320 3300048911 Bacteria 1067
210 Ga0496109_0031918 3300048912 Bacteria 4731
211 Ga0496114_0001392 3300048917 Bacteria 18351
212 Ga0501038_0080968 3300049574 Bacteria 2736
213 Ga0501038_0312234 3300049574 Bacteria 1232
214 Ga0501043_0178880 3300049579 Unclassified 1653
215 Ga0501046_0254170 3300049580 Bacteria 1293
216 Ga0501047_0128865 3300049581 Bacteria 2411
217 Ga0501068_0290898 3300049584 Bacteria 1045
218 Ga0501071_0248380 3300049587 Bacteria 1343
219 Ga0501247_001902 3300049677 Bacteria 2106
220 Ga0501079_0447072 3300049741 Bacteria 1015
221 Ga0501083_0071386 3300049744 Bacteria 2308
222 Ga0501044_0075924 3300049823 Unclassified 3412
223 Ga0501044_0162257 3300049823 Bacteria 2211
224 Ga0501044_0216523 3300049823 Bacteria 1867
225 Ga0500562_005204 3300053108 Bacteria 3268
226 Ga0500642_0183066 3300053130 Bacteria 979
227 Ga0500568_0000407 3300053139 Bacteria 32843
228 Ga0500622_0000013 3300053156 Bacteria 371650
229 Ga0501084_0038969 3300054114 Bacteria 3974
230 2739644797 2739367663 Bacteria 5040914
231 2842906901 2842903701 Bacteria 6986368
232 2902049988 2902048731 Bacteria 4976191
233 2946000246 2945997725 Bacteria 6404843
234 Ga0157378_10023782
235 rootH2_10196887
236 rootH1_10155535
237 Ga0070658_10003226
238 Ga0070658_10108503
239 Ga0070676_10001251
240 Ga0070670_100177302
241 Ga0068869_100021417
242 Ga0070666_10000913
243 Ga0070680_100060914
244 Ga0070682_100000306
245 Ga0070682_100000460
246 Ga0068868_100001760
247 Ga0068868_100015825
248 Ga0070660_100020708
249 Ga0070691_10001224
250 Ga0070668_100000036
251 Ga0070675_100050901
252 Ga0070671_100011552
253 Ga0070671_100046359
254 Ga0070673_100000556
255 Ga0070673_100156313
256 Ga0070659_100000854
257 Ga0070667_100000151
258 Ga0070667_100011374
259 Ga0070662_100001152
260 Ga0070662_100146278
261 Ga0070681_10023004
262 Ga0068867_100001821
263 Ga0070685_10069653
264 Ga0070679_100007747
265 Ga0068853_100115996
266 Ga0070672_100000471
267 Ga0070693_100030784
268 Ga0070693_100098019
269 Ga0070665_100001215
270 Ga0070665_100066825
271 Ga0068855_100001248
272 Ga0068855_100095976
273 Ga0068855_100496380
274 Ga0070664_100026009
275 Ga0070664_100052244
276 Ga0068857_100255757
277 Ga0070702_100057982
278 Ga0068852_100094095
279 Ga0068852_100603038
280 Ga0068859_100000026
281 Ga0068859_100184709
282 Ga0068864_100001161
283 Ga0068864_100018308
284 Ga0068864_100316386
285 Ga0068851_10002501
286 Ga0068863_100001435
287 Ga0068863_100035596
288 Ga0068858_100001071
289 Ga0068858_100067398
290 Ga0068858_100092182
291 Ga0068860_100000824
292 Ga0068860_100006095
293 Ga0068860_100019647
294 Ga0068860_100391487
295 Ga0081455_10006436
296 Ga0075366_10109368
297 Ga0097621_100004022
298 Ga0097621_100007197
299 Ga0097621_100059485
300 Ga0068871_100003690
301 Ga0068865_100003069
302 Ga0097620_100000026
303 Ga0097620_100184711
304 Ga0105240_10005793
305 Ga0105240_10019358
306 Ga0105240_10155628
307 Ga0105240_10383740
308 Ga0105245_10012935
309 Ga0105245_10035416
310 Ga0105247_10003205
311 Ga0105247_10012320
312 Ga0105243_10089572
313 Ga0105241_10000113
314 Ga0105241_10000739
315 Ga0105248_10077632
316 Ga0105238_10030766
317 Ga0105249_10007291
318 Ga0105249_10012247
319 Ga0105249_10016226
320 Ga0105249_10031972
321 Ga0105239_10019423
322 Ga0105239_10159466
323 Ga0105246_10015690
324 Ga0157373_10000161
325 Ga0157373_10001334
326 Ga0157373_10003110
327 Ga0157371_10223896
328 Ga0157370_10129633
329 Ga0157369_10046328
330 Ga0157369_10408171
331 Ga0157369_10504889
332 Ga0157374_10000153
333 Ga0157374_10002577
334 Ga0157378_10010369
335 Ga0157378_10258016
336 Ga0163162_10000040
337 Ga0163162_10029523
338 Ga0157372_10002309
339 Ga0157372_10227576
340 Ga0157372_10274047
341 Ga0157375_10000407
342 Ga0157375_10191021
343 Ga0163163_10000110
344 Ga0163163_10041043
345 Ga0163163_10210629
346 Ga0157380_10001466
347 Ga0157380_10222759
348 Ga0157377_10037977
349 Ga0157379_10000173
350 Ga0157379_10016328
351 Ga0157379_10056869
352 Ga0157379_10326899
353 Ga0157376_10000535
354 Ga0157376_10018612
355 Ga0157376_10056339
356 Ga0163161_10113499
357 Ga0197907_10213375
358 Ga0206355_1202739
359 Ga0206355_1209081
360 Ga0206351_10014417
361 Ga0206350_10159956
362 Ga0206350_10401402
363 Ga0209026_1000351
364 Ga0207710_10001464
365 Ga0207710_10010484
366 Ga0207680_10001727
367 Ga0207705_10003028
368 Ga0207654_10003203
369 Ga0207707_10000189
370 Ga0207695_10002088
371 Ga0207671_10073266
372 Ga0207660_10001432
373 Ga0207662_10211728
374 Ga0207657_10020350
375 Ga0207657_10484012
376 Ga0207652_10000488
377 Ga0207681_10068595
378 Ga0207694_10226276
379 Ga0207650_10104098
380 Ga0207659_10049001
381 Ga0207687_10011776
382 Ga0207690_10011362
383 Ga0207706_10002485
384 Ga0207704_10001601
385 Ga0207691_10000504
386 Ga0207691_10198653
387 Ga0207689_10029042
388 Ga0207689_10058561
389 Ga0207667_10005017
390 Ga0207667_10186787
391 Ga0207667_10410945
392 Ga0207651_10000164
393 Ga0207712_10028628
394 Ga0207712_10191814
395 Ga0207668_10000568
396 Ga0207658_10000225
397 Ga0207658_10096055
398 Ga0207658_10124532
399 Ga0207658_10220125
400 Ga0207677_10003499
401 Ga0207677_10013233
402 Ga0207677_10050302
403 Ga0207703_10001012
404 Ga0207703_10021902
405 Ga0207703_10128359
406 Ga0207639_10083279
407 Ga0207639_10143031
408 Ga0207641_10000155
409 Ga0207641_10006442
410 Ga0207641_10008788
411 Ga0207648_10013539
412 Ga0207676_10006768
413 Ga0207676_10013345
414 Ga0207676_10112939
415 Ga0207683_10326389
416 Ga0207698_10706678
417 Ga0268266_10001023
418 Ga0268264_10001646
419 Ga0268264_10059000
420 Ga0307515_10000363
421 Ga0316183_1096868
422 Ga0316181_1101548
423 Ga0316182_1019572
424 Ga0265327_10011303
425 Ga0395899_0145332
426 Ga0451807_1031808
427 Ga0451577_0009739
428 Ga0451577_0013930
429 Ga0451577_0157238
430 Ga0466972_0000422
431 Ga0453684_0006335
432 Ga0453684_0457641
433 Ga0466970_0001701
434 Ga0466960_0024051
435 Ga0451576_0060223
436 Ga0451576_0255567
437 Ga0495638_0119991
438 Ga0495594_0167424
439 Ga0495668_0001611
440 Ga0495672_0037754
441 Ga0495686_0012134
442 Ga0496108_0495320
443 Ga0496109_0031918
444 Ga0496114_0001392
445 Ga0501038_0080968
446 Ga0501038_0312234
447 Ga0501043_0178880
448 Ga0501046_0254170
449 Ga0501047_0128865
450 Ga0501068_0290898
451 Ga0501071_0248380
452 Ga0501247_001902
453 Ga0501079_0447072
454 Ga0501083_0071386
455 Ga0501044_0075924
456 Ga0501044_0162257
457 Ga0501044_0216523
458 Ga0500562_005204
459 Ga0500642_0183066
460 Ga0500568_0000407
461 Ga0500622_0000013
462 Ga0501084_0038969
463 2739644797
464 2842906901
465 2902049988
466 2946000246

