F345849

General Info

Members Datasets Scaffolds Average Seq Length
233 137 466 628

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100009973|Ga0070706_1000099735
Length 726
Sequence MRLCRVPCGKALPYRKLISYSGGYASVKFLRHSLRKLTTFPERRSLSARKAASRKTRHKVKEFPVIKSNIASMTRALVSGFFLFCILATSFTTNAADETRHVPTIDELLTLKAIGGAQISPGGQWVAYTVTNADFKQDAFVTQIWLAETSGKGRTLQLSRGEKSSTNPRWSPDGEWLAFTSNRVEDKNQIFVINPTGEPVPQVSKDRKDYLGDYEVVRKDYNFAYLWTFNVSEAMKGPLVGKQRTKKKDFSVDSFSWSHDGSKIAFSATVNPDLIQGVTSDVYLLDLADDAVTKLVSQPGPDSGPRWSPDDKQIVFSSAMGNTVFFASNSRLALVPAAGGTPRSITDSFDENPNLLDWWSDGIYFTGQQKTASHLFRVDPASGKVTRVSGPDSLMAGSFSFTRDGRQLSFTAASPTSLNEVFVSDAQKFSPRSLTNMTEQTKPLLLGTREVVSWKSTDGTTIEGVLIKPADFDPAKKYPLLCVIHGGPTGVDRPALLTPDARYYPSDIWAARGALVLKVNYRGSAGYGEKFRKLNVRNLGVGDAWDVLSGVDYLISKGWVDKDKVGCMGWSQGGYISAFLTASSDRFVAISVGAGISNWATYYYNTDITPFTINYLGKNPVDDPEIYQKTSPISYVKNARTPTLIQHGELDRRVPIANAYELRQALEDKGVRVEMIVYKGFGHPITKPKAMRAVMSHNLGWFNHYLWNDPLPDFASPDVPKQESKK

