F345886

General Info

Members Datasets Scaffolds Average Seq Length
233 150 466 307

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100006762|Ga0070665_1000067625
Length 333
Sequence MRPISRRAFVAGAGAAAALAASRIEAMDALFEAPLYPPMDLSYFDTPVSPAPADIRLGYASITWGGKDLDAVADIAAAGYPGIQLRSNIVPAYEQRPQALADELAKHHLTLVALSSGAVSIDPAAEAQQLALHAGHARFLRACGGLYLQCTDERPKRALVPADYQRLGRLLTEIGKRTADAGVALGYHNHMGTIGERPDAVDWILDAADPKYVKLELDIAHYQQGGGDPVKAIRKYADRLLFLHIKDVEDMPGASGGPGSYRFVELGRGKVDVKGVFAAMRDVKFRGWAVVELDAVPDPDRRTPKESALINRKYLEDCGLTFHMPHATTRDQR

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
147 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
150 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.58
Nodule 0
Rhizoplane 1.72
Rhizosphere 91.85
Stem 0
Stem Tuber 0
Unclassified 16.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100006762 3300005548 Bacteria 11657
2 MBSR1b_contig_4478808 2162886012 Bacteria 1438
3 Ga0065712_10004244 3300005290 Bacteria 5150
4 Ga0065712_10009591 3300005290 Unclassified 4221
5 Ga0065712_10073130 3300005290 Bacteria 4494
6 Ga0065712_10098317 3300005290 Unclassified 2117
7 Ga0065715_10014775 3300005293 Bacteria 2114
8 Ga0065715_10172709 3300005293 Bacteria 1534
9 Ga0065715_10252400 3300005293 Bacteria 1163
10 Ga0065715_10253160 3300005293 Bacteria 1160
11 Ga0065707_10097363 3300005295 Bacteria 3181
12 Ga0070690_100013059 3300005330 Bacteria 4900
13 Ga0070670_100054802 3300005331 Bacteria 3423
14 Ga0070670_100433642 3300005331 Bacteria 1163
15 Ga0068869_100028562 3300005334 Bacteria 3899
16 Ga0068869_100312876 3300005334 Bacteria 1271
17 Ga0070666_10054588 3300005335 Bacteria 2696
18 Ga0070680_100004561 3300005336 Bacteria 10412
19 Ga0068868_100007847 3300005338 Bacteria 7616
20 Ga0068868_100041710 3300005338 Unclassified 3576
21 Ga0070689_100051143 3300005340 Bacteria 3193
22 Ga0070669_100016859 3300005353 Bacteria 5214
23 Ga0070675_100101696 3300005354 Bacteria 2422
24 Ga0070671_100003630 3300005355 Bacteria 12079
25 Ga0070671_100058789 3300005355 Unclassified 3199
26 Ga0070673_100394401 3300005364 Bacteria 1236
27 Ga0070688_100032847 3300005365 Bacteria 3133
28 Ga0070667_100401763 3300005367 Bacteria 1247
29 Ga0070709_10162321 3300005434 Bacteria 1555
30 Ga0070701_10023925 3300005438 Unclassified 2949
31 Ga0070694_100000183 3300005444 Bacteria 32881
32 Ga0070694_100135129 3300005444 Bacteria 1786
33 Ga0070694_100142200 3300005444 Bacteria 1744
34 Ga0070708_100000354 3300005445 Bacteria 34774
35 Ga0070708_100318444 3300005445 Bacteria 1465
36 Ga0070681_10000048 3300005458 Bacteria 82548
37 Ga0068867_100046367 3300005459 Bacteria 3192
38 Ga0070685_10022553 3300005466 Unclassified 3434
39 Ga0070706_100019869 3300005467 Bacteria 6193
40 Ga0070706_100141916 3300005467 Bacteria 2242
41 Ga0070707_100018709 3300005468 Bacteria 6520
42 Ga0070707_100239060 3300005468 Unclassified 1768
43 Ga0070698_100026448 3300005471 Bacteria 6040
44 Ga0070699_100004235 3300005518 Bacteria 12682
45 Ga0070699_100045144 3300005518 Bacteria 3814
46 Ga0070699_100202619 3300005518 Bacteria 1765
47 Ga0070679_100000361 3300005530 Bacteria 38685
48 Ga0070697_100000117 3300005536 Bacteria 62404
49 Ga0070697_100005323 3300005536 Bacteria 9889
50 Ga0070697_100367771 3300005536 Bacteria 1244