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19420

DDAH_eukar

N,N dimethylarginine dimethylhydrolase, eukaryotic

49

333

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6juy-assembly1.cif.gz_C crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.8666 7 305
6jv0-assembly1.cif.gz_A crystal structure of n-terminal domain of argz, bound to product, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.8635 7 305
6jv1-assembly1.cif.gz_A crystal structure of n-terminal domain of argz, c264s mutant, bound to substrate, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.8592 7 305
6juz-assembly1.cif.gz_A crystal structure of n-terminal domain of argz(n71s) covalently bond to a reaction intermediate 0.8588 7 305
6juy-assembly1.cif.gz_D crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.8535 7 308
ID Description Score Start End Superfamily
af_Q86KZ6_15_316_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9541 15 298 3.75.10.10
af_Q8C5H8_56_229_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.8964 39 66 3.40.50.10330
af_Q86KZ6_15_316_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.895 15 298 3.75.10.10
af_Q4D5L9_1_215_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8805 124 295 3.75.10.10
af_A0A7I9BCB0_10_272_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8652 6 301 3.75.10.10
ID Description Score Start End GO Terms
AF-A0A519X4V2-F1-model_v4 Amidinotransferase 0.9988 187 304 GO:0016740
AF-A0A520DLR0-F1-model_v4 Amidinotransferase 0.9976 58 307 GO:0016740
AF-A0A7W1KSV6-F1-model_v4 Amidinotransferase 0.9948 64 307 GO:0016740
AF-A0A348VB39-F1-model_v4 Amidinotransferase 0.9947 133 301 GO:0016740
AF-A0A0B7I5I5-F1-model_v4 deleted 0.9945 193 302

Map