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
117 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
130 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
131 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
132 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
133 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
135 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
136 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3
Nodule 0
Rhizoplane 3
Rhizosphere 92.7
Stem 0
Stem Tuber 0
Unclassified 12.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100009973 3300005467 Bacteria 8824
2 JGI24034J14986_100154 3300001432 Bacteria 3396
3 JGI24748J21848_1000002 3300002074 Bacteria 426946
4 JGI24034J26672_10000004 3300002239 Bacteria 426946
5 Ga0065714_10075955 3300005288 Bacteria 2831
6 Ga0065712_10068198 3300005290 Bacteria 13168
7 Ga0065715_10000198 3300005293 Bacteria 35810
8 Ga0065715_10096925 3300005293 Bacteria 3794
9 Ga0065715_10099548 3300005293 Bacteria 3397
10 Ga0065715_10103323 3300005293 Bacteria 3019
11 Ga0065715_10111542 3300005293 Bacteria 2570
12 Ga0070670_100002514 3300005331 Bacteria 15120
13 Ga0068869_100002640 3300005334 Bacteria 10832
14 Ga0068869_100012864 3300005334 Bacteria 5541
15 Ga0070680_100036299 3300005336 Unclassified 3982
16 Ga0070669_100005403 3300005353 Bacteria 9213
17 Ga0070669_100017443 3300005353 Bacteria 5121
18 Ga0070675_100014437 3300005354 Bacteria 6228
19 Ga0070671_100033769 3300005355 Bacteria 4234
20 Ga0070671_100063547 3300005355 Bacteria 3074
21 Ga0070673_100064515 3300005364 Unclassified 2918
22 Ga0070659_100032968 3300005366 Bacteria 4022
23 Ga0070667_100104691 3300005367 Unclassified 2448
24 Ga0070703_10000044 3300005406 Bacteria 61258
25 Ga0070705_100006994 3300005440 Bacteria 5548
26 Ga0070700_100011544 3300005441 Bacteria 4896
27 Ga0070694_100001838 3300005444 Bacteria 12566
28 Ga0070694_100004465 3300005444 Bacteria 8412
29 Ga0070694_100012517 3300005444 Bacteria 5277
30 Ga0070694_100017888 3300005444 Bacteria 4486
31 Ga0070708_100005976 3300005445 Bacteria 9676
32 Ga0070678_100009440 3300005456 Bacteria 5913
33 Ga0070678_100072187 3300005456 Unclassified 2586
34 Ga0070681_10002361 3300005458 Bacteria 17228
35 Ga0070681_10053110 3300005458 Unclassified 4038
36 Ga0068867_100038903 3300005459 Unclassified 3465
37 Ga0070706_100001377 3300005467 Bacteria 25835
38 Ga0070706_100005966 3300005467 Bacteria 11526
39 Ga0070706_100032710 3300005467 Bacteria 4798
40 Ga0070707_100000303 3300005468 Bacteria 48187
41 Ga0070707_100029807 3300005468 Bacteria 5192
42 Ga0070707_100035053 3300005468 Bacteria 4786
43 Ga0070707_100091798 3300005468 Bacteria 2940
44 Ga0070698_100000564 3300005471 Bacteria 39746
45 Ga0070698_100000676 3300005471 Bacteria 36451
46 Ga0070698_100001132 3300005471 Bacteria 29495
47 Ga0070698_100020264 3300005471 Bacteria 6970
48 Ga0070698_100024305 3300005471 Bacteria 6321
49 Ga0070698_100042424 3300005471 Bacteria 4666
50 Ga0070699_100002861 3300005518 Bacteria 15387
51 Ga0070679_100021845 3300005530 Bacteria 6250
52 Ga0070684_100001550 3300005535 Bacteria 16589
53 Ga0070697_100000976 3300005536 Bacteria 21590
54 Ga0070686_100030383 3300005544 Bacteria 3295
55 Ga0070696_100007062 3300005546 Bacteria 7498
56 Ga0070665_100010295 3300005548 Bacteria 9461
57 Ga0070704_100050319 3300005549 Unclassified 2928
58 Ga0070664_100003105 3300005564 Bacteria 13433
59 Ga0070664_100013173 3300005564 Bacteria 6733
60 Ga0068857_100012119 3300005577 Bacteria 7498