51 Ga0070672_100211731 3300005543 Bacteria 1623
52 Ga0070695_100017125 3300005545 Bacteria 4395
53 Ga0070696_100363405 3300005546 Bacteria 1124
54 Ga0070693_100085826 3300005547 Bacteria 1887
55 Ga0070704_100106947 3300005549 Bacteria 2121
56 Ga0070664_100050174 3300005564 Bacteria 3531
57 Ga0068854_100017185 3300005578 Unclassified 4837
58 Ga0068854_100052561 3300005578 Bacteria 2922
59 Ga0068856_100095344 3300005614 Bacteria 2963
60 Ga0070702_100007881 3300005615 Bacteria 5123
61 Ga0070702_100065715 3300005615 Bacteria 2125
62 Ga0068852_100182319 3300005616 Bacteria 1975
63 Ga0068859_100056236 3300005617 Unclassified 3959
64 Ga0068859_100133142 3300005617 Bacteria 2558
65 Ga0068864_100011398 3300005618 Bacteria 7343
66 Ga0068864_100120975 3300005618 Bacteria 2340
67 Ga0068861_100352194 3300005719 Bacteria 1292
68 Ga0068870_10142629 3300005840 Bacteria 1403
69 Ga0068870_10209112 3300005840 Bacteria 1187
70 Ga0068858_100019130 3300005842 Bacteria 6407
71 Ga0068858_100169454 3300005842 Unclassified 2058
72 Ga0068862_100052268 3300005844 Bacteria 3495
73 Ga0075365_10060410 3300006038 Unclassified 2529
74 Ga0075368_10017972 3300006042 Bacteria 2652
75 Ga0075364_10002419 3300006051 Bacteria 10458
76 Ga0075364_10039043 3300006051 Bacteria 3076
77 Ga0075362_10002231 3300006177 Bacteria 6443
78 Ga0075367_10009861 3300006178 Bacteria 5003
79 Ga0075366_10115344 3300006195 Unclassified 1617
80 Ga0097621_100006230 3300006237 Bacteria 8461
81 Ga0097621_100032505 3300006237 Bacteria 4148
82 Ga0068871_100001660 3300006358 Bacteria 14957
83 Ga0068871_100180806 3300006358 Bacteria 1812
84 Ga0075428_100046101 3300006844 Bacteria 4789
85 Ga0075431_100338031 3300006847 Bacteria 1515
86 Ga0075433_10467845 3300006852 Bacteria 1111
87 Ga0075434_100000082 3300006871 Bacteria 51181
88 Ga0075434_100034724 3300006871 Bacteria 4982
89 Ga0075434_100035064 3300006871 Unclassified 4959
90 Ga0075434_100350378 3300006871 Unclassified 1497
91 Ga0075429_100310781 3300006880 Bacteria 1380
92 Ga0068865_100020546 3300006881 Bacteria 4283
93 Ga0075436_100000178 3300006914 Bacteria 39723
94 Ga0075436_100019262 3300006914 Bacteria 4676
95 Ga0075436_100132119 3300006914 Bacteria 1751
96 Ga0097620_100056235 3300006931 Unclassified 3959
97 Ga0097620_100133141 3300006931 Bacteria 2558
98 Ga0075435_100000008 3300007076 Bacteria 115376
99 Ga0099794_10048284 3300007265 Bacteria 2043
100 Ga0111539_10182193 3300009094 Bacteria 2453
101 Ga0105245_10040957 3300009098 Unclassified 4128
102 Ga0105245_10200695 3300009098 Bacteria 1915
103 Ga0114129_10024439 3300009147 Bacteria 8561
104 Ga0114129_10026962 3300009147 Bacteria 8134
105 Ga0114129_10037021 3300009147 Bacteria 6889
106 Ga0114129_10075488 3300009147 Bacteria 4693
107 Ga0114129_10146777 3300009147 Bacteria 3231
108 Ga0114129_10222073 3300009147 Bacteria 2548
109 Ga0114129_10321610 3300009147 Bacteria 2056
110 Ga0114129_10373212 3300009147 Unclassified 1885
111 Ga0105242_10014750 3300009176 Bacteria 6052
112 Ga0105242_10046860 3300009176 Bacteria 3509
113 Ga0105242_10059948 3300009176 Bacteria 3124
114 Ga0105248_10013401 3300009177 Bacteria 9023
115 Ga0105248_10181143 3300009177 Bacteria 2374
116 Ga0105248_10224959 3300009177 Bacteria 2112