61 Ga0068859_100023892 3300005617 Bacteria 6134
62 Ga0068859_100033997 3300005617 Bacteria 5118
63 Ga0068864_100018265 3300005618 Bacteria 5856
64 Ga0068864_100082450 3300005618 Bacteria 2822
65 Ga0068864_100092156 3300005618 Bacteria 2674
66 Ga0068861_100044246 3300005719 Unclassified 3347
67 Ga0068863_100013987 3300005841 Bacteria 7734
68 Ga0068858_100000067 3300005842 Bacteria 106455
69 Ga0068858_100018418 3300005842 Bacteria 6537
70 Ga0068860_100018208 3300005843 Bacteria 6837
71 Ga0068860_100063411 3300005843 Unclassified 3510
72 Ga0068860_100071873 3300005843 Unclassified 3287
73 Ga0081455_10001996 3300005937 Bacteria 24363
74 Ga0081455_10028311 3300005937 Bacteria 5120
75 Ga0081539_10000087 3300005985 Bacteria 214031
76 Ga0081539_10002196 3300005985 Bacteria 28570
77 Ga0075368_10006362 3300006042 Bacteria 4122
78 Ga0070715_10000019 3300006163 Bacteria 122990
79 Ga0070716_100000004 3300006173 Bacteria 296614
80 Ga0075367_10001602 3300006178 Bacteria 9824
81 Ga0097621_100008423 3300006237 Bacteria 7427
82 Ga0097621_100026558 3300006237 Bacteria 4544
83 Ga0097621_100054334 3300006237 Unclassified 3266
84 Ga0068871_100029556 3300006358 Unclassified 4305
85 Ga0068871_100045521 3300006358 Bacteria 3531
86 Ga0075428_100001260 3300006844 Bacteria 27027
87 Ga0075428_100005117 3300006844 Bacteria 14572
88 Ga0075430_100000363 3300006846 Bacteria 33258
89 Ga0075430_100018236 3300006846 Bacteria 5973
90 Ga0075431_100011390 3300006847 Bacteria 8959
91 Ga0075431_100067247 3300006847 Bacteria 3699
92 Ga0075431_100102980 3300006847 Bacteria 2946
93 Ga0075433_10045145 3300006852 Bacteria 3830
94 Ga0075433_10052581 3300006852 Unclassified 3550
95 Ga0075434_100125719 3300006871 Bacteria 2581
96 Ga0075429_100000831 3300006880 Bacteria 24224
97 Ga0068865_100032152 3300006881 Bacteria 3503
98 Ga0075436_100000093 3300006914 Bacteria 52002
99 Ga0075436_100009417 3300006914 Bacteria 6677
100 Ga0097620_100023892 3300006931 Bacteria 6134
101 Ga0097620_100033997 3300006931 Bacteria 5118
102 Ga0111539_10000191 3300009094 Bacteria 71382
103 Ga0111539_10000472 3300009094 Bacteria 50726
104 Ga0111539_10009676 3300009094 Bacteria 12166
105 Ga0105247_10000005 3300009101 Bacteria 426989
106 Ga0114129_10000006 3300009147 Bacteria 157531
107 Ga0114129_10000490 3300009147 Bacteria 47893
108 Ga0114129_10053972 3300009147 Bacteria 5636
109 Ga0114129_10072387 3300009147 Bacteria 4805
110 Ga0114129_10161770 3300009147 Bacteria 3057
111 Ga0114129_10234270 3300009147 Unclassified 2471
112 Ga0105243_10000112 3300009148 Bacteria 93493
113 Ga0105243_10022455 3300009148 Bacteria 4796
114 Ga0105242_10000067 3300009176 Bacteria 73482
115 Ga0105242_10005049 3300009176 Bacteria 10191
116 Ga0105242_10010402 3300009176 Bacteria 7137
117 Ga0105248_10086996 3300009177 Unclassified 3516
118 Ga0105237_10005237 3300009545 Bacteria 14674
119 Ga0105237_10098062 3300009545 Bacteria 2922
120 Ga0105246_10055987 3300011119 Bacteria 2724
121 Ga0157373_10044685 3300013100 Unclassified 3162
122 Ga0157378_10001680 3300013297 Bacteria 19944
123 Ga0157378_10004639 3300013297 Bacteria 12050
124 Ga0157378_10027444 3300013297 Bacteria 5025
125 Ga0163162_10004103 3300013306 Bacteria 13976
126 Ga0163162_10005471 3300013306 Bacteria 12276
127 Ga0163162_10013706 3300013306 Bacteria 7919
128 Ga0163163_10008561 3300014325 Bacteria 9094
129 Ga0163163_10124718 3300014325 Unclassified 2612
130 Ga0157377_10036196 3300014745 Bacteria 2714
131 Ga0157376_10051641 3300014969 Bacteria 3415
132 Ga0157376_10075580 3300014969 Bacteria 2875
133 Ga0163161_10011875 3300017792 Bacteria 6042
134 Ga0163161_10017488 3300017792 Bacteria 5017
135 Ga0213876_10017229 3300021384 Bacteria 3814
136 Ga0207672_1000108 3300025223 Bacteria 11430
137 Ga0207697_10001751 3300025315 Bacteria 11667
138 Ga0207697_10015228 3300025315 Bacteria 3179
139 Ga0207697_10023281 3300025315 Bacteria 2536
140 Ga0207653_10000366 3300025885 Bacteria 21213
141 Ga0207710_10000004 3300025900 Bacteria 846540
142 Ga0207685_10000021 3300025905 Bacteria 131248
143 Ga0207684_10001639 3300025910 Bacteria 23761
144 Ga0207684_10007011 3300025910 Bacteria 10191
145 Ga0207707_10000004 3300025912 Bacteria 391281
146 Ga0207707_10007223 3300025912 Bacteria 9668
147 Ga0207707_10033884 3300025912 Unclassified 4469
148 Ga0207660_10002922 3300025917 Bacteria 11166
149 Ga0207662_10053062 3300025918 Unclassified 2414
150 Ga0207652_10027953 3300025921 Bacteria 4703
151 Ga0207681_10006434 3300025923 Bacteria 7212
152 Ga0207681_10030667 3300025923 Unclassified 3507
153 Ga0207650_10017749 3300025925 Bacteria 4985
154 Ga0207659_10022897 3300025926 Bacteria 4166
155 Ga0207644_10067888 3300025931 Bacteria 2600
156 Ga0207686_10000006 3300025934 Bacteria 259583
157 Ga0207686_10000209 3300025934 Bacteria 44597
158 Ga0207686_10000604 3300025934 Bacteria 22462
159 Ga0207709_10000037 3300025935 Bacteria 279771
160 Ga0207665_10000006 3300025939 Bacteria 184957
161 Ga0207691_10020185 3300025940 Bacteria 6302
162 Ga0207711_10004479 3300025941 Bacteria 11908
163 Ga0207711_10036387 3300025941 Unclassified 4177
164 Ga0207711_10048650 3300025941 Bacteria 3627
165 Ga0207689_10004801 3300025942 Bacteria 12193
166 Ga0207689_10005680 3300025942 Bacteria 11099
167 Ga0207689_10017490 3300025942 Bacteria 6066
168 Ga0207689_10030388 3300025942 Bacteria 4502
169 Ga0207651_10085652 3300025960 Bacteria 2287
170 Ga0207677_10037675 3300026023 Unclassified 3162
171 Ga0207703_10000323 3300026035 Bacteria 52038
172 Ga0207708_10008307 3300026075 Bacteria 7688
173 Ga0207641_10010950 3300026088 Bacteria 7433
174 Ga0207674_10000663 3300026116 Bacteria 44727
175 Ga0207674_10067078 3300026116 Unclassified 3613
176 Ga0207674_10095563 3300026116 Bacteria 2958
177 Ga0207675_100000347 3300026118 Bacteria 44211
178 Ga0207675_100034438 3300026118 Unclassified 4723
179 Ga0207675_100088929 3300026118 Unclassified 2902
180 Ga0207683_10017294 3300026121 Bacteria 6143
181 Ga0207428_10000583 3300027907 Bacteria 43081
182 Ga0207428_10001992 3300027907 Bacteria 20712
183 Ga0207428_10003079 3300027907 Bacteria 16408
184 Ga0207428_10019456 3300027907 Bacteria 5788
185 Ga0207428_10066455 3300027907 Bacteria 2841
186 Ga0268264_10074896 3300028381 Bacteria 2877
187 Ga0307408_100002843 3300031548 Bacteria 12008
188 Ga0307408_100021740 3300031548 Bacteria 4346
189 Ga0307416_100039704 3300032002 Bacteria 3648
190 Ga0373937_0052040 3300036401 Bacteria 3754
191 Ga0373937_0123481 3300036401 Unclassified 2414
192 Ga0395899_0018401 3300037312 Bacteria 5312
193 Ga0395898_0164393 3300037466 Bacteria 2123
194 Ga0395901_0024803 3300038443 Bacteria 6155
195 Ga0400489_40376 3300039093 Bacteria 2348
196 Ga0436365_1881959 3300039437 Bacteria 7514
197 Ga0451577_0011215 3300042876 Bacteria 8498
198 Ga0495638_0011956 3300046460 Bacteria 5967
199 Ga0495598_0000049 3300046537 Bacteria 18657
200 Ga0495621_0000100 3300046539 Bacteria 17826
201 Ga0496107_0076874 3300048910 Bacteria 2432
202 Ga0496108_0061387 3300048911 Bacteria 3163
203 Ga0496109_0000110 3300048912 Bacteria 85627