117 Ga0105248_10544949 3300009177 Bacteria 1309
118 Ga0105237_10053442 3300009545 Bacteria 4052
119 Ga0099796_10081375 3300010159 Bacteria 1188
120 Ga0105239_10333008 3300010375 Unclassified 1713
121 Ga0105246_10055077 3300011119 Bacteria 2743
122 Ga0157374_10029246 3300013296 Unclassified 4986
123 Ga0157374_10341156 3300013296 Unclassified 1487
124 Ga0157378_10019257 3300013297 Bacteria 5998
125 Ga0157378_10019422 3300013297 Bacteria 5974
126 Ga0157378_10450279 3300013297 Unclassified 1277
127 Ga0163162_10003516 3300013306 Bacteria 14983
128 Ga0163162_10035318 3300013306 Unclassified 4978
129 Ga0157372_10153026 3300013307 Bacteria 2663
130 Ga0157375_10313704 3300013308 Bacteria 1732
131 Ga0163163_10000302 3300014325 Bacteria 48452
132 Ga0163163_10001886 3300014325 Bacteria 17730
133 Ga0163163_10032457 3300014325 Bacteria 5043
134 Ga0163163_10098842 3300014325 Bacteria 2939
135 Ga0163163_10212351 3300014325 Bacteria 1984
136 Ga0157380_10007313 3300014326 Bacteria 7838
137 Ga0157380_10116218 3300014326 Bacteria 2257
138 Ga0157380_10165704 3300014326 Unclassified 1925
139 Ga0157376_10005746 3300014969 Bacteria 8690
140 Ga0157376_10013280 3300014969 Bacteria 6142
141 Ga0163161_10029788 3300017792 Unclassified 3880
142 Ga0213876_10219416 3300021384 Bacteria 1011
143 Ga0207697_10086009 3300025315 Bacteria 1329
144 Ga0207680_10026640 3300025903 Unclassified 3207
145 Ga0207699_10172316 3300025906 Bacteria 1449
146 Ga0207684_10017992 3300025910 Bacteria 6057
147 Ga0207684_10077556 3300025910 Bacteria 2826
148 Ga0207684_10331538 3300025910 Bacteria 1311
149 Ga0207707_10000015 3300025912 Bacteria 259670
150 Ga0207707_10270707 3300025912 Bacteria 1472
151 Ga0207693_10388870 3300025915 Unclassified 1091
152 Ga0207660_10003265 3300025917 Bacteria 10617
153 Ga0207652_10000487 3300025921 Bacteria 40568
154 Ga0207646_10218068 3300025922 Bacteria 1724
155 Ga0207681_10213521 3300025923 Bacteria 1489
156 Ga0207681_10224652 3300025923 Bacteria 1454
157 Ga0207659_10079172 3300025926 Bacteria 2424
158 Ga0207659_10335016 3300025926 Bacteria 1252
159 Ga0207687_10167628 3300025927 Unclassified 1691
160 Ga0207644_10006978 3300025931 Bacteria 7353
161 Ga0207706_10461981 3300025933 Bacteria 1098
162 Ga0207686_10062033 3300025934 Bacteria 2372
163 Ga0207686_10295542 3300025934 Unclassified 1201
164 Ga0207669_10026190 3300025937 Bacteria 3168
165 Ga0207704_10043845 3300025938 Bacteria 2645
166 Ga0207665_10042108 3300025939 Bacteria 3052
167 Ga0207665_10116721 3300025939 Bacteria 1881
168 Ga0207691_10003534 3300025940 Bacteria 15200
169 Ga0207711_10105832 3300025941 Bacteria 2495
170 Ga0207711_10298875 3300025941 Bacteria 1484
171 Ga0207689_10019191 3300025942 Bacteria 5765
172 Ga0207689_10039318 3300025942 Bacteria 3916
173 Ga0207679_10064486 3300025945 Bacteria 2738
174 Ga0207651_10298832 3300025960 Bacteria 1338
175 Ga0207640_10016630 3300025981 Bacteria 4285
176 Ga0207658_10358521 3300025986 Unclassified 1271
177 Ga0207677_10276514 3300026023 Bacteria 1376
178 Ga0207703_10046411 3300026035 Unclassified 3499
179 Ga0207639_10503678 3300026041 Bacteria 1107
180 Ga0207702_10153760 3300026078 Bacteria 2095
181 Ga0207641_10125007 3300026088 Unclassified 2301
182 Ga0207648_10011056 3300026089 Bacteria 8518