204 Ga0496109_0000735 3300048912 Bacteria 27260
205 Ga0496109_0141365 3300048912 Bacteria 2251
206 Ga0496112_0000222 3300048915 Bacteria 36912
207 Ga0496112_0001137 3300048915 Bacteria 19815
208 Ga0501298_002595 3300049521 Bacteria 2749
209 Ga0501040_0013358 3300049576 Bacteria 5396
210 nmdc:mga05p37_141622_c1 3300050507 Bacteria 2946
211 nmdc:mga05p37_25_c1 3300050507 Bacteria 116982
212 nmdc:mga05p37_2676_c1 3300050507 Bacteria 20740
213 nmdc:mga05p37_57804_c1 3300050507 Bacteria 4776
214 nmdc:mga09592_42884_c1 3300050508 Bacteria 3806
215 nmdc:mga09592_49442_c1 3300050508 Bacteria 3545
216 nmdc:mga06r32_10364_c1 3300050510 Bacteria 8408
217 nmdc:mga06r32_2008_c1 3300050510 Bacteria 18193
218 nmdc:mga06r32_93537_c1 3300050510 Bacteria 2940
219 nmdc:mga08y16_34288_c1 3300050511 Bacteria 5333
220 nmdc:mga08y16_62209_c1 3300050511 Bacteria 3898
221 nmdc:mga0n895_149545_c1 3300050512 Bacteria 2365
222 nmdc:mga0rr50_1844_c1 3300050513 Bacteria 11733
223 nmdc:mga08x19_27_c1 3300050514 Bacteria 226652
224 nmdc:mga08x19_43425_c1 3300050514 Bacteria 2868
225 nmdc:mga0a205_42834_c1 3300050515 Bacteria 4363
226 nmdc:mga0a205_57969_c1 3300050515 Bacteria 3740
227 nmdc:mga0a205_83327_c1 3300050515 Unclassified 3088
228 Ga0500555_000303 3300053103 Bacteria 21262
229 Ga0500568_0001484 3300053139 Bacteria 15031
230 Ga0500616_0000691 3300053153 Bacteria 39462
231 Ga0500645_000028 3300053730 Bacteria 123681
232 Ga0500599_000283 3300053736 Bacteria 4918
233 Ga0501084_0045102 3300054114 Unclassified 3692
234 Ga0070706_100009973
235 JGI24034J14986_100154
236 JGI24748J21848_1000002
237 JGI24034J26672_10000004
238 Ga0065714_10075955
239 Ga0065712_10068198
240 Ga0065715_10000198
241 Ga0065715_10096925
242 Ga0065715_10099548
243 Ga0065715_10103323
244 Ga0065715_10111542
245 Ga0070670_100002514
246 Ga0068869_100002640
247 Ga0068869_100012864
248 Ga0070680_100036299
249 Ga0070669_100005403
250 Ga0070669_100017443
251 Ga0070675_100014437
252 Ga0070671_100033769
253 Ga0070671_100063547
254 Ga0070673_100064515
255 Ga0070659_100032968
256 Ga0070667_100104691
257 Ga0070703_10000044
258 Ga0070705_100006994
259 Ga0070700_100011544
260 Ga0070694_100001838
261 Ga0070694_100004465
262 Ga0070694_100012517
263 Ga0070694_100017888
264 Ga0070708_100005976
265 Ga0070678_100009440
266 Ga0070678_100072187
267 Ga0070681_10002361
268 Ga0070681_10053110
269 Ga0068867_100038903
270 Ga0070706_100001377
271 Ga0070706_100005966
272 Ga0070706_100032710
273 Ga0070707_100000303
274 Ga0070707_100029807
275 Ga0070707_100035053
276 Ga0070707_100091798
277 Ga0070698_100000564
278 Ga0070698_100000676
279 Ga0070698_100001132
280 Ga0070698_100020264
281 Ga0070698_100024305
282 Ga0070698_100042424
283 Ga0070699_100002861
284 Ga0070679_100021845
285 Ga0070684_100001550
286 Ga0070697_100000976
287 Ga0070686_100030383
288 Ga0070696_100007062
289 Ga0070665_100010295
290 Ga0070704_100050319
291 Ga0070664_100003105
292 Ga0070664_100013173
293 Ga0068857_100012119
294 Ga0068859_100023892
295 Ga0068859_100033997
296 Ga0068864_100018265
297 Ga0068864_100082450
298 Ga0068864_100092156
299 Ga0068861_100044246
300 Ga0068863_100013987
301 Ga0068858_100000067
302 Ga0068858_100018418
303 Ga0068860_100018208
304 Ga0068860_100063411
305 Ga0068860_100071873
306 Ga0081455_10001996
307 Ga0081455_10028311
308 Ga0081539_10000087
309 Ga0081539_10002196
310 Ga0075368_10006362
311 Ga0070715_10000019
312 Ga0070716_100000004
313 Ga0075367_10001602
314 Ga0097621_100008423
315 Ga0097621_100026558
316 Ga0097621_100054334
317 Ga0068871_100029556
318 Ga0068871_100045521
319 Ga0075428_100001260
320 Ga0075428_100005117
321 Ga0075430_100000363
322 Ga0075430_100018236
323 Ga0075431_100011390
324 Ga0075431_100067247
325 Ga0075431_100102980
326 Ga0075433_10045145
327 Ga0075433_10052581
328 Ga0075434_100125719
329 Ga0075429_100000831
330 Ga0068865_100032152
331 Ga0075436_100000093
332 Ga0075436_100009417
333 Ga0097620_100023892
334 Ga0097620_100033997
335 Ga0111539_10000191
336 Ga0111539_10000472
337 Ga0111539_10009676
338 Ga0105247_10000005
339 Ga0114129_10000006
340 Ga0114129_10000490
341 Ga0114129_10053972
342 Ga0114129_10072387
343 Ga0114129_10161770
344 Ga0114129_10234270
345 Ga0105243_10000112
346 Ga0105243_10022455
347 Ga0105242_10000067
348 Ga0105242_10005049
349 Ga0105242_10010402
350 Ga0105248_10086996
351 Ga0105237_10005237
352 Ga0105237_10098062
353 Ga0105246_10055987
354 Ga0157373_10044685
355 Ga0157378_10001680
356 Ga0157378_10004639
357 Ga0157378_10027444
358 Ga0163162_10004103
359 Ga0163162_10005471
360 Ga0163162_10013706
361 Ga0163163_10008561
362 Ga0163163_10124718
363 Ga0157377_10036196
364 Ga0157376_10051641
365 Ga0157376_10075580
366 Ga0163161_10011875
367 Ga0163161_10017488
368 Ga0213876_10017229
369 Ga0207672_1000108
370 Ga0207697_10001751
371 Ga0207697_10015228
372 Ga0207697_10023281
373 Ga0207653_10000366
374 Ga0207710_10000004
375 Ga0207685_10000021
376 Ga0207684_10001639
377 Ga0207684_10007011
378 Ga0207707_10000004
379 Ga0207707_10007223
380 Ga0207707_10033884
381 Ga0207660_10002922
382 Ga0207662_10053062
383 Ga0207652_10027953
384 Ga0207681_10006434
385 Ga0207681_10030667
386 Ga0207650_10017749
387 Ga0207659_10022897
388 Ga0207644_10067888
389 Ga0207686_10000006
390 Ga0207686_10000209
391 Ga0207686_10000604
392 Ga0207709_10000037
393 Ga0207665_10000006
394 Ga0207691_10020185
395 Ga0207711_10004479
396 Ga0207711_10036387
397 Ga0207711_10048650
398 Ga0207689_10004801
399 Ga0207689_10005680
400 Ga0207689_10017490
401 Ga0207689_10030388
402 Ga0207651_10085652
403 Ga0207677_10037675
404 Ga0207703_10000323
405 Ga0207708_10008307
406 Ga0207641_10010950
407 Ga0207674_10000663
408 Ga0207674_10067078
409 Ga0207674_10095563
410 Ga0207675_100000347
411 Ga0207675_100034438
412 Ga0207675_100088929
413 Ga0207683_10017294
414 Ga0207428_10000583
415 Ga0207428_10001992
416 Ga0207428_10003079
417 Ga0207428_10019456
418 Ga0207428_10066455
419 Ga0268264_10074896
420 Ga0307408_100002843
421 Ga0307408_100021740
422 Ga0307416_100039704
423 Ga0373937_0052040
424 Ga0373937_0123481
425 Ga0395899_0018401
426 Ga0395898_0164393
427 Ga0395901_0024803
428 Ga0400489_40376
429 Ga0436365_1881959
430 Ga0451577_0011215
431 Ga0495638_0011956
432 Ga0495598_0000049
433 Ga0495621_0000100
434 Ga0496107_0076874
435 Ga0496108_0061387
436 Ga0496109_0000110
437 Ga0496109_0000735
438 Ga0496109_0141365
439 Ga0496112_0000222
440 Ga0496112_0001137
441 Ga0501298_002595
442 Ga0501040_0013358
443 nmdc:mga05p37_141622_c1
444 nmdc:mga05p37_25_c1
445 nmdc:mga05p37_2676_c1
446 nmdc:mga05p37_57804_c1
447 nmdc:mga09592_42884_c1
448 nmdc:mga09592_49442_c1
449 nmdc:mga06r32_10364_c1
450 nmdc:mga06r32_2008_c1
451 nmdc:mga06r32_93537_c1
452 nmdc:mga08y16_34288_c1
453 nmdc:mga08y16_62209_c1
454 nmdc:mga0n895_149545_c1
455 nmdc:mga0rr50_1844_c1
456 nmdc:mga08x19_27_c1
457 nmdc:mga08x19_43425_c1
458 nmdc:mga0a205_42834_c1
459 nmdc:mga0a205_57969_c1
460 nmdc:mga0a205_83327_c1
461 Ga0500555_000303
462 Ga0500568_0001484
463 Ga0500616_0000691
464 Ga0500645_000028
465 Ga0500599_000283
466 Ga0501084_0045102