183 Ga0207676_10001983 3300026095 Bacteria 14901
184 Ga0207676_10102415 3300026095 Bacteria 2377
185 Ga0207674_10226978 3300026116 Bacteria 1815
186 Ga0207675_100025039 3300026118 Bacteria 5554
187 Ga0207683_10032795 3300026121 Unclassified 4512
188 Ga0207698_10270958 3300026142 Bacteria 1565
189 Ga0209813_10019311 3300027866 Bacteria 1893
190 Ga0207428_10240673 3300027907 Bacteria 1352
191 Ga0268266_10037881 3300028379 Bacteria 4106
192 Ga0268265_10094505 3300028380 Bacteria 2398
193 Ga0268265_10298367 3300028380 Unclassified 1450
194 Ga0268264_10483835 3300028381 Bacteria 1204
195 Ga0373939_0046476 3300035114 Bacteria 1329
196 Ga0436365_0411245 3300039437 Bacteria 1023
197 Ga0451576_0374633 3300045051 Bacteria 1492
198 Ga0495580_0203130 3300046472 Unclassified 1365
199 Ga0495662_0090321 3300046476 Bacteria 1493
200 Ga0495608_0160659 3300046511 Bacteria 1429
201 Ga0495658_0169606 3300046683 Bacteria 1350
202 Ga0495680_0113432 3300047322 Bacteria 2007
203 Ga0496102_0047244 3300048905 Bacteria 3911
204 Ga0496104_0166663 3300048907 Bacteria 2113
205 Ga0496112_0088422 3300048915 Bacteria 3066
206 Ga0496112_0209934 3300048915 Unclassified 1905
207 Ga0501034_0005060 3300049571 Bacteria 14484
208 nmdc:mga03683_703_c1 3300050489 Bacteria 9615
209 nmdc:mga00v17_14514_c1 3300050491 Bacteria 4399
210 nmdc:mga00v17_70754_c1 3300050491 Bacteria 2161
211 nmdc:mga0yw44_83778_c1 3300050492 Unclassified 2003
212 nmdc:mga05p37_106532_c1 3300050507 Bacteria 3449
213 nmdc:mga05p37_175474_c1 3300050507 Bacteria 2611
214 nmdc:mga05p37_186838_c1 3300050507 Bacteria 2519
215 nmdc:mga05p37_271424_c1 3300050507 Bacteria 2026
216 nmdc:mga05p37_48270_c2 3300050507 Bacteria 4682
217 nmdc:mga05p37_855558_c1 3300050507 Bacteria 987
218 nmdc:mga09592_178744_c1 3300050508 Bacteria 1835
219 nmdc:mga06r32_597883_c1 3300050510 Bacteria 1074
220 nmdc:mga08y16_390410_c1 3300050511 Bacteria 1426
221 nmdc:mga0n895_155909_c1 3300050512 Bacteria 2314
222 nmdc:mga0n895_16927_c1 3300050512 Bacteria 6705
223 nmdc:mga0n895_176314_c1 3300050512 Unclassified 2168
224 nmdc:mga0n895_7_c1 3300050512 Bacteria 121855
225 nmdc:mga0n895_89940_c1 3300050512 Unclassified 3071
226 nmdc:mga0rr50_137682_c1 3300050513 Bacteria 1961
227 nmdc:mga0rr50_26566_c1 3300050513 Bacteria 4041
228 nmdc:mga0rr50_3_c1 3300050513 Bacteria 353622
229 nmdc:mga08x19_179_c1 3300050514 Bacteria 50938
230 nmdc:mga0a205_113893_c1 3300050515 Bacteria 2603
231 nmdc:mga0a205_16233_c1 3300050515 Bacteria 6973
232 Ga0495619_0158630 3300053085 Bacteria 1562
233 Ga0500645_004221 3300053730 Bacteria 5587
234 Ga0070665_100006762
235 MBSR1b_contig_4478808
236 Ga0065712_10004244
237 Ga0065712_10009591
238 Ga0065712_10073130
239 Ga0065712_10098317
240 Ga0065715_10014775
241 Ga0065715_10172709
242 Ga0065715_10252400
243 Ga0065715_10253160
244 Ga0065707_10097363
245 Ga0070690_100013059
246 Ga0070670_100054802
247 Ga0070670_100433642
248 Ga0068869_100028562
249 Ga0068869_100312876
250 Ga0070666_10054588
251 Ga0070680_100004561
252 Ga0068868_100007847
253 Ga0068868_100041710
254 Ga0070689_100051143
255 Ga0070669_100016859
256 Ga0070675_100101696
257 Ga0070671_100003630
258 Ga0070671_100058789
259 Ga0070673_100394401
260 Ga0070688_100032847
261 Ga0070667_100401763
262 Ga0070709_10162321
263 Ga0070701_10023925
264 Ga0070694_100000183
265 Ga0070694_100135129
266 Ga0070694_100142200
267 Ga0070708_100000354
268 Ga0070708_100318444
269 Ga0070681_10000048
270 Ga0068867_100046367
271 Ga0070685_10022553
272 Ga0070706_100019869
273 Ga0070706_100141916
274 Ga0070707_100018709
275 Ga0070707_100239060
276 Ga0070698_100026448
277 Ga0070699_100004235
278 Ga0070699_100045144
279 Ga0070699_100202619
280 Ga0070679_100000361
281 Ga0070697_100000117
282 Ga0070697_100005323
283 Ga0070697_100367771
284 Ga0070672_100211731
285 Ga0070695_100017125
286 Ga0070696_100363405
287 Ga0070693_100085826
288 Ga0070704_100106947
289 Ga0070664_100050174
290 Ga0068854_100017185
291 Ga0068854_100052561
292 Ga0068856_100095344
293 Ga0070702_100007881
294 Ga0070702_100065715
295 Ga0068852_100182319
296 Ga0068859_100056236
297 Ga0068859_100133142
298 Ga0068864_100011398
299 Ga0068864_100120975
300 Ga0068861_100352194
301 Ga0068870_10142629
302 Ga0068870_10209112
303 Ga0068858_100019130
304 Ga0068858_100169454
305 Ga0068862_100052268
306 Ga0075365_10060410
307 Ga0075368_10017972
308 Ga0075364_10002419
309 Ga0075364_10039043
310 Ga0075362_10002231
311 Ga0075367_10009861
312 Ga0075366_10115344
313 Ga0097621_100006230
314 Ga0097621_100032505
315 Ga0068871_100001660
316 Ga0068871_100180806
317 Ga0075428_100046101
318 Ga0075431_100338031
319 Ga0075433_10467845
320 Ga0075434_100000082
321 Ga0075434_100034724
322 Ga0075434_100035064
323 Ga0075434_100350378
324 Ga0075429_100310781
325 Ga0068865_100020546
326 Ga0075436_100000178
327 Ga0075436_100019262
328 Ga0075436_100132119
329 Ga0097620_100056235
330 Ga0097620_100133141
331 Ga0075435_100000008
332 Ga0099794_10048284
333 Ga0111539_10182193
334 Ga0105245_10040957
335 Ga0105245_10200695
336 Ga0114129_10024439
337 Ga0114129_10026962
338 Ga0114129_10037021
339 Ga0114129_10075488
340 Ga0114129_10146777
341 Ga0114129_10222073
342 Ga0114129_10321610
343 Ga0114129_10373212
344 Ga0105242_10014750
345 Ga0105242_10046860
346 Ga0105242_10059948
347 Ga0105248_10013401
348 Ga0105248_10181143
349 Ga0105248_10224959
350 Ga0105248_10544949
351 Ga0105237_10053442
352 Ga0099796_10081375
353 Ga0105239_10333008
354 Ga0105246_10055077
355 Ga0157374_10029246
356 Ga0157374_10341156
357 Ga0157378_10019257
358 Ga0157378_10019422
359 Ga0157378_10450279
360 Ga0163162_10003516
361 Ga0163162_10035318
362 Ga0157372_10153026
363 Ga0157375_10313704
364 Ga0163163_10000302
365 Ga0163163_10001886
366 Ga0163163_10032457
367 Ga0163163_10098842
368 Ga0163163_10212351
369 Ga0157380_10007313
370 Ga0157380_10116218
371 Ga0157380_10165704
372 Ga0157376_10005746
373 Ga0157376_10013280
374 Ga0163161_10029788
375 Ga0213876_10219416
376 Ga0207697_10086009
377 Ga0207680_10026640
378 Ga0207699_10172316
379 Ga0207684_10017992
380 Ga0207684_10077556
381 Ga0207684_10331538
382 Ga0207707_10000015
383 Ga0207707_10270707
384 Ga0207693_10388870
385 Ga0207660_10003265
386 Ga0207652_10000487
387 Ga0207646_10218068
388 Ga0207681_10213521
389 Ga0207681_10224652
390 Ga0207659_10079172
391 Ga0207659_10335016
392 Ga0207687_10167628
393 Ga0207644_10006978
394 Ga0207706_10461981
395 Ga0207686_10062033
396 Ga0207686_10295542
397 Ga0207669_10026190