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00326

Peptidase_S9

Prolyl oligopeptidase family

503

709

0.98

PF07676

PD40

WD40-like Beta Propeller Repeat

292

318

0.95

PF01738

DLH

Dienelactone hydrolase family

536

704

0.84

PF20434

BD-FAE

BD-FAE

472

666

0.82

PF07676

PD40

WD40-like Beta Propeller Repeat

157

192

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yzn-assembly1.cif.gz_C crystal structure of s9 peptidase (active form) from deinococcus radiodurans r1 0.8249 28 613
7ep9-assembly1.cif.gz_C the structure of carboxypeptidase from fusobacterium nucleatum 0.8239 27 613
5yzn-assembly1.cif.gz_D crystal structure of s9 peptidase (active form) from deinococcus radiodurans r1 0.8219 28 613
6ikg-assembly1.cif.gz_B crystal structure of substrate-bound s9 peptidase (s514a mutant) from deinococcus radiodurans 0.8208 28 613
6ikg-assembly1.cif.gz_C crystal structure of substrate-bound s9 peptidase (s514a mutant) from deinococcus radiodurans 0.8188 28 613
ID Description Score Start End Superfamily
5oljA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8964 354 613 3.40.50.1820
5oljA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8897 354 613 3.40.50.1820
af_Q9P778_407_680_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8888 356 626 3.40.50.1820
af_Q69Y12_406_672_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8887 352 620 3.40.50.1820
af_E7F5R8_581_840_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8881 353 613 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A0N8PQX3-F1-model_v4 Peptidase S9 prolyl oligopeptidase catalytic domain-containing protein 0.9418 427 613 GO:0004252
GO:0006508
AF-A0A137NUK3-F1-model_v4 Dipeptidyl-peptidase V 0.9406 428 613 GO:0004252
GO:0006508
AF-A0A818JW26-F1-model_v4 Peptidase S9 prolyl oligopeptidase catalytic domain-containing protein 0.9386 337 613 GO:0004252
GO:0006508
AF-A0A7C6A1V0-F1-model_v4 S9 family peptidase 0.9374 357 616 GO:0004252
GO:0006508
AF-X0WN35-F1-model_v4 Peptidase S9 prolyl oligopeptidase catalytic domain-containing protein 0.9302 429 613 GO:0004252
GO:0006508

Map