398 Ga0207704_10043845
399 Ga0207665_10042108
400 Ga0207665_10116721
401 Ga0207691_10003534
402 Ga0207711_10105832
403 Ga0207711_10298875
404 Ga0207689_10019191
405 Ga0207689_10039318
406 Ga0207679_10064486
407 Ga0207651_10298832
408 Ga0207640_10016630
409 Ga0207658_10358521
410 Ga0207677_10276514
411 Ga0207703_10046411
412 Ga0207639_10503678
413 Ga0207702_10153760
414 Ga0207641_10125007
415 Ga0207648_10011056
416 Ga0207676_10001983
417 Ga0207676_10102415
418 Ga0207674_10226978
419 Ga0207675_100025039
420 Ga0207683_10032795
421 Ga0207698_10270958
422 Ga0209813_10019311
423 Ga0207428_10240673
424 Ga0268266_10037881
425 Ga0268265_10094505
426 Ga0268265_10298367
427 Ga0268264_10483835
428 Ga0373939_0046476
429 Ga0436365_0411245
430 Ga0451576_0374633
431 Ga0495580_0203130
432 Ga0495662_0090321
433 Ga0495608_0160659
434 Ga0495658_0169606
435 Ga0495680_0113432
436 Ga0496102_0047244
437 Ga0496104_0166663
438 Ga0496112_0088422
439 Ga0496112_0209934
440 Ga0501034_0005060
441 nmdc:mga03683_703_c1
442 nmdc:mga00v17_14514_c1
443 nmdc:mga00v17_70754_c1
444 nmdc:mga0yw44_83778_c1
445 nmdc:mga05p37_106532_c1
446 nmdc:mga05p37_175474_c1
447 nmdc:mga05p37_186838_c1
448 nmdc:mga05p37_271424_c1
449 nmdc:mga05p37_48270_c2
450 nmdc:mga05p37_855558_c1
451 nmdc:mga09592_178744_c1
452 nmdc:mga06r32_597883_c1
453 nmdc:mga08y16_390410_c1
454 nmdc:mga0n895_155909_c1
455 nmdc:mga0n895_16927_c1
456 nmdc:mga0n895_176314_c1
457 nmdc:mga0n895_7_c1
458 nmdc:mga0n895_89940_c1
459 nmdc:mga0rr50_137682_c1
460 nmdc:mga0rr50_26566_c1
461 nmdc:mga0rr50_3_c1
462 nmdc:mga08x19_179_c1
463 nmdc:mga0a205_113893_c1
464 nmdc:mga0a205_16233_c1
465 Ga0495619_0158630
466 Ga0500645_004221

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

72

317

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ju2-assembly1.cif.gz_A crystal structure of protein smc04130 from sinorhizobium meliloti 1021 0.8288 42 299
1i6n-assembly1.cif.gz_A 1.8 a crystal structure of ioli protein with a binding zinc atom 0.8262 40 302
3cny-assembly2.cif.gz_B crystal structure of a putative inositol catabolism protein iole (iole, lp_3607) from lactobacillus plantarum wcfs1 at 1.85 a resolution 0.8259 33 302
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8253 53 278
7vpf-assembly1.cif.gz_B crystal structure of a novel putative sugar isomerase from the psychrophilic bacterium paenibacillus sp. r4 0.8153 36 301
ID Description Score Start End Superfamily
3cnyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8348 34 302 3.20.20.150
3qc0A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8104 42 299 3.20.20.150
1i60A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8085 40 305 3.20.20.150
3lmzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8066 37 296 3.20.20.150
3vylH00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8042 39 306 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A2V7RFM1-F1-model_v4 Xylose isomerase 0.9795 51 307 GO:0016853
AF-A0A2V8M606-F1-model_v4 Xylose isomerase 0.9728 138 308 GO:0016853
AF-A0A2V8M606-F1-model_v4 Xylose isomerase 0.9672 138 308 GO:0016853
AF-A0A2V7VAZ3-F1-model_v4 Xylose isomerase 0.966 116 296 GO:0016853
AF-A0A2V7VAZ3-F1-model_v4 Xylose isomerase 0.9505 116 296 GO:0016853

